F487430

General Info

Members Datasets Scaffolds Average Seq Length
982 410 831 270

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0009001|Ga0495610_0009001_4430_5260
Length 276
Sequence MDSWVDGQPADSLSLKDRGLAYGDGLFETIAVHRGQPILLDRHLARLADGCSRLAIAADIELIRHELLSYAAAMGEGVLKLILSRGDGLRGYAPDPAAPGRRILQGNPPAVYPAAHAEHGVRLFPCSTRLATQPLLAGLKHLNRLEQVLARAEWQDSEHAEGLMLDQAGRVIEGVFSNVFLLRDGVLITPDLKRCGVAGVMRAEILFQAESLAIPTQIADISLEQLQWADEVFLCNSVYGVWPVRAYAALSWPVGPLTRKLKNHCPRPTGCLIRET

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
21 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
22 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
23 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
24 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
25 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
26 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
27 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
28 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
29 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
30 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
31 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
32 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
33 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
34 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
35 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
36 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
37 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
38 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
39 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
40 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
41 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
42 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
43 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
44 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
45 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
46 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
47 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
48 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
49 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
50 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
51 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
52 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
53 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
54 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
55 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
56 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
57 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
58 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
59 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
60 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
61 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
62 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
63 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
64 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
65 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
66 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
67 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
68 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
69 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
70 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
71 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
72 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
73 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
74 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
75 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
76 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
77 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
78 2773857670 Pseudomonas sp. 478 Isolate Unclassified
79 2773857673 Pseudomonas sp. 443 Isolate Unclassified
80 2784132063 Pseudomonas sp. 424 Isolate Unclassified
81 2784132072 Pseudomonas sp. 460 Isolate Unclassified
82 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
83 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
84 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
85 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
86 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
87 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
88 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
89 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
90 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
91 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
92 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
93 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
94 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
95 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
96 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
97 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
98 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
99 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
100 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
101 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
102 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
103 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
104 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
105 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
106 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
107 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
108 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
109 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
110 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
111 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
112 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
113 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
114 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
115 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
116 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
117 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
118 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
119 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
120 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
121 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
122 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
123 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
124 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
125 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
126 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
127 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
128 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
129 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
130 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
131 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
132 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
133 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
134 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
135 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
136 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
137 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
138 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
139 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
140 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
141 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
142 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
143 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
144 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
145 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
146 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
147 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
148 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
149 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
150 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
151 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
152 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
153 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
154 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
155 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
156 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
157 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
158 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
159 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
160 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
161 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
162 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
163 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
164 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
165 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
166 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
167 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
168 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
169 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
170 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
171 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
172 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
173 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
174 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
175 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
176 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
177 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
178 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
179 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
180 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
181 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
182 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
183 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
184 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
185 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
186 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
187 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
188 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
189 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
190 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
191 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
192 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
193 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
194 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
195 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
196 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
197 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
198 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
199 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
200 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
201 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
203 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
204 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
212 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
214 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
215 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
218 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
219 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
246 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
248 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
249 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
250 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
256 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
257 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
258 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
264 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
265 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
266 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
267 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
268 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
269 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
270 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
271 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
272 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
273 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
274 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
275 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
276 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
279 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
280 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
281 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
282 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
283 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
284 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
285 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
286 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
287 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
312 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
318 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
342 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
343 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
344 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
345 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
355 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
356 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
357 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
358 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
359 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
360 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
384 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
385 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
386 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
387 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
393 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
394 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
395 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
396 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
397 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
398 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
399 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
400 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
401 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
402 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
403 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
404 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
405 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
406 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
407 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
408 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
409 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
410 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.42
Metatranscriptomes 0.2
Isolates 15.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.94
Nodule 2.34
Rhizoplane 4.07
Rhizosphere 75.15
Stem 0
Stem Tuber 0
Unclassified 10.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5007 2124908027 Bacteria 12299
2 JGI25156J39149_1006926 3300002705 Bacteria 3042
3 JGI25162J39368_1000732 3300002737 Bacteria 22514
4 JGI25163J39215_1000824 3300002771 Bacteria 7443
5 JGI25163J39215_1000932 3300002771 Bacteria 6678
6 JGI25164J39214_1000085 3300002772 Bacteria 92776
7 JGI25164J39214_1000296 3300002772 Bacteria 34311
8 JGI25164J39214_1000469 3300002772 Bacteria 20276
9 JGI25165J46597_1000090 3300003214 Bacteria 168833
10 JGI25165J46597_1000528 3300003214 Bacteria 35737
11 JGI25165J46597_1000864 3300003214 Bacteria 21703
12 rootH1_10315725 3300003323 Bacteria 1700
13 Ga0055538_1000132 3300003751 Bacteria 54508
14 Ga0055539_1000177 3300003752 Bacteria 54508
15 Ga0055533_1000179 3300003756 Bacteria 54508
16 Ga0055532_1000179 3300003758 Bacteria 54508
17 Ga0055525_1000097 3300003759 Bacteria 137371
18 Ga0055525_1000408 3300003759 Bacteria 26491
19 Ga0055527_1000198 3300003760 Bacteria 39703
20 Ga0055535_1000795 3300003761 Bacteria 22979
21 Ga0055535_1001887 3300003761 Bacteria 8869
22 Ga0055542_1000441 3300003762 Bacteria 39703
23 Ga0055542_1001802 3300003762 Bacteria 8869
24 Ga0055529_1000591 3300003763 Bacteria 28451
25 Ga0055529_1001179 3300003763 Bacteria 10659
26 Ga0055536_1003265 3300003781 Bacteria 8790
27 Ga0055530_10000671 3300003791 Bacteria 29135
28 Ga0055530_10004397 3300003791 Bacteria 7269
29 Ga0055540_1000400 3300003792 Bacteria 35238
30 Ga0055531_10000202 3300003794 Bacteria 65776
31 Ga0055541_1000118 3300003841 Bacteria 54508
32 Ga0065714_10004576 3300005288 Bacteria 5814
33 Ga0065714_10008187 3300005288 Bacteria 5174
34 Ga0065714_10010654 3300005288 Bacteria 3220
35 Ga0065714_10015583 3300005288 Bacteria 3679
36 Ga0065714_10076538 3300005288 Bacteria 2779
37 Ga0065714_10077353 3300005288 Bacteria 2698
38 Ga0065714_10087468 3300005288 Bacteria 2056
39 Ga0065714_10198784 3300005288 Bacteria 902
40 Ga0065714_10203413 3300005288 Bacteria 886
41 Ga0065715_10002678 3300005293 Bacteria 5970
42 Ga0070661_100000284 3300005344 Bacteria 41018
43 Ga0070669_100001202 3300005353 Bacteria 18859
44 Ga0070663_100010411 3300005455 Bacteria 5796
45 Ga0070662_100000804 3300005457 Bacteria 19304
46 Ga0068853_100003812 3300005539 Bacteria 11552
47 Ga0070696_100037356 3300005546 Bacteria 3351
48 Ga0070693_100011231 3300005547 Bacteria 4507
49 Ga0070665_100013903 3300005548 Bacteria 8097
50 Ga0068855_100078707 3300005563 Bacteria 3824
51 Ga0070664_100000681 3300005564 Bacteria 25939
52 Ga0070664_100127710 3300005564 Bacteria 2232
53 Ga0068854_100023043 3300005578 Bacteria 4250
54 Ga0068856_100004288 3300005614 Bacteria 14229
55 Ga0068851_10000011 3300005834 Bacteria 178585
56 Ga0075363_100149968 3300006048 Bacteria 1316
57 Ga0075432_10004638 3300006058 Bacteria 4681
58 Ga0075432_10008264 3300006058 Bacteria 3547
59 Ga0075362_10156000 3300006177 Bacteria 1097
60 Ga0075362_10191915 3300006177 Bacteria 992
61 Ga0075369_10029817 3300006186 Bacteria 2294
62 Ga0075436_100086856 3300006914 Bacteria 2173
63 Ga0079104_1000668 3300006946 Bacteria 32257
64 Ga0079104_1020161 3300006946 Bacteria 1844
65 Ga0105251_10007772 3300009011 Bacteria 6536
66 Ga0105251_10008998 3300009011 Bacteria 5954
67 Ga0105251_10034102 3300009011 Bacteria 2522
68 Ga0105251_10039370 3300009011 Bacteria 2311
69 Ga0105251_10073371 3300009011 Bacteria 1590
70 Ga0105244_10004356 3300009036 Bacteria 9764
71 Ga0105244_10008269 3300009036 Bacteria 6512
72 Ga0105244_10013981 3300009036 Bacteria 4661
73 Ga0105244_10022306 3300009036 Bacteria 3486
74 Ga0105244_10026665 3300009036 Bacteria 3123
75 Ga0105244_10036096 3300009036 Bacteria 2592
76 Ga0105244_10172892 3300009036 Bacteria 1028
77 Ga0105250_10000074 3300009092 Bacteria 91652
78 Ga0105250_10004551 3300009092 Bacteria 6358
79 Ga0105250_10005278 3300009092 Bacteria 5804
80 Ga0105250_10043120 3300009092 Bacteria 1808
81 Ga0105250_10050418 3300009092 Bacteria 1670
82 Ga0105250_10072769 3300009092 Bacteria 1390
83 Ga0105250_10093544 3300009092 Bacteria 1224
84 Ga0105240_10084626 3300009093 Bacteria 3888
85 Ga0105243_10012583 3300009148 Bacteria 6396
86 Ga0105243_10031266 3300009148 Bacteria 4104
87 Ga0105243_10036090 3300009148 Bacteria 3834
88 Ga0105243_10041987 3300009148 Bacteria 3578
89 Ga0105242_10000626 3300009176 Bacteria 27761
90 Ga0105248_10011709 3300009177 Bacteria 9671
91 Ga0105237_10001599 3300009545 Bacteria 29440
92 Ga0105237_10001820 3300009545 Bacteria 27503
93 Ga0105238_10184205 3300009551 Bacteria 2065
94 Ga0105249_10601321 3300009553 Bacteria 1154
95 Ga0105246_10010995 3300011119 Bacteria 5610
96 Ga0105246_10110849 3300011119 Bacteria 2016
97 Ga0157373_10012012 3300013100 Bacteria 6365
98 Ga0157373_10012417 3300013100 Bacteria 6262
99 Ga0157373_10015562 3300013100 Bacteria 5560
100 Ga0157373_10017236 3300013100 Bacteria 5260
101 Ga0157373_10022847 3300013100 Bacteria 4535
102 Ga0157373_10055876 3300013100 Bacteria 2804
103 Ga0157371_10013522 3300013102 Bacteria 6195
104 Ga0157371_10019628 3300013102 Bacteria 4980
105 Ga0157371_10124521 3300013102 Bacteria 1833
106 Ga0157371_10142386 3300013102 Bacteria 1708
107 Ga0157371_10283324 3300013102 Bacteria 1197
108 Ga0157370_10024052 3300013104 Bacteria 6039
109 Ga0157370_10036318 3300013104 Bacteria 4783
110 Ga0157370_10115524 3300013104 Bacteria 2507
111 Ga0157370_10122730 3300013104 Bacteria 2426
112 Ga0157370_10151347 3300013104 Bacteria 2159
113 Ga0157370_10217875 3300013104 Bacteria 1768
114 Ga0157370_10259338 3300013104 Bacteria 1607
115 Ga0157370_10484147 3300013104 Bacteria 1137
116 Ga0157369_10003663 3300013105 Bacteria 18241
117 Ga0157369_10027825 3300013105 Bacteria 6263
118 Ga0157369_10028899 3300013105 Bacteria 6133
119 Ga0157369_10029490 3300013105 Bacteria 6062
120 Ga0157369_10142074 3300013105 Bacteria 2540
121 Ga0157369_10220782 3300013105 Bacteria 1984
122 Ga0157369_10221488 3300013105 Bacteria 1981
123 Ga0157369_10497624 3300013105 Bacteria 1261
124 Ga0163162_10000495 3300013306 Bacteria 36598
125 Ga0163162_10081968 3300013306 Bacteria 3297
126 Ga0163162_10278969 3300013306 Bacteria 1803
127 Ga0157372_10235741 3300013307 Bacteria 2122
128 Ga0157375_10021676 3300013308 Bacteria 5898
129 Ga0157375_10027977 3300013308 Bacteria 5277
130 Ga0157375_10171941 3300013308 Bacteria 2314
131 Ga0182008_10001674 3300014497 Bacteria 14583
132 Ga0182008_10008849 3300014497 Bacteria 5464
133 Ga0182008_10009722 3300014497 Bacteria 5179
134 Ga0182008_10009866 3300014497 Bacteria 5133
135 Ga0182008_10010494 3300014497 Bacteria 4955
136 Ga0182008_10017589 3300014497 Bacteria 3707
137 Ga0182008_10018048 3300014497 Bacteria 3655
138 Ga0182008_10146610 3300014497 Bacteria 1183
139 Ga0182006_1004541 3300015261 Bacteria 6831
140 Ga0182006_1004981 3300015261 Bacteria 6400
141 Ga0182006_1006695 3300015261 Bacteria 5331
142 Ga0182006_1011431 3300015261 Bacteria 3905
143 Ga0182006_1024345 3300015261 Bacteria 2497
144 Ga0182006_1035810 3300015261 Bacteria 1975
145 Ga0182006_1041324 3300015261 Bacteria 1810
146 Ga0182007_10004029 3300015262 Bacteria 6776
147 Ga0182007_10011611 3300015262 Bacteria 3423
148 Ga0182007_10104577 3300015262 Bacteria 939
149 Ga0182005_1002599 3300015265 Bacteria 6381
150 Ga0182005_1002754 3300015265 Bacteria 6133
151 Ga0163161_10010440 3300017792 Bacteria 6430
152 Ga0163161_10011813 3300017792 Bacteria 6056
153 Ga0163161_10012997 3300017792 Bacteria 5785
154 Ga0163161_10087788 3300017792 Bacteria 2298
155 Ga0163161_10117937 3300017792 Bacteria 1991
156 Ga0163161_10271736 3300017792 Bacteria 1327
157 Ga0206356_10901725 3300020070 Bacteria 1658
158 Ga0206353_11308317 3300020082 Bacteria 4469
159 Ga0209435_100479 3300025206 Bacteria 7904
160 Ga0209760_100114 3300025207 Bacteria 57573
161 Ga0209760_100337 3300025207 Bacteria 13875
162 Ga0209784_100173 3300025224 Bacteria 55534
163 Ga0209566_100226 3300025225 Bacteria 55534
164 Ga0209674_100216 3300025226 Bacteria 55534
165 Ga0209672_100007 3300025228 Bacteria 959482
166 Ga0209672_100389 3300025228 Bacteria 26663
167 Ga0209147_100229 3300025229 Bacteria 55534
168 Ga0209563_100079 3300025230 Bacteria 203017
169 Ga0209563_100224 3300025230 Bacteria 28175
170 Ga0209563_100338 3300025230 Bacteria 17932
171 Ga0207427_100001 3300025231 Bacteria 1410763
172 Ga0207427_100008 3300025231 Bacteria 740731
173 Ga0207427_100033 3300025231 Bacteria 338459
174 Ga0209437_100003 3300025233 Bacteria 1517827
175 Ga0209437_100014 3300025233 Bacteria 740714
176 Ga0209437_100105 3300025233 Bacteria 220034
177 Ga0209258_100046 3300025242 Bacteria 369794
178 Ga0209258_100095 3300025242 Bacteria 223270
179 Ga0209258_100386 3300025242 Bacteria 56316
180 Ga0209646_1000387 3300025246 Bacteria 28229
181 Ga0209646_1001353 3300025246 Bacteria 6760
182 Ga0209026_1000335 3300025250 Bacteria 45678
183 Ga0209677_100171 3300025253 Bacteria 55534
184 Ga0209148_1000039 3300025254 Bacteria 482479
185 Ga0209148_1000098 3300025254 Bacteria 233172
186 Ga0209759_1008946 3300025256 Bacteria 3077
187 Ga0209759_1008956 3300025256 Bacteria 3075
188 Ga0209233_1000007 3300025261 Bacteria 1411234
189 Ga0209233_1000008 3300025261 Bacteria 1356712
190 Ga0209233_1000080 3300025261 Bacteria 338459
191 Ga0209455_1000010 3300025272 Bacteria 959482
192 Ga0209455_1000034 3300025272 Bacteria 483129
193 Ga0209455_1000310 3300025272 Bacteria 49825
194 Ga0209675_1001650 3300025291 Bacteria 12430
195 Ga0209676_1000010 3300025292 Bacteria 954025
196 Ga0209676_1000021 3300025292 Bacteria 609534
197 Ga0209676_1000345 3300025292 Bacteria 88051
198 Ga0209050_1000081 3300025298 Bacteria 267533
199 Ga0209050_1000162 3300025298 Bacteria 155309
200 Ga0209050_1002674 3300025298 Bacteria 14539
201 Ga0209051_1000104 3300025303 Bacteria 161001
202 Ga0209051_1020234 3300025303 Bacteria 2873
203 Ga0209051_1023109 3300025303 Bacteria 2595
204 Ga0209257_1000040 3300025304 Bacteria 538759
205 Ga0207656_10000013 3300025321 Bacteria 160490
206 Ga0207696_1000045 3300025711 Bacteria 296484
207 Ga0207696_1000097 3300025711 Bacteria 175696
208 Ga0207696_1002467 3300025711 Bacteria 9046
209 Ga0207696_1013261 3300025711 Bacteria 2881
210 Ga0207696_1014766 3300025711 Bacteria 2668
211 Ga0207696_1019573 3300025711 Bacteria 2200
212 Ga0207696_1021596 3300025711 Bacteria 2059
213 Ga0207696_1057697 3300025711 Bacteria 1097
214 Ga0207655_1000005 3300025728 Bacteria 917277
215 Ga0207655_1000142 3300025728 Bacteria 137562
216 Ga0207655_1008691 3300025728 Bacteria 6409
217 Ga0207655_1011990 3300025728 Bacteria 5108
218 Ga0207655_1016994 3300025728 Bacteria 3947
219 Ga0207655_1017006 3300025728 Bacteria 3945
220 Ga0207655_1017633 3300025728 Bacteria 3840
221 Ga0207655_1028445 3300025728 Bacteria 2637
222 Ga0207655_1034139 3300025728 Bacteria 2291
223 Ga0207655_1034770 3300025728 Bacteria 2261
224 Ga0207655_1040731 3300025728 Bacteria 2000
225 Ga0207713_1000030 3300025735 Bacteria 284027
226 Ga0207713_1001006 3300025735 Bacteria 24570
227 Ga0207713_1002600 3300025735 Bacteria 13023
228 Ga0207713_1010546 3300025735 Bacteria 5108
229 Ga0207713_1022987 3300025735 Bacteria 2946
230 Ga0207713_1058047 3300025735 Bacteria 1493
231 Ga0207713_1058061 3300025735 Bacteria 1493
232 Ga0207713_1060121 3300025735 Bacteria 1454
233 Ga0207713_1063136 3300025735 Bacteria 1400
234 Ga0207695_10001592 3300025913 Bacteria 36863
235 Ga0207671_10000165 3300025914 Bacteria 103178
236 Ga0207671_10001137 3300025914 Bacteria 31975
237 Ga0207649_10000013 3300025920 Bacteria 255009
238 Ga0207681_10001353 3300025923 Bacteria 15834
239 Ga0207694_10068547 3300025924 Bacteria 2770
240 Ga0207650_10000077 3300025925 Bacteria 132010
241 Ga0207650_10000457 3300025925 Bacteria 34586
242 Ga0207706_10002991 3300025933 Bacteria 16297
243 Ga0207706_10013867 3300025933 Bacteria 7310
244 Ga0207686_10019202 3300025934 Bacteria 3883
245 Ga0207709_10000035 3300025935 Bacteria 300968
246 Ga0207709_10005497 3300025935 Bacteria 7192
247 Ga0207709_10031319 3300025935 Bacteria 3105
248 Ga0207711_10192460 3300025941 Bacteria 1859
249 Ga0207679_10000005 3300025945 Bacteria 525011
250 Ga0207667_10081214 3300025949 Bacteria 3358
251 Ga0207640_10105810 3300025981 Bacteria 1983
252 Ga0207639_10002794 3300026041 Bacteria 11720
253 Ga0207678_10001305 3300026067 Bacteria 23111
254 Ga0207702_10000231 3300026078 Bacteria 64867
255 Ga0209281_1000077 3300027111 Bacteria 262887
256 Ga0209281_1002389 3300027111 Bacteria 7645
257 Ga0209371_1000359 3300027312 Bacteria 49211
258 Ga0207428_10036878 3300027907 Bacteria 3983
259 Ga0207428_10085243 3300027907 Bacteria 2461
260 Ga0207428_10087582 3300027907 Bacteria 2423
261 Ga0207428_10104020 3300027907 Bacteria 2192
262 Ga0207428_10211549 3300027907 Bacteria 1456
263 Ga0268256_1000305 3300030500 Bacteria 49210
264 Ga0316177_1078523 3300030731 Bacteria 2810
265 Ga0316178_1072945 3300030735 Bacteria 12828
266 Ga0307408_100022832 3300031548 Bacteria 4255
267 Ga0307412_10011186 3300031911 Bacteria 5193
268 Ga0307412_10058519 3300031911 Bacteria 2578
269 Ga0307409_100121203 3300031995 Bacteria 2215
270 Ga0307510_10030497 3300033180 Bacteria 6112
271 Ga0439438_003655 3300041405 Bacteria 6144
272 Ga0439438_003712 3300041405 Bacteria 6070
273 Ga0439438_004492 3300041405 Bacteria 5334
274 Ga0439438_004546 3300041405 Bacteria 5289
275 Ga0439438_004833 3300041405 Bacteria 5076
276 Ga0439438_009790 3300041405 Bacteria 3080
277 Ga0439438_039860 3300041405 Bacteria 1222
278 Ga0439447_002684 3300041407 Bacteria 6443
279 Ga0439447_003481 3300041407 Bacteria 5593
280 Ga0439447_003500 3300041407 Bacteria 5572
281 Ga0439447_004420 3300041407 Bacteria 4837
282 Ga0439447_012937 3300041407 Bacteria 2381
283 Ga0439447_024393 3300041407 Bacteria 1566
284 Ga0439466_0002247 3300041411 Bacteria 7566
285 Ga0439466_0003822 3300041411 Bacteria 5814
286 Ga0439466_0004509 3300041411 Bacteria 5353
287 Ga0439466_0014661 3300041411 Bacteria 2851
288 Ga0439466_0050707 3300041411 Bacteria 1360
289 Ga0439465_0003421 3300041413 Bacteria 5176
290 Ga0451807_2733865 3300041486 Bacteria 1223
291 Ga0439431_0004399 3300041997 Bacteria 3097
292 Ga0439445_0011758 3300042004 Bacteria 2091
293 Ga0439432_003190 3300042006 Bacteria 6103
294 Ga0439432_009415 3300042006 Bacteria 3407
295 Ga0439432_016417 3300042006 Bacteria 2491
296 Ga0439432_020478 3300042006 Bacteria 2197
297 Ga0439451_002492 3300042009 Bacteria 3732
298 Ga0439452_002545 3300042010 Bacteria 6713
299 Ga0439452_003098 3300042010 Bacteria 5895
300 Ga0439452_004023 3300042010 Bacteria 5013
301 Ga0439452_005077 3300042010 Bacteria 4296
302 Ga0439452_013941 3300042010 Bacteria 2244
303 Ga0439456_010689 3300042013 Bacteria 1898
304 Ga0439456_011613 3300042013 Bacteria 1823
305 Ga0439456_039622 3300042013 Bacteria 1019
306 Ga0439456_040073 3300042013 Bacteria 1014
307 Ga0439456_046051 3300042013 Bacteria 950
308 Ga0439463_001951 3300042016 Bacteria 5365
309 Ga0439463_021196 3300042016 Bacteria 1623
310 Ga0450911_002967 3300042115 Bacteria 3130
311 Ga0450911_003734 3300042115 Bacteria 2622
312 Ga0450911_006215 3300042115 Bacteria 1791
313 Ga0450911_011144 3300042115 Bacteria 1234
314 Ga0450919_010851 3300042121 Bacteria 1037
315 Ga0450920_005991 3300042122 Bacteria 2175
316 Ga0450922_001519 3300042124 Bacteria 2273
317 Ga0450890_000530 3300042127 Bacteria 5625
318 Ga0450902_000722 3300042137 Bacteria 4224
319 Ga0450902_001237 3300042137 Bacteria 3438
320 Ga0450902_026099 3300042137 Bacteria 976
321 Ga0450903_004755 3300042138 Bacteria 2300
322 Ga0450903_007767 3300042138 Bacteria 1759
323 Ga0450905_012500 3300042142 Bacteria 1196
324 Ga0450906_002265 3300042145 Bacteria 4217
325 Ga0450907_001033 3300042146 Bacteria 6517
326 Ga0450907_007198 3300042146 Bacteria 1857
327 Ga0439446_0007648 3300042156 Bacteria 2847
328 Ga0450908_003567 3300042184 Bacteria 3030
329 Ga0450908_004856 3300042184 Bacteria 2584
330 Ga0450909_000392 3300042185 Bacteria 5578
331 Ga0450909_018263 3300042185 Bacteria 1041
332 Ga0450909_028066 3300042185 Bacteria 850
333 Ga0439434_0001710 3300042435 Bacteria 6369
334 Ga0439434_0027940 3300042435 Bacteria 1707
335 Ga0439464_0016553 3300042439 Bacteria 1994
336 Ga0439460_0002977 3300042461 Bacteria 4085
337 Ga0439460_0035001 3300042461 Bacteria 1450
338 Ga0450918_018789 3300042531 Bacteria 1206
339 Ga0450901_000122 3300042533 Bacteria 8475
340 Ga0439440_0006677 3300042993 Bacteria 2328
341 Ga0495617_000225 3300046452 Bacteria 34294
342 Ga0495617_003852 3300046452 Bacteria 5530
343 Ga0495617_004477 3300046452 Bacteria 5082
344 Ga0495617_039187 3300046452 Bacteria 1584
345 Ga0495617_057299 3300046452 Bacteria 1291
346 Ga0495627_000257 3300046453 Bacteria 54471
347 Ga0495627_000451 3300046453 Bacteria 35736
348 Ga0495627_009457 3300046453 Bacteria 3585
349 Ga0495627_067071 3300046453 Bacteria 1052
350 Ga0495592_0288559 3300046454 Bacteria 1070
351 Ga0495603_0002381 3300046455 Bacteria 11047
352 Ga0495603_0021821 3300046455 Bacteria 3877
353 Ga0495603_0037916 3300046455 Bacteria 2891
354 Ga0495603_0185250 3300046455 Bacteria 1204
355 Ga0495590_0004245 3300046457 Bacteria 5791
356 Ga0495590_0004738 3300046457 Bacteria 5454
357 Ga0495590_0020240 3300046457 Bacteria 2365
358 Ga0495590_0021327 3300046457 Bacteria 2296
359 Ga0495590_0110041 3300046457 Bacteria 983
360 Ga0495591_004826 3300046458 Bacteria 6429
361 Ga0495591_005086 3300046458 Bacteria 6175
362 Ga0495591_006137 3300046458 Bacteria 5384
363 Ga0495591_006343 3300046458 Bacteria 5248
364 Ga0495591_007626 3300046458 Bacteria 4568
365 Ga0495591_011702 3300046458 Bacteria 3304
366 Ga0495591_017012 3300046458 Bacteria 2510
367 Ga0495591_024620 3300046458 Bacteria 1904
368 Ga0495591_048272 3300046458 Bacteria 1174
369 Ga0495629_0209464 3300046459 Bacteria 1346
370 Ga0495638_0018185 3300046460 Bacteria 4671
371 Ga0495638_0020515 3300046460 Bacteria 4365
372 Ga0495638_0022371 3300046460 Bacteria 4151
373 Ga0495638_0035890 3300046460 Bacteria 3158
374 Ga0495638_0037932 3300046460 Bacteria 3064
375 Ga0495638_0063604 3300046460 Bacteria 2275
376 Ga0495638_0072792 3300046460 Bacteria 2099
377 Ga0495638_0082030 3300046460 Bacteria 1956
378 Ga0495638_0085338 3300046460 Bacteria 1909
379 Ga0495638_0096764 3300046460 Bacteria 1771
380 Ga0495638_0164514 3300046460 Bacteria 1277
381 Ga0495638_0222359 3300046460 Bacteria 1054
382 Ga0495638_0272469 3300046460 Bacteria 923
383 Ga0495653_0014639 3300046463 Bacteria 6399
384 Ga0495653_0014669 3300046463 Bacteria 6393
385 Ga0495653_0052181 3300046463 Bacteria 3135
386 Ga0495653_0061222 3300046463 Bacteria 2848
387 Ga0495653_0108430 3300046463 Bacteria 1999
388 Ga0495653_0145074 3300046463 Bacteria 1664
389 Ga0495650_0000853 3300046471 Bacteria 36611
390 Ga0495650_0008618 3300046471 Bacteria 5915
391 Ga0495650_0009821 3300046471 Bacteria 5404
392 Ga0495650_0023447 3300046471 Bacteria 2937
393 Ga0495650_0023701 3300046471 Bacteria 2916
394 Ga0495650_0104783 3300046471 Bacteria 1057
395 Ga0495582_0020275 3300046473 Bacteria 3638
396 Ga0495605_0000903 3300046474 Bacteria 20403
397 Ga0495605_0001530 3300046474 Bacteria 15010
398 Ga0495605_0010787 3300046474 Bacteria 5106
399 Ga0495605_0010841 3300046474 Bacteria 5090
400 Ga0495605_0012571 3300046474 Bacteria 4689
401 Ga0495605_0025150 3300046474 Bacteria 3104
402 Ga0495605_0029903 3300046474 Bacteria 2797
403 Ga0495605_0075634 3300046474 Bacteria 1583
404 Ga0495639_0000158 3300046475 Bacteria 34960
405 Ga0495639_0006561 3300046475 Bacteria 5004
406 Ga0495639_0062583 3300046475 Bacteria 1707
407 Ga0495639_0203296 3300046475 Bacteria 970
408 Ga0495584_0006126 3300046491 Bacteria 6323
409 Ga0495584_0007034 3300046491 Bacteria 5877
410 Ga0495584_0007144 3300046491 Bacteria 5834
411 Ga0495584_0008147 3300046491 Bacteria 5443
412 Ga0495584_0027676 3300046491 Bacteria 2872
413 Ga0495584_0028398 3300046491 Bacteria 2834
414 Ga0495584_0039964 3300046491 Bacteria 2369
415 Ga0495584_0100022 3300046491 Bacteria 1465
416 Ga0495585_0008120 3300046492 Bacteria 6378
417 Ga0495585_0009359 3300046492 Bacteria 5879
418 Ga0495585_0010239 3300046492 Bacteria 5595
419 Ga0495585_0014589 3300046492 Bacteria 4572
420 Ga0495585_0014716 3300046492 Bacteria 4551
421 Ga0495585_0022053 3300046492 Bacteria 3655
422 Ga0495585_0203333 3300046492 Bacteria 1007
423 Ga0495585_0223347 3300046492 Bacteria 949
424 Ga0495594_0010942 3300046499 Bacteria 4707
425 Ga0495594_0011583 3300046499 Bacteria 4585
426 Ga0495594_0017129 3300046499 Bacteria 3824
427 Ga0495594_0056928 3300046499 Bacteria 2158
428 Ga0495596_0004892 3300046500 Bacteria 6425
429 Ga0495596_0045684 3300046500 Bacteria 1722
430 Ga0495607_0000869 3300046501 Bacteria 28344
431 Ga0495607_0006360 3300046501 Bacteria 8317
432 Ga0495607_0007341 3300046501 Bacteria 7637
433 Ga0495607_0009030 3300046501 Bacteria 6778
434 Ga0495607_0014781 3300046501 Bacteria 5074
435 Ga0495607_0025554 3300046501 Bacteria 3671
436 Ga0495607_0031783 3300046501 Bacteria 3229
437 Ga0495607_0033106 3300046501 Bacteria 3147
438 Ga0495607_0033463 3300046501 Bacteria 3127
439 Ga0495607_0037857 3300046501 Bacteria 2893
440 Ga0495607_0059837 3300046501 Bacteria 2170
441 Ga0495607_0069096 3300046501 Bacteria 1978
442 Ga0495607_0145855 3300046501 Bacteria 1216
443 Ga0495607_0149734 3300046501 Bacteria 1195
444 Ga0495607_0189997 3300046501 Bacteria 1023
445 Ga0495583_0000521 3300046506 Bacteria 54646
446 Ga0495583_0008207 3300046506 Bacteria 6414
447 Ga0495583_0009383 3300046506 Bacteria 5853
448 Ga0495583_0017192 3300046506 Bacteria 3852
449 Ga0495583_0018242 3300046506 Bacteria 3697
450 Ga0495583_0052920 3300046506 Bacteria 1844
451 Ga0495583_0090412 3300046506 Bacteria 1319
452 Ga0495606_0008218 3300046507 Bacteria 9122
453 Ga0495606_0014967 3300046507 Bacteria 6015
454 Ga0495606_0015945 3300046507 Bacteria 5759
455 Ga0495606_0017185 3300046507 Bacteria 5480
456 Ga0495606_0020027 3300046507 Bacteria 4950
457 Ga0495606_0021665 3300046507 Bacteria 4701
458 Ga0495606_0021913 3300046507 Bacteria 4672
459 Ga0495610_0009001 3300046512 Bacteria 6375
460 Ga0495610_0009088 3300046512 Bacteria 6330
461 Ga0495610_0009663 3300046512 Bacteria 6072
462 Ga0495610_0010838 3300046512 Bacteria 5628
463 Ga0495610_0010961 3300046512 Bacteria 5583
464 Ga0495610_0011192 3300046512 Bacteria 5502
465 Ga0495610_0016561 3300046512 Bacteria 4236
466 Ga0495610_0017103 3300046512 Bacteria 4145
467 Ga0495610_0021570 3300046512 Bacteria 3538
468 Ga0495610_0022453 3300046512 Bacteria 3451
469 Ga0495616_0006907 3300046513 Bacteria 6835
470 Ga0495616_0007521 3300046513 Bacteria 6520
471 Ga0495616_0031688 3300046513 Bacteria 2766
472 Ga0495616_0036809 3300046513 Bacteria 2522
473 Ga0495616_0040658 3300046513 Bacteria 2374
474 Ga0495616_0040746 3300046513 Bacteria 2371
475 Ga0495616_0074250 3300046513 Bacteria 1639
476 Ga0495616_0107565 3300046513 Bacteria 1299
477 Ga0495616_0162218 3300046513 Bacteria 1004
478 Ga0495620_0002844 3300046515 Bacteria 9940
479 Ga0495620_0007056 3300046515 Bacteria 6128
480 Ga0495620_0010613 3300046515 Bacteria 4851
481 Ga0495620_0017763 3300046515 Bacteria 3538
482 Ga0495620_0020290 3300046515 Bacteria 3248
483 Ga0495620_0061060 3300046515 Bacteria 1569
484 Ga0495628_0181046 3300046516 Bacteria 1594
485 Ga0495630_0016649 3300046517 Bacteria 5376
486 Ga0495630_0018980 3300046517 Bacteria 5053
487 Ga0495630_0229999 3300046517 Bacteria 1416
488 Ga0495631_0000478 3300046518 Bacteria 26772
489 Ga0495631_0013312 3300046518 Bacteria 3995
490 Ga0495631_0015929 3300046518 Bacteria 3592
491 Ga0495631_0036200 3300046518 Bacteria 2205
492 Ga0495631_0064148 3300046518 Bacteria 1590
493 Ga0495631_0096372 3300046518 Bacteria 1273
494 Ga0495631_0137474 3300046518 Bacteria 1049
495 Ga0495632_0008307 3300046519 Bacteria 6392
496 Ga0495632_0008784 3300046519 Bacteria 6155
497 Ga0495632_0009540 3300046519 Bacteria 5838
498 Ga0495632_0012646 3300046519 Bacteria 4857
499 Ga0495632_0021411 3300046519 Bacteria 3483
500 Ga0495632_0046790 3300046519 Bacteria 2148
501 Ga0495632_0065324 3300046519 Bacteria 1757
502 Ga0495632_0152365 3300046519 Bacteria 1068
503 Ga0495637_0005988 3300046520 Bacteria 6148
504 Ga0495637_0006397 3300046520 Bacteria 5916
505 Ga0495637_0008319 3300046520 Bacteria 5101
506 Ga0495637_0013389 3300046520 Bacteria 3892
507 Ga0495637_0016295 3300046520 Bacteria 3475
508 Ga0495637_0019368 3300046520 Bacteria 3147
509 Ga0495637_0024487 3300046520 Bacteria 2731
510 Ga0495637_0028419 3300046520 Bacteria 2498
511 Ga0495637_0028490 3300046520 Bacteria 2494
512 Ga0495637_0056372 3300046520 Bacteria 1626
513 Ga0495643_0004605 3300046522 Bacteria 9598
514 Ga0495643_0009458 3300046522 Bacteria 6057
515 Ga0495643_0030091 3300046522 Bacteria 3034
516 Ga0495643_0035228 3300046522 Bacteria 2757
517 Ga0495643_0060090 3300046522 Bacteria 2018
518 Ga0495643_0074811 3300046522 Bacteria 1773
519 Ga0495643_0093988 3300046522 Bacteria 1543
520 Ga0495643_0110761 3300046522 Bacteria 1396
521 Ga0495643_0168391 3300046522 Bacteria 1073
522 Ga0495644_0003999 3300046523 Bacteria 5797
523 Ga0495644_0017355 3300046523 Bacteria 2752
524 Ga0495644_0025760 3300046523 Bacteria 2231
525 Ga0495644_0036872 3300046523 Bacteria 1844
526 Ga0495644_0107092 3300046523 Bacteria 1059
527 Ga0495648_0003220 3300046524 Bacteria 14476
528 Ga0495648_0011986 3300046524 Bacteria 6497
529 Ga0495648_0012916 3300046524 Bacteria 6201
530 Ga0495648_0013468 3300046524 Bacteria 6043
531 Ga0495648_0016867 3300046524 Bacteria 5248
532 Ga0495648_0017468 3300046524 Bacteria 5125
533 Ga0495648_0025421 3300046524 Bacteria 4009
534 Ga0495648_0053097 3300046524 Bacteria 2457
535 Ga0495648_0053759 3300046524 Bacteria 2437
536 Ga0495648_0057512 3300046524 Bacteria 2331
537 Ga0495648_0169917 3300046524 Bacteria 1118
538 Ga0495666_0020490 3300046526 Bacteria 3275
539 Ga0495666_0185577 3300046526 Bacteria 959
540 Ga0495642_0003041 3300046528 Bacteria 6680
541 Ga0495642_0003357 3300046528 Bacteria 6326
542 Ga0495642_0004114 3300046528 Bacteria 5674
543 Ga0495654_0000875 3300046530 Bacteria 22618
544 Ga0495654_0006669 3300046530 Bacteria 6535
545 Ga0495654_0006958 3300046530 Bacteria 6373
546 Ga0495654_0007930 3300046530 Bacteria 5899
547 Ga0495654_0007957 3300046530 Bacteria 5888
548 Ga0495654_0017519 3300046530 Bacteria 3765
549 Ga0495654_0025971 3300046530 Bacteria 3015
550 Ga0495654_0026914 3300046530 Bacteria 2952
551 Ga0495654_0042315 3300046530 Bacteria 2262
552 Ga0495654_0056846 3300046530 Bacteria 1891
553 Ga0495654_0137139 3300046530 Bacteria 1093
554 Ga0495654_0138496 3300046530 Bacteria 1086
555 Ga0495654_0174293 3300046530 Bacteria 935
556 Ga0495586_0087407 3300046535 Bacteria 1718
557 Ga0495609_0000349 3300046538 Bacteria 40285
558 Ga0495609_0005802 3300046538 Bacteria 6409
559 Ga0495609_0021143 3300046538 Bacteria 3001
560 Ga0495609_0071736 3300046538 Bacteria 1521
561 Ga0495609_0154400 3300046538 Bacteria 975
562 Ga0495597_0000221 3300046542 Bacteria 52360
563 Ga0495597_0007884 3300046542 Bacteria 5369
564 Ga0495597_0008152 3300046542 Bacteria 5268
565 Ga0495597_0030946 3300046542 Bacteria 2436
566 Ga0495597_0034302 3300046542 Bacteria 2293
567 Ga0495597_0054950 3300046542 Bacteria 1747
568 Ga0495597_0067832 3300046542 Bacteria 1542
569 Ga0495597_0117828 3300046542 Bacteria 1108
570 Ga0495597_0151905 3300046542 Bacteria 949
571 Ga0495645_0159026 3300046543 Bacteria 1563
572 Ga0495622_0004041 3300046557 Bacteria 6846
573 Ga0495622_0004608 3300046557 Bacteria 6385
574 Ga0495622_0014806 3300046557 Bacteria 3625
575 Ga0495622_0027627 3300046557 Bacteria 2648
576 Ga0495622_0031579 3300046557 Bacteria 2474
577 Ga0495622_0195993 3300046557 Bacteria 901
578 Ga0495622_0209532 3300046557 Bacteria 866
579 Ga0495633_0000287 3300046558 Bacteria 58020
580 Ga0495633_0019202 3300046558 Bacteria 3457
581 Ga0495633_0133599 3300046558 Bacteria 1148
582 Ga0495633_0165922 3300046558 Bacteria 1018
583 Ga0495656_0043668 3300046615 Bacteria 1883
584 Ga0495668_0008686 3300046616 Bacteria 6314
585 Ga0495668_0010764 3300046616 Bacteria 5523
586 Ga0495668_0193595 3300046616 Bacteria 1113
587 Ga0495634_0012371 3300046642 Bacteria 6179
588 Ga0495634_0348377 3300046642 Bacteria 887
589 Ga0495611_0000679 3300046648 Bacteria 19413
590 Ga0495611_0001919 3300046648 Bacteria 9881
591 Ga0495611_0010339 3300046648 Bacteria 3948
592 Ga0495611_0017803 3300046648 Bacteria 3043
593 Ga0495611_0060545 3300046648 Bacteria 1720
594 Ga0495625_0002270 3300046660 Bacteria 21124
595 Ga0495625_0014956 3300046660 Bacteria 6166
596 Ga0495625_0018168 3300046660 Bacteria 5496
597 Ga0495625_0051669 3300046660 Bacteria 2946
598 Ga0495625_0052634 3300046660 Bacteria 2914
599 Ga0495625_0055293 3300046660 Bacteria 2831
600 Ga0495625_0089787 3300046660 Bacteria 2126
601 Ga0495625_0097873 3300046660 Bacteria 2018
602 Ga0495625_0328531 3300046660 Bacteria 972
603 Ga0495635_0011871 3300046663 Bacteria 6105
604 Ga0495635_0078913 3300046663 Bacteria 2253
605 Ga0495659_0002188 3300046664 Bacteria 6375
606 Ga0495659_0017081 3300046664 Bacteria 2400
607 Ga0495659_0074843 3300046664 Bacteria 1274
608 Ga0495659_0127726 3300046664 Bacteria 1006
609 Ga0495661_0000028 3300046665 Bacteria 182191
610 Ga0495661_0000596 3300046665 Bacteria 37123
611 Ga0495661_0023404 3300046665 Bacteria 4011
612 Ga0495661_0032749 3300046665 Bacteria 3283
613 Ga0495661_0089635 3300046665 Bacteria 1752
614 Ga0495661_0230404 3300046665 Bacteria 955
615 Ga0495588_0046567 3300046674 Bacteria 2224
616 Ga0495657_0396699 3300046675 Bacteria 812
617 Ga0495623_0011027 3300046679 Bacteria 5847
618 Ga0495623_0040153 3300046679 Bacteria 2988
619 Ga0495646_0034820 3300046680 Bacteria 3125
620 Ga0495613_0028914 3300046689 Bacteria 4122
621 Ga0495613_0035907 3300046689 Bacteria 3676
622 Ga0495624_0010386 3300046690 Bacteria 6418
623 Ga0495670_0005708 3300046691 Bacteria 6104
624 Ga0495670_0005850 3300046691 Bacteria 6026
625 Ga0495670_0007057 3300046691 Bacteria 5531
626 Ga0495670_0009118 3300046691 Bacteria 4878
627 Ga0495670_0031281 3300046691 Bacteria 2644
628 Ga0495670_0061676 3300046691 Bacteria 1885
629 Ga0495671_0007066 3300046692 Bacteria 6428
630 Ga0495671_0011040 3300046692 Bacteria 4986
631 Ga0495671_0011460 3300046692 Bacteria 4875
632 Ga0495671_0018162 3300046692 Bacteria 3734
633 Ga0495671_0020947 3300046692 Bacteria 3440
634 Ga0495671_0022238 3300046692 Bacteria 3323
635 Ga0495671_0044886 3300046692 Bacteria 2214
636 Ga0495671_0111003 3300046692 Bacteria 1339
637 Ga0495671_0224292 3300046692 Bacteria 909
638 Ga0495671_0229791 3300046692 Bacteria 897
639 Ga0495649_0003758 3300046694 Bacteria 10081
640 Ga0495649_0007939 3300046694 Bacteria 6419
641 Ga0495649_0013301 3300046694 Bacteria 4752
642 Ga0495649_0027148 3300046694 Bacteria 3177
643 Ga0495649_0029908 3300046694 Bacteria 3009
644 Ga0495649_0049367 3300046694 Bacteria 2285
645 Ga0495649_0087794 3300046694 Bacteria 1659
646 Ga0495649_0159131 3300046694 Bacteria 1184
647 Ga0495649_0204193 3300046694 Bacteria 1025
648 Ga0495589_0005797 3300046794 Bacteria 6514
649 Ga0495589_0006835 3300046794 Bacteria 6001
650 Ga0495589_0007574 3300046794 Bacteria 5688
651 Ga0495589_0009516 3300046794 Bacteria 5050
652 Ga0495589_0012887 3300046794 Bacteria 4320
653 Ga0495589_0018694 3300046794 Bacteria 3552
654 Ga0495589_0021020 3300046794 Bacteria 3335
655 Ga0495589_0035241 3300046794 Bacteria 2510
656 Ga0495589_0053171 3300046794 Bacteria 1999
657 Ga0495600_0275706 3300046809 Bacteria 1066
658 Ga0495660_0001754 3300046810 Bacteria 14453
659 Ga0495660_0005255 3300046810 Bacteria 7766
660 Ga0495660_0014627 3300046810 Bacteria 4538
661 Ga0495660_0034942 3300046810 Bacteria 2810
662 Ga0495660_0051904 3300046810 Bacteria 2229
663 Ga0495660_0082870 3300046810 Bacteria 1678
664 Ga0495660_0126811 3300046810 Bacteria 1284
665 Ga0495581_0020117 3300047315 Bacteria 3875
666 Ga0495604_0014492 3300047317 Bacteria 6287
667 Ga0495604_0019863 3300047317 Bacteria 5375
668 Ga0495604_0080550 3300047317 Bacteria 2439
669 Ga0495604_0172488 3300047317 Bacteria 1520
670 Ga0495636_0023199 3300047318 Bacteria 2510
671 Ga0495674_0022886 3300047319 Bacteria 5758
672 Ga0495672_0004119 3300047320 Bacteria 12105
673 Ga0495672_0010951 3300047320 Bacteria 6430
674 Ga0495672_0010991 3300047320 Bacteria 6414
675 Ga0495672_0011802 3300047320 Bacteria 6137
676 Ga0495672_0012546 3300047320 Bacteria 5909
677 Ga0495672_0012897 3300047320 Bacteria 5795
678 Ga0495672_0025964 3300047320 Bacteria 3744
679 Ga0495672_0067681 3300047320 Bacteria 2033
680 Ga0495672_0188097 3300047320 Bacteria 1040
681 Ga0495676_0019306 3300047321 Bacteria 5997
682 Ga0495676_0044259 3300047321 Bacteria 3634
683 Ga0495676_0346046 3300047321 Bacteria 994
684 Ga0495680_0016282 3300047322 Bacteria 6394
685 Ga0495680_0020043 3300047322 Bacteria 5635
686 Ga0495680_0020798 3300047322 Bacteria 5509
687 Ga0495680_0022963 3300047322 Bacteria 5192
688 Ga0495680_0061528 3300047322 Bacteria 2888
689 Ga0495680_0110478 3300047322 Bacteria 2037
690 Ga0495683_0000053 3300047323 Bacteria 121769
691 Ga0495683_0000176 3300047323 Bacteria 62784
692 Ga0495683_0006693 3300047323 Bacteria 6277
693 Ga0495683_0027993 3300047323 Bacteria 2881
694 Ga0495683_0032221 3300047323 Bacteria 2670
695 Ga0495683_0106796 3300047323 Bacteria 1340
696 Ga0495687_000676 3300047443 Bacteria 38731
697 Ga0495687_008412 3300047443 Bacteria 5909
698 Ga0495687_011711 3300047443 Bacteria 4692
699 Ga0495687_016205 3300047443 Bacteria 3754
700 Ga0495675_0069826 3300047444 Bacteria 2217
701 Ga0495677_0004418 3300047445 Bacteria 5399
702 Ga0495679_002285 3300047446 Bacteria 9890
703 Ga0495679_013289 3300047446 Bacteria 3099
704 Ga0495679_015209 3300047446 Bacteria 2821
705 Ga0495679_073427 3300047446 Bacteria 981
706 Ga0495685_006994 3300047447 Bacteria 3713
707 Ga0495685_022697 3300047447 Bacteria 2160
708 Ga0495673_0000938 3300047469 Bacteria 26443
709 Ga0495673_0001495 3300047469 Bacteria 18488
710 Ga0495673_0002985 3300047469 Bacteria 11401
711 Ga0495673_0007204 3300047469 Bacteria 6428
712 Ga0495673_0007237 3300047469 Bacteria 6413
713 Ga0495673_0008958 3300047469 Bacteria 5574
714 Ga0495673_0012088 3300047469 Bacteria 4598
715 Ga0495673_0015257 3300047469 Bacteria 3962
716 Ga0495673_0020580 3300047469 Bacteria 3282
717 Ga0495673_0039272 3300047469 Bacteria 2148
718 Ga0495673_0064910 3300047469 Bacteria 1551
719 Ga0495673_0161633 3300047469 Bacteria 859
720 Ga0495681_0000588 3300047470 Bacteria 27772
721 Ga0495681_0005805 3300047470 Bacteria 8201
722 Ga0495681_0009539 3300047470 Bacteria 5964
723 Ga0495681_0009601 3300047470 Bacteria 5943
724 Ga0495681_0010451 3300047470 Bacteria 5617
725 Ga0495681_0010626 3300047470 Bacteria 5561
726 Ga0495681_0010743 3300047470 Bacteria 5516
727 Ga0495681_0020902 3300047470 Bacteria 3539
728 Ga0495681_0023530 3300047470 Bacteria 3270
729 Ga0495681_0029275 3300047470 Bacteria 2820
730 Ga0495681_0035413 3300047470 Bacteria 2479
731 Ga0495681_0041589 3300047470 Bacteria 2230
732 Ga0495681_0100436 3300047470 Bacteria 1265
733 Ga0495681_0151076 3300047470 Bacteria 974
734 Ga0495684_0154978 3300047471 Bacteria 1711
735 Ga0495684_0365772 3300047471 Bacteria 1020
736 Ga0495686_0018147 3300047472 Bacteria 4726
737 Ga0495686_0021228 3300047472 Bacteria 4318
738 Ga0495686_0023740 3300047472 Bacteria 4038
739 Ga0495686_0039147 3300047472 Bacteria 3029
740 Ga0495686_0285183 3300047472 Bacteria 917
741 Ga0495593_0059771 3300047673 Bacteria 1997
742 Ga0495593_0128828 3300047673 Bacteria 1285
743 Ga0495593_0209231 3300047673 Bacteria 979
744 Ga0495602_0133851 3300048088 Bacteria 1972
745 Ga0495602_0232462 3300048088 Bacteria 1384
746 Ga0495626_0000721 3300048091 Bacteria 30932
747 Ga0495626_0002158 3300048091 Bacteria 14181
748 Ga0495626_0007151 3300048091 Bacteria 6241
749 Ga0495626_0007269 3300048091 Bacteria 6177
750 Ga0495626_0008235 3300048091 Bacteria 5736
751 Ga0495626_0009970 3300048091 Bacteria 5102
752 Ga0495626_0010027 3300048091 Bacteria 5082
753 Ga0495626_0036297 3300048091 Bacteria 2348
754 Ga0496102_0017499 3300048905 Bacteria 6277
755 Ga0496103_0008923 3300048906 Bacteria 5944
756 Ga0496105_0379909 3300048908 Bacteria 1124
757 Ga0496110_0178192 3300048913 Bacteria 1930
758 Ga0496111_0094149 3300048914 Bacteria 2197
759 Ga0496115_0432897 3300048918 Bacteria 1064
760 Ga0496116_0001102 3300048919 Bacteria 32408
761 Ga0496116_0001892 3300048919 Bacteria 22607
762 Ga0496116_0013194 3300048919 Bacteria 6683
763 Ga0496116_0028107 3300048919 Bacteria 4080
764 Ga0496116_0036122 3300048919 Bacteria 3462
765 Ga0496116_0063853 3300048919 Bacteria 2370
766 Ga0496117_0002125 3300048920 Bacteria 25937
767 Ga0496117_0003138 3300048920 Bacteria 19704
768 Ga0496117_0021272 3300048920 Bacteria 5255
769 Ga0496117_0049167 3300048920 Bacteria 3003
770 Ga0496117_0106235 3300048920 Bacteria 1762
771 Ga0496117_0120247 3300048920 Bacteria 1615
772 Ga0496117_0229352 3300048920 Bacteria 1027
773 Ga0496118_0025614 3300048921 Bacteria 5050
774 Ga0496118_0032940 3300048921 Bacteria 4259
775 Ga0496118_0041866 3300048921 Bacteria 3620
776 Ga0496118_0157774 3300048921 Bacteria 1408
777 Ga0496118_0191515 3300048921 Bacteria 1222
778 Ga0496118_0227488 3300048921 Bacteria 1079
779 Ga0496119_0025020 3300048922 Bacteria 4179
780 Ga0496119_0089649 3300048922 Bacteria 1750
781 Ga0496119_0110366 3300048922 Bacteria 1528
782 Ga0496120_0032235 3300048923 Bacteria 3161
783 Ga0496120_0202094 3300048923 Bacteria 961
784 Ga0496121_0000781 3300048924 Bacteria 58375
785 Ga0496121_0046437 3300048924 Bacteria 3717
786 Ga0496121_0075467 3300048924 Bacteria 2693
787 Ga0496121_0193598 3300048924 Bacteria 1455
788 Ga0496122_0001762 3300048925 Bacteria 33218
789 Ga0496122_0018352 3300048925 Bacteria 6472
790 Ga0496122_0018887 3300048925 Bacteria 6333
791 Ga0496123_0001295 3300048926 Bacteria 35624
792 Ga0496123_0014533 3300048926 Bacteria 6518
793 Ga0496123_0159601 3300048926 Bacteria 1204
794 Ga0496124_0002323 3300048927 Bacteria 25088
795 Ga0496124_0026032 3300048927 Bacteria 5282
796 Ga0496124_0154606 3300048927 Bacteria 1795
797 Ga0496124_0162748 3300048927 Bacteria 1737
798 Ga0496124_0173757 3300048927 Bacteria 1665
799 Ga0496125_0002291 3300048928 Bacteria 25314
800 Ga0496125_0019099 3300048928 Bacteria 6479
801 Ga0496125_0054616 3300048928 Bacteria 3262
802 Ga0496125_0149095 3300048928 Bacteria 1610
803 Ga0496126_0146537 3300048929 Bacteria 2027
804 Ga0496126_0166247 3300048929 Bacteria 1882
805 Ga0496126_0582464 3300048929 Bacteria 884
806 Ga0495678_000362 3300049459 Bacteria 46331
807 Ga0495678_007338 3300049459 Bacteria 5724
808 Ga0495678_007420 3300049459 Bacteria 5681
809 Ga0495678_010370 3300049459 Bacteria 4535
810 Ga0495678_017505 3300049459 Bacteria 3246
811 Ga0495678_020346 3300049459 Bacteria 2941
812 Ga0495678_030754 3300049459 Bacteria 2243
813 Ga0495678_038732 3300049459 Bacteria 1926
814 Ga0495678_050308 3300049459 Bacteria 1615
815 Ga0495678_057954 3300049459 Bacteria 1465
816 Ga0495678_058781 3300049459 Bacteria 1452
817 Ga0495678_068185 3300049459 Bacteria 1312
818 Ga0495678_122652 3300049459 Bacteria 870
819 Ga0495682_0000344 3300049460 Bacteria 34342
820 Ga0495682_0016549 3300049460 Bacteria 2790
821 Ga0495682_0124754 3300049460 Bacteria 921
822 Ga0501227_065892 3300049665 Bacteria 935
823 Ga0501241_015355 3300049758 Bacteria 1392
824 Ga0501226_000022 3300049853 Bacteria 111874
825 nmdc:mga03n38_176280_c1 3300050490 Bacteria 1092
826 nmdc:mga00v17_267365_c1 3300050491 Bacteria 1110
827 nmdc:mga00v17_73054_c1 3300050491 Bacteria 2129
828 nmdc:mga08x19_267819_c1 3300050514 Bacteria 1182
829 nmdc:mga0sz30_22593_c1 3300050516 Bacteria 2554
830 Ga0500573_0031135 3300053140 Bacteria 3078
831 Ga0500634_0011370 3300053161 Bacteria 4591

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0396699 Ga0495657_0396699_20_721 233
2 3300025291 Ga0209675_1001650 Ga0209675_10016508 234
3 3300046512 Ga0495610_0022453 Ga0495610_0022453_10_714 234
4 3300046460 Ga0495638_0037932 Ga0495638_0037932_171_878 235
5 3300009036 Ga0105244_10004356 Ga0105244_1000435610 248
6 3300042439 Ga0439464_0016553 Ga0439464_0016553_992_1807 253
7 3300031548 Ga0307408_100022832 Ga0307408_1000228322 258
8 3300042013 Ga0439456_010689 Ga0439456_010689_1090_1869 259
9 3300042138 Ga0450903_007767 Ga0450903_007767_11_790 259
10 3300042185 Ga0450909_028066 Ga0450909_028066_41_820 259
11 3300046460 Ga0495638_0020515 Ga0495638_0020515_3565_4344 259
12 3300046501 Ga0495607_0059837 Ga0495607_0059837_1377_2156 259
13 3300046522 Ga0495643_0110761 Ga0495643_0110761_28_807 259
14 3300046530 Ga0495654_0137139 Ga0495654_0137139_279_1058 259
15 3300046542 Ga0495597_0008152 Ga0495597_0008152_4464_5243 259
16 3300046542 Ga0495597_0151905 Ga0495597_0151905_19_798 259
17 3300046665 Ga0495661_0023404 Ga0495661_0023404_3203_3982 259
18 3300047469 Ga0495673_0161633 Ga0495673_0161633_55_834 259
19 3300047472 Ga0495686_0285183 Ga0495686_0285183_18_797 259
20 3300002705 JGI25156J39149_1006926 JGI25156J39149_10069263 262
21 3300002737 JGI25162J39368_1000732 JGI25162J39368_10007329 262
22 3300002772 JGI25164J39214_1000085 JGI25164J39214_10000859 262
23 3300003214 JGI25165J46597_1000090 JGI25165J46597_100009086 262
24 3300003759 Ga0055525_1000097 Ga0055525_100009753 262
25 3300003760 Ga0055527_1000198 Ga0055527_100019820 262
26 3300003761 Ga0055535_1000795 Ga0055535_100079516 262
27 3300003761 Ga0055535_1001887 Ga0055535_10018879 262
28 3300003762 Ga0055542_1000441 Ga0055542_100044120 262
29 3300003762 Ga0055542_1001802 Ga0055542_10018023 262
30 3300003763 Ga0055529_1000591 Ga0055529_100059111 262
31 3300003763 Ga0055529_1001179 Ga0055529_100117910 262
32 3300005455 Ga0070663_100010411 Ga0070663_1000104112 262
33 3300005546 Ga0070696_100037356 Ga0070696_1000373562 262
34 3300005547 Ga0070693_100011231 Ga0070693_1000112313 262
35 3300005563 Ga0068855_100078707 Ga0068855_1000787072 262
36 3300005614 Ga0068856_100004288 Ga0068856_1000042882 262
37 3300009093 Ga0105240_10084626 Ga0105240_100846262 262
38 3300009545 Ga0105237_10001820 Ga0105237_1000182012 262
39 3300009551 Ga0105238_10184205 Ga0105238_101842052 262
40 3300013104 Ga0157370_10024052 Ga0157370_100240525 262
41 3300013105 Ga0157369_10003663 Ga0157369_1000366317 262
42 3300020070 Ga0206356_10901725 Ga0206356_109017251 262
43 3300020082 Ga0206353_11308317 Ga0206353_113083175 262
44 3300025228 Ga0209672_100007 Ga0209672_100007187 262
45 3300025228 Ga0209672_100389 Ga0209672_1003893 262
46 3300025230 Ga0209563_100079 Ga0209563_10007952 262
47 3300025231 Ga0207427_100033 Ga0207427_100033232 262
48 3300025233 Ga0209437_100105 Ga0209437_100105131 262
49 3300025242 Ga0209258_100046 Ga0209258_100046150 262
50 3300025242 Ga0209258_100095 Ga0209258_100095179 262
51 3300025246 Ga0209646_1001353 Ga0209646_10013539 262
52 3300025250 Ga0209026_1000335 Ga0209026_100033519 262
53 3300025254 Ga0209148_1000039 Ga0209148_1000039391 262
54 3300025254 Ga0209148_1000098 Ga0209148_100009821 262
55 3300025256 Ga0209759_1008956 Ga0209759_10089564 262
56 3300025261 Ga0209233_1000080 Ga0209233_1000080232 262
57 3300025272 Ga0209455_1000010 Ga0209455_1000010187 262
58 3300025272 Ga0209455_1000034 Ga0209455_1000034392 262
59 3300025272 Ga0209455_1000310 Ga0209455_100031021 262
60 3300025913 Ga0207695_10001592 Ga0207695_100015926 262
61 3300025914 Ga0207671_10001137 Ga0207671_1000113735 262
62 3300025924 Ga0207694_10068547 Ga0207694_100685472 262
63 3300025949 Ga0207667_10081214 Ga0207667_100812142 262
64 3300025981 Ga0207640_10105810 Ga0207640_101058103 262
65 3300026067 Ga0207678_10001305 Ga0207678_1000130512 262
66 3300026078 Ga0207702_10000231 Ga0207702_1000023112 262
67 iso_pu_bacteria 3007252601 3007253137 266
68 iso_pu_bacteria 3007315729 3007318085 266
69 iso_pu_bacteria 2511231004 2511256779 267
70 iso_pu_bacteria 2511231006 2511266738 267
71 iso_pu_bacteria 2511231007 2511274726 267
72 iso_pu_bacteria 2511231008 2511277746 267
73 iso_pu_bacteria 2511231010 2511287627 267
74 iso_pu_bacteria 2511231011 2511297540 267
75 iso_pu_bacteria 2511231012 2511303141 267
76 iso_pu_bacteria 2511231014 2511314148 267
77 iso_pu_bacteria 2511231015 2511319695 267
78 iso_pu_bacteria 2511231016 2511329036 267
79 iso_pu_bacteria 2511231017 2511330503 267
80 iso_pu_bacteria 2511231018 2511339682 267
81 iso_pu_bacteria 2511231019 2511344981 267
82 iso_pu_bacteria 2511231020 2511350712 267
83 iso_pu_bacteria 2511231021 2511360103 267
84 iso_pu_bacteria 2511231022 2511360766 267
85 iso_pu_bacteria 2511231023 2511371462 267
86 iso_pu_bacteria 2511231031 2511410696 267
87 iso_pu_bacteria 2512047018 2512324763 267
88 iso_pu_bacteria 2554235341 2555668778 267
89 iso_pu_bacteria 2582580891 2583793841 267
90 iso_pu_bacteria 2597489887 2597856969 267
91 iso_pu_bacteria 2597489889 2597871259 267
92 iso_pu_bacteria 2599185160 2599357153 267
93 iso_pu_bacteria 2599185161 2599362060 267
94 iso_pu_bacteria 2599185162 2599368380 267
95 iso_pu_bacteria 2599185163 2599375169 267
96 iso_pu_bacteria 2599185164 2599382258 267
97 iso_pu_bacteria 2599185165 2599388705 267
98 iso_pu_bacteria 2599185166 2599394027 267
99 iso_pu_bacteria 2599185167 2599402025 267
100 iso_pu_bacteria 2599185168 2599405792 267
101 iso_pu_bacteria 2599185179 2599454283 267
102 iso_pu_bacteria 2599185181 2599464346 267
103 iso_pu_bacteria 2599185182 2599468666 267
104 iso_pu_bacteria 2599185185 2599483993 267
105 iso_pu_bacteria 2599185186 2599493365 267
106 iso_pu_bacteria 2599185188 2599504316 267
107 iso_pu_bacteria 2599185189 2599510653 267
108 iso_pu_bacteria 2599185190 2599512321 267
109 iso_pu_bacteria 2599185191 2599520480 267
110 iso_pu_bacteria 2599185257 2599801644 267
111 iso_pu_bacteria 2599185290 2599890997 267
112 iso_pu_bacteria 2599185300 2599933423 267
113 iso_pu_bacteria 2599185356 2600216623 267
114 iso_pu_bacteria 2600254931 2600365932 267
115 iso_pu_bacteria 2600255296 2601689290 267
116 iso_pu_bacteria 2600255313 2601776784 267
117 iso_pu_bacteria 2600255318 2601796409 267
118 iso_pu_bacteria 2603880185 2606073559 267
119 iso_pu_bacteria 2603880199 2606126797 267
120 iso_pu_bacteria 2606217733 2608381787 267
121 iso_pu_bacteria 2619619299 2621298057 267
122 iso_pu_bacteria 2623620443 2624482057 267
123 iso_pu_bacteria 2623620446 2624490858 267
124 iso_pu_bacteria 2643221565 2643845097 267
125 iso_pu_bacteria 2643221571 2643871789 267
126 iso_pu_bacteria 2643221589 2643956623 267
127 iso_pu_bacteria 2643221602 2644025334 267
128 iso_pu_bacteria 2643221633 2644187685 267
129 iso_pu_bacteria 2643221713 2644624288 267
130 iso_pu_bacteria 2667528171 2671098699 267
131 iso_pu_bacteria 2671180172 2671768593 267
132 iso_pu_bacteria 2675903420 2677900199 267
133 iso_pu_bacteria 2713897148 2715751367 267
134 iso_pu_bacteria 2713897149 2715758358 267
135 iso_pu_bacteria 2718217725 2718635299 267
136 iso_pu_bacteria 2721755607 2723250166 267
137 iso_pu_bacteria 2738541265 2738675189 267
138 iso_pu_bacteria 2738541282 2738753593 267
139 iso_pu_bacteria 2738541303 2738862582 267
140 iso_pu_bacteria 2738543004 2739197040 267
141 iso_pu_bacteria 2738543015 2739259109 267
142 iso_pu_bacteria 2738543025 2739315094 267
143 iso_pu_bacteria 2740892503 2743736394 267
144 iso_pu_bacteria 2773857670 2774122696 267
145 iso_pu_bacteria 2773857673 2774132995 267
146 iso_pu_bacteria 2784132063 2784263178 267
147 iso_pu_bacteria 2784132072 2784317934 267
148 iso_pu_bacteria 2791355520 2794595940 267
149 iso_pu_bacteria 2808606373 2808907606 267
150 iso_pu_bacteria 2808606377 2808929853 267
151 iso_pu_bacteria 2808606381 2808952072 267
152 iso_pu_bacteria 2808606382 2808957201 267
153 iso_pu_bacteria 2808606445 2809218981 267
154 iso_pu_bacteria 2816332298 2817492803 267
155 iso_pu_bacteria 2818991456 2819655795 267
156 iso_pu_bacteria 2818991464 2819703820 267
157 iso_pu_bacteria 2823421272 2823424428 267
158 iso_pu_bacteria 2826581358 2826583629 267
159 iso_pu_bacteria 2834028612 2834031592 267
160 iso_pu_bacteria 2842815866 2842818125 267
161 iso_pu_bacteria 2842826826 2842827385 267
162 iso_pu_bacteria 2842832357 2842836659 267
163 iso_pu_bacteria 2842837860 2842843064 267
164 iso_pu_bacteria 2842843487 2842844775 267
165 iso_pu_bacteria 2842849001 2842849240 267
166 iso_pu_bacteria 2852657418 2852661383 267
167 iso_pu_bacteria 2860339153 2860340959 267
168 iso_pu_bacteria 2878029506 2878034038 267
169 iso_pu_bacteria 2880230671 2880234663 267
170 iso_pu_bacteria 2904518522 2904521203 267
171 iso_pu_bacteria 2904550169 2904555232 267
172 iso_pu_bacteria 2917070673 2917072554 267
173 iso_pu_bacteria 2919063839 2919069340 267
174 iso_pu_bacteria 2919385768 2919388138 267
175 iso_pu_bacteria 2919456309 2919460940 267
176 iso_pu_bacteria 2919487758 2919489675 267
177 iso_pu_bacteria 2919501602 2919504155 267
178 iso_pu_bacteria 2919697872 2919703284 267
179 iso_pu_bacteria 2923153595 2923155408 267
180 iso_pu_bacteria 2926063275 2926065272 267
181 iso_pu_bacteria 2929189879 2929193971 267
182 iso_pu_bacteria 2931390751 2931395263 267
183 iso_pu_bacteria 2931396565 2931396701 267
184 iso_pu_bacteria 2935353572 2935354718 267
185 iso_pu_bacteria 2939636861 2939637498 267
186 iso_pu_bacteria 2946027586 2946032465 267
187 iso_pu_bacteria 2947233263 2947239274 267
188 iso_pu_bacteria 2969304461 2969308818 267
189 iso_pu_bacteria 2974289157 2974289805 267
190 iso_pu_bacteria 2984286254 2984290625 267
191 iso_pu_bacteria 2998139840 2998144121 267
192 iso_pu_bacteria 3007395558 3007400947 267
193 iso_pu_bacteria 3007419365 3007424368 267
194 iso_pu_bacteria 3007511990 3007515873 267
195 iso_pu_bacteria 3007614139 3007619615 267
196 iso_pu_bacteria 3007619802 3007619953 267
197 iso_pu_bacteria 3007718800 3007719046 267
198 iso_pu_bacteria 3007855910 3007858896 267
199 iso_pu_bacteria 3007861166 3007865551 267
200 iso_pu_bacteria 8015687852 8015689629 267
201 iso_pu_bacteria 8019775933 8019779415 267
202 iso_pu_bacteria 8029995093 8029996760 267
203 iso_pu_bacteria 8054285046 8054289523 267
204 iso_pu_bacteria 8054347763 8054349106 267
205 iso_pu_bacteria 8055770955 8055772765 267
206 iso_pu_bacteria 8055817908 8055822703 267
207 iso_pu_bacteria 8056125926 8056130392 267
208 iso_pu_bacteria 8056131705 8056136154 267
209 iso_pu_bacteria 8056148874 8056150032 267
210 iso_pu_bacteria 8056155041 8056155168 267
211 iso_pu_bacteria 8056161164 8056162411 267
212 iso_pu_bacteria 8056166840 8056167163 267
213 iso_pu_bacteria 8056172158 8056173132 267
214 iso_pu_bacteria 8056177738 8056180120 267
215 iso_pu_bacteria 8056569372 8056572859 267
216 3300046512 Ga0495610_0009001 Ga0495610_0009001_4430_5260 268
217 iso_pu_bacteria 2597489888 2597862606 268
218 iso_pu_bacteria 637000220 637319138 268
219 3300009011 Ga0105251_10073371 Ga0105251_100733712 270
220 3300013102 Ga0157371_10019628 Ga0157371_100196286 270
221 3300015261 Ga0182006_1006695 Ga0182006_10066954 270
222 3300027312 Ga0209371_1000359 Ga0209371_10003593 270
223 3300030500 Ga0268256_1000305 Ga0268256_10003053 270
224 3300042010 Ga0439452_013941 Ga0439452_013941_960_1772 270
225 3300048926 Ga0496123_0159601 Ga0496123_0159601_203_1015 270
226 2124908027 MRS2a_Contig_5007 MRS2a_00558570 271
227 3300002771 JGI25163J39215_1000824 JGI25163J39215_10008242 271
228 3300002771 JGI25163J39215_1000932 JGI25163J39215_10009322 271
229 3300002772 JGI25164J39214_1000296 JGI25164J39214_10002963 271
230 3300002772 JGI25164J39214_1000469 JGI25164J39214_100046920 271
231 3300003214 JGI25165J46597_1000528 JGI25165J46597_10005283 271
232 3300003214 JGI25165J46597_1000864 JGI25165J46597_100086420 271
233 3300003323 rootH1_10315725 rootH1_103157252 271
234 3300003751 Ga0055538_1000132 Ga0055538_100013220 271
235 3300003752 Ga0055539_1000177 Ga0055539_100017720 271
236 3300003756 Ga0055533_1000179 Ga0055533_100017920 271
237 3300003758 Ga0055532_1000179 Ga0055532_100017937 271
238 3300003759 Ga0055525_1000408 Ga0055525_100040820 271
239 3300003781 Ga0055536_1003265 Ga0055536_10032652 271
240 3300003791 Ga0055530_10000671 Ga0055530_1000067131 271
241 3300003791 Ga0055530_10004397 Ga0055530_100043978 271
242 3300003792 Ga0055540_1000400 Ga0055540_100040039 271
243 3300003794 Ga0055531_10000202 Ga0055531_1000020231 271
244 3300003841 Ga0055541_1000118 Ga0055541_100011820 271
245 3300005288 Ga0065714_10004576 Ga0065714_100045762 271
246 3300005288 Ga0065714_10008187 Ga0065714_100081872 271
247 3300005288 Ga0065714_10010654 Ga0065714_100106543 271
248 3300005288 Ga0065714_10015583 Ga0065714_100155832 271
249 3300005288 Ga0065714_10076538 Ga0065714_100765382 271
250 3300005288 Ga0065714_10077353 Ga0065714_100773532 271
251 3300005288 Ga0065714_10087468 Ga0065714_100874681 271
252 3300005288 Ga0065714_10198784 Ga0065714_101987841 271
253 3300005288 Ga0065714_10203413 Ga0065714_102034131 271
254 3300005293 Ga0065715_10002678 Ga0065715_100026782 271
255 3300005344 Ga0070661_100000284 Ga0070661_10000028419 271
256 3300005353 Ga0070669_100001202 Ga0070669_10000120219 271
257 3300005457 Ga0070662_100000804 Ga0070662_1000008047 271
258 3300005539 Ga0068853_100003812 Ga0068853_1000038126 271
259 3300005548 Ga0070665_100013903 Ga0070665_1000139038 271
260 3300005564 Ga0070664_100000681 Ga0070664_1000006818 271
261 3300005564 Ga0070664_100127710 Ga0070664_1001277102 271
262 3300005578 Ga0068854_100023043 Ga0068854_1000230434 271
263 3300005834 Ga0068851_10000011 Ga0068851_1000001186 271
264 3300006048 Ga0075363_100149968 Ga0075363_1001499682 271
265 3300006058 Ga0075432_10004638 Ga0075432_100046382 271
266 3300006058 Ga0075432_10008264 Ga0075432_100082642 271
267 3300006177 Ga0075362_10156000 Ga0075362_101560002 271
268 3300006177 Ga0075362_10191915 Ga0075362_101919151 271
269 3300006186 Ga0075369_10029817 Ga0075369_100298172 271
270 3300006914 Ga0075436_100086856 Ga0075436_1000868562 271
271 3300006946 Ga0079104_1000668 Ga0079104_100066828 271
272 3300006946 Ga0079104_1020161 Ga0079104_10201612 271
273 3300009011 Ga0105251_10007772 Ga0105251_100077726 271
274 3300009011 Ga0105251_10008998 Ga0105251_100089982 271
275 3300009011 Ga0105251_10034102 Ga0105251_100341022 271
276 3300009011 Ga0105251_10039370 Ga0105251_100393702 271
277 3300009036 Ga0105244_10008269 Ga0105244_100082692 271
278 3300009036 Ga0105244_10013981 Ga0105244_100139814 271
279 3300009036 Ga0105244_10022306 Ga0105244_100223062 271
280 3300009036 Ga0105244_10026665 Ga0105244_100266652 271
281 3300009036 Ga0105244_10036096 Ga0105244_100360962 271
282 3300009036 Ga0105244_10172892 Ga0105244_101728921 271
283 3300009092 Ga0105250_10000074 Ga0105250_100000747 271
284 3300009092 Ga0105250_10004551 Ga0105250_100045516 271
285 3300009092 Ga0105250_10005278 Ga0105250_100052782 271
286 3300009092 Ga0105250_10043120 Ga0105250_100431202 271
287 3300009092 Ga0105250_10050418 Ga0105250_100504182 271
288 3300009092 Ga0105250_10072769 Ga0105250_100727692 271
289 3300009092 Ga0105250_10093544 Ga0105250_100935442 271
290 3300009148 Ga0105243_10012583 Ga0105243_100125832 271
291 3300009148 Ga0105243_10031266 Ga0105243_100312664 271
292 3300009148 Ga0105243_10036090 Ga0105243_100360903 271
293 3300009148 Ga0105243_10041987 Ga0105243_100419873 271
294 3300009176 Ga0105242_10000626 Ga0105242_100006266 271
295 3300009177 Ga0105248_10011709 Ga0105248_100117092 271
296 3300009545 Ga0105237_10001599 Ga0105237_1000159912 271
297 3300009553 Ga0105249_10601321 Ga0105249_106013212 271
298 3300011119 Ga0105246_10010995 Ga0105246_100109953 271
299 3300011119 Ga0105246_10110849 Ga0105246_101108492 271
300 3300013100 Ga0157373_10012012 Ga0157373_100120122 271
301 3300013100 Ga0157373_10012417 Ga0157373_100124176 271
302 3300013100 Ga0157373_10015562 Ga0157373_100155622 271
303 3300013100 Ga0157373_10017236 Ga0157373_100172362 271
304 3300013100 Ga0157373_10022847 Ga0157373_100228474 271
305 3300013100 Ga0157373_10055876 Ga0157373_100558762 271
306 3300013102 Ga0157371_10013522 Ga0157371_100135225 271
307 3300013102 Ga0157371_10124521 Ga0157371_101245211 271
308 3300013102 Ga0157371_10142386 Ga0157371_101423861 271
309 3300013102 Ga0157371_10283324 Ga0157371_102833242 271
310 3300013104 Ga0157370_10036318 Ga0157370_100363185 271
311 3300013104 Ga0157370_10115524 Ga0157370_101155242 271
312 3300013104 Ga0157370_10122730 Ga0157370_101227302 271
313 3300013104 Ga0157370_10151347 Ga0157370_101513472 271
314 3300013104 Ga0157370_10217875 Ga0157370_102178752 271
315 3300013104 Ga0157370_10259338 Ga0157370_102593382 271
316 3300013104 Ga0157370_10484147 Ga0157370_104841471 271
317 3300013105 Ga0157369_10027825 Ga0157369_100278252 271
318 3300013105 Ga0157369_10028899 Ga0157369_100288992 271
319 3300013105 Ga0157369_10029490 Ga0157369_100294902 271
320 3300013105 Ga0157369_10142074 Ga0157369_101420742 271
321 3300013105 Ga0157369_10220782 Ga0157369_102207821 271
322 3300013105 Ga0157369_10221488 Ga0157369_102214882 271
323 3300013105 Ga0157369_10497624 Ga0157369_104976242 271
324 3300013306 Ga0163162_10000495 Ga0163162_1000049537 271
325 3300013306 Ga0163162_10081968 Ga0163162_100819683 271
326 3300013306 Ga0163162_10278969 Ga0163162_102789692 271
327 3300013307 Ga0157372_10235741 Ga0157372_102357412 271
328 3300013308 Ga0157375_10021676 Ga0157375_100216762 271
329 3300013308 Ga0157375_10027977 Ga0157375_100279772 271
330 3300013308 Ga0157375_10171941 Ga0157375_101719413 271
331 3300014497 Ga0182008_10001674 Ga0182008_1000167414 271
332 3300014497 Ga0182008_10008849 Ga0182008_100088492 271
333 3300014497 Ga0182008_10009722 Ga0182008_100097222 271
334 3300014497 Ga0182008_10009866 Ga0182008_100098665 271
335 3300014497 Ga0182008_10010494 Ga0182008_100104945 271
336 3300014497 Ga0182008_10017589 Ga0182008_100175892 271
337 3300014497 Ga0182008_10018048 Ga0182008_100180484 271
338 3300014497 Ga0182008_10146610 Ga0182008_101466102 271
339 3300015261 Ga0182006_1004541 Ga0182006_10045416 271
340 3300015261 Ga0182006_1004981 Ga0182006_10049816 271
341 3300015261 Ga0182006_1011431 Ga0182006_10114314 271
342 3300015261 Ga0182006_1024345 Ga0182006_10243453 271
343 3300015261 Ga0182006_1035810 Ga0182006_10358101 271
344 3300015261 Ga0182006_1041324 Ga0182006_10413242 271
345 3300015262 Ga0182007_10004029 Ga0182007_100040296 271
346 3300015262 Ga0182007_10011611 Ga0182007_100116112 271
347 3300015262 Ga0182007_10104577 Ga0182007_101045771 271
348 3300015265 Ga0182005_1002599 Ga0182005_10025992 271
349 3300015265 Ga0182005_1002754 Ga0182005_10027542 271
350 3300017792 Ga0163161_10010440 Ga0163161_100104406 271
351 3300017792 Ga0163161_10011813 Ga0163161_100118132 271
352 3300017792 Ga0163161_10012997 Ga0163161_100129972 271
353 3300017792 Ga0163161_10087788 Ga0163161_100877882 271
354 3300017792 Ga0163161_10117937 Ga0163161_101179371 271
355 3300017792 Ga0163161_10271736 Ga0163161_102717362 271
356 3300025206 Ga0209435_100479 Ga0209435_1004795 271
357 3300025207 Ga0209760_100114 Ga0209760_10011451 271
358 3300025207 Ga0209760_100337 Ga0209760_1003372 271
359 3300025224 Ga0209784_100173 Ga0209784_10017321 271
360 3300025225 Ga0209566_100226 Ga0209566_10022621 271
361 3300025226 Ga0209674_100216 Ga0209674_10021621 271
362 3300025229 Ga0209147_100229 Ga0209147_10022937 271
363 3300025230 Ga0209563_100224 Ga0209563_10022413 271
364 3300025230 Ga0209563_100338 Ga0209563_10033817 271
365 3300025231 Ga0207427_100001 Ga0207427_1000011041 271
366 3300025231 Ga0207427_100008 Ga0207427_100008423 271
367 3300025233 Ga0209437_100003 Ga0209437_100003331 271
368 3300025233 Ga0209437_100014 Ga0209437_100014288 271
369 3300025242 Ga0209258_100386 Ga0209258_10038637 271
370 3300025246 Ga0209646_1000387 Ga0209646_100038713 271
371 3300025253 Ga0209677_100171 Ga0209677_10017121 271
372 3300025256 Ga0209759_1008946 Ga0209759_10089462 271
373 3300025261 Ga0209233_1000007 Ga0209233_10000071041 271
374 3300025261 Ga0209233_1000008 Ga0209233_1000008288 271
375 3300025292 Ga0209676_1000010 Ga0209676_1000010248 271
376 3300025292 Ga0209676_1000021 Ga0209676_1000021355 271
377 3300025292 Ga0209676_1000345 Ga0209676_10003452 271
378 3300025298 Ga0209050_1000081 Ga0209050_10000812 271
379 3300025298 Ga0209050_1000162 Ga0209050_100016212 271
380 3300025298 Ga0209050_1002674 Ga0209050_10026742 271
381 3300025303 Ga0209051_1000104 Ga0209051_10001047 271
382 3300025303 Ga0209051_1020234 Ga0209051_10202342 271
383 3300025303 Ga0209051_1023109 Ga0209051_10231092 271
384 3300025304 Ga0209257_1000040 Ga0209257_1000040277 271
385 3300025321 Ga0207656_10000013 Ga0207656_1000001393 271
386 3300025711 Ga0207696_1000045 Ga0207696_1000045314 271
387 3300025711 Ga0207696_1000097 Ga0207696_100009719 271
388 3300025711 Ga0207696_1002467 Ga0207696_100246710 271
389 3300025711 Ga0207696_1013261 Ga0207696_10132612 271
390 3300025711 Ga0207696_1014766 Ga0207696_10147662 271
391 3300025711 Ga0207696_1019573 Ga0207696_10195732 271
392 3300025711 Ga0207696_1021596 Ga0207696_10215962 271
393 3300025711 Ga0207696_1057697 Ga0207696_10576972 271
394 3300025728 Ga0207655_1000005 Ga0207655_1000005844 271
395 3300025728 Ga0207655_1000142 Ga0207655_1000142106 271
396 3300025728 Ga0207655_1008691 Ga0207655_10086912 271
397 3300025728 Ga0207655_1011990 Ga0207655_10119902 271
398 3300025728 Ga0207655_1016994 Ga0207655_10169943 271
399 3300025728 Ga0207655_1017006 Ga0207655_10170065 271
400 3300025728 Ga0207655_1017633 Ga0207655_10176333 271
401 3300025728 Ga0207655_1028445 Ga0207655_10284452 271
402 3300025728 Ga0207655_1034139 Ga0207655_10341392 271
403 3300025728 Ga0207655_1034770 Ga0207655_10347702 271
404 3300025728 Ga0207655_1040731 Ga0207655_10407312 271
405 3300025735 Ga0207713_1000030 Ga0207713_1000030301 271
406 3300025735 Ga0207713_1001006 Ga0207713_10010062 271
407 3300025735 Ga0207713_1002600 Ga0207713_100260014 271
408 3300025735 Ga0207713_1010546 Ga0207713_10105465 271
409 3300025735 Ga0207713_1022987 Ga0207713_10229872 271
410 3300025735 Ga0207713_1058047 Ga0207713_10580471 271
411 3300025735 Ga0207713_1058061 Ga0207713_10580611 271
412 3300025735 Ga0207713_1060121 Ga0207713_10601212 271
413 3300025735 Ga0207713_1063136 Ga0207713_10631362 271
414 3300025914 Ga0207671_10000165 Ga0207671_1000016523 271
415 3300025920 Ga0207649_10000013 Ga0207649_10000013165 271
416 3300025923 Ga0207681_10001353 Ga0207681_1000135312 271
417 3300025925 Ga0207650_10000077 Ga0207650_100000773 271
418 3300025925 Ga0207650_10000457 Ga0207650_100004573 271
419 3300025933 Ga0207706_10002991 Ga0207706_100029917 271
420 3300025933 Ga0207706_10013867 Ga0207706_100138673 271
421 3300025934 Ga0207686_10019202 Ga0207686_100192022 271
422 3300025935 Ga0207709_10000035 Ga0207709_10000035242 271
423 3300025935 Ga0207709_10005497 Ga0207709_100054973 271
424 3300025935 Ga0207709_10031319 Ga0207709_100313192 271
425 3300025941 Ga0207711_10192460 Ga0207711_101924602 271
426 3300025945 Ga0207679_10000005 Ga0207679_10000005419 271
427 3300026041 Ga0207639_10002794 Ga0207639_100027946 271
428 3300027111 Ga0209281_1000077 Ga0209281_1000077229 271
429 3300027111 Ga0209281_1002389 Ga0209281_10023897 271
430 3300027907 Ga0207428_10036878 Ga0207428_100368785 271
431 3300027907 Ga0207428_10085243 Ga0207428_100852433 271
432 3300027907 Ga0207428_10087582 Ga0207428_100875822 271
433 3300027907 Ga0207428_10104020 Ga0207428_101040202 271
434 3300027907 Ga0207428_10211549 Ga0207428_102115492 271
435 3300030731 Ga0316177_1078523 Ga0316177_10785232 271
436 3300030735 Ga0316178_1072945 Ga0316178_10729451 271
437 3300031911 Ga0307412_10011186 Ga0307412_100111862 271
438 3300031911 Ga0307412_10058519 Ga0307412_100585192 271
439 3300031995 Ga0307409_100121203 Ga0307409_1001212032 271
440 3300033180 Ga0307510_10030497 Ga0307510_100304977 271
441 3300041405 Ga0439438_003655 Ga0439438_003655_4443_5258 271
442 3300041405 Ga0439438_003712 Ga0439438_003712_763_1578 271
443 3300041405 Ga0439438_004492 Ga0439438_004492_2867_3682 271
444 3300041405 Ga0439438_004546 Ga0439438_004546_243_1058 271
445 3300041405 Ga0439438_004833 Ga0439438_004833_495_1310 271
446 3300041405 Ga0439438_009790 Ga0439438_009790_1250_2065 271
447 3300041405 Ga0439438_039860 Ga0439438_039860_372_1187 271
448 3300041407 Ga0439447_002684 Ga0439447_002684_4434_5249 271
449 3300041407 Ga0439447_003481 Ga0439447_003481_677_1492 271
450 3300041407 Ga0439447_003500 Ga0439447_003500_216_1031 271
451 3300041407 Ga0439447_004420 Ga0439447_004420_3877_4692 271
452 3300041407 Ga0439447_012937 Ga0439447_012937_156_971 271
453 3300041407 Ga0439447_024393 Ga0439447_024393_226_1041 271
454 3300041411 Ga0439466_0002247 Ga0439466_0002247_312_1127 271
455 3300041411 Ga0439466_0003822 Ga0439466_0003822_3323_4138 271
456 3300041411 Ga0439466_0004509 Ga0439466_0004509_850_1665 271
457 3300041411 Ga0439466_0014661 Ga0439466_0014661_1658_2473 271
458 3300041411 Ga0439466_0050707 Ga0439466_0050707_285_1100 271
459 3300041413 Ga0439465_0003421 Ga0439465_0003421_115_930 271
460 3300041486 Ga0451807_2733865 Ga0451807_2733865_362_1177 271
461 3300041997 Ga0439431_0004399 Ga0439431_0004399_1097_1912 271
462 3300042004 Ga0439445_0011758 Ga0439445_0011758_137_952 271
463 3300042006 Ga0439432_003190 Ga0439432_003190_4137_4952 271
464 3300042006 Ga0439432_009415 Ga0439432_009415_1654_2469 271
465 3300042006 Ga0439432_016417 Ga0439432_016417_236_1051 271
466 3300042006 Ga0439432_020478 Ga0439432_020478_1068_1883 271
467 3300042009 Ga0439451_002492 Ga0439451_002492_921_1736 271
468 3300042010 Ga0439452_002545 Ga0439452_002545_4506_5321 271
469 3300042010 Ga0439452_003098 Ga0439452_003098_533_1348 271
470 3300042010 Ga0439452_004023 Ga0439452_004023_150_965 271
471 3300042010 Ga0439452_005077 Ga0439452_005077_909_1724 271
472 3300042013 Ga0439456_011613 Ga0439456_011613_182_997 271
473 3300042013 Ga0439456_039622 Ga0439456_039622_160_975 271
474 3300042013 Ga0439456_040073 Ga0439456_040073_68_883 271
475 3300042013 Ga0439456_046051 Ga0439456_046051_55_870 271
476 3300042016 Ga0439463_001951 Ga0439463_001951_3444_4259 271
477 3300042016 Ga0439463_021196 Ga0439463_021196_239_1054 271
478 3300042115 Ga0450911_002967 Ga0450911_002967_2220_3035 271
479 3300042115 Ga0450911_003734 Ga0450911_003734_741_1556 271
480 3300042115 Ga0450911_006215 Ga0450911_006215_734_1549 271
481 3300042115 Ga0450911_011144 Ga0450911_011144_261_1076 271
482 3300042121 Ga0450919_010851 Ga0450919_010851_138_953 271
483 3300042122 Ga0450920_005991 Ga0450920_005991_276_1091 271
484 3300042124 Ga0450922_001519 Ga0450922_001519_1275_2090 271
485 3300042127 Ga0450890_000530 Ga0450890_000530_315_1130 271
486 3300042137 Ga0450902_000722 Ga0450902_000722_459_1280 271
487 3300042137 Ga0450902_001237 Ga0450902_001237_197_1012 271
488 3300042137 Ga0450902_026099 Ga0450902_026099_55_870 271
489 3300042138 Ga0450903_004755 Ga0450903_004755_99_914 271
490 3300042142 Ga0450905_012500 Ga0450905_012500_282_1097 271
491 3300042145 Ga0450906_002265 Ga0450906_002265_3160_3975 271
492 3300042146 Ga0450907_001033 Ga0450907_001033_4572_5387 271
493 3300042146 Ga0450907_007198 Ga0450907_007198_484_1299 271
494 3300042156 Ga0439446_0007648 Ga0439446_0007648_1171_1986 271
495 3300042184 Ga0450908_003567 Ga0450908_003567_428_1243 271
496 3300042184 Ga0450908_004856 Ga0450908_004856_926_1741 271
497 3300042185 Ga0450909_000392 Ga0450909_000392_282_1097 271
498 3300042185 Ga0450909_018263 Ga0450909_018263_155_970 271
499 3300042435 Ga0439434_0001710 Ga0439434_0001710_4542_5357 271
500 3300042435 Ga0439434_0027940 Ga0439434_0027940_226_1041 271
501 3300042461 Ga0439460_0002977 Ga0439460_0002977_1031_1846 271
502 3300042461 Ga0439460_0035001 Ga0439460_0035001_483_1298 271
503 3300042531 Ga0450918_018789 Ga0450918_018789_177_992 271
504 3300042533 Ga0450901_000122 Ga0450901_000122_6911_7732 271
505 3300042993 Ga0439440_0006677 Ga0439440_0006677_267_1082 271
506 3300046452 Ga0495617_000225 Ga0495617_000225_1126_1941 271
507 3300046452 Ga0495617_003852 Ga0495617_003852_4689_5504 271
508 3300046452 Ga0495617_004477 Ga0495617_004477_166_981 271
509 3300046452 Ga0495617_039187 Ga0495617_039187_30_845 271
510 3300046452 Ga0495617_057299 Ga0495617_057299_347_1162 271
511 3300046453 Ga0495627_000257 Ga0495627_000257_4813_5631 271
512 3300046453 Ga0495627_000451 Ga0495627_000451_1091_1906 271
513 3300046453 Ga0495627_009457 Ga0495627_009457_449_1264 271
514 3300046453 Ga0495627_067071 Ga0495627_067071_108_929 271
515 3300046454 Ga0495592_0288559 Ga0495592_0288559_236_1051 271
516 3300046455 Ga0495603_0002381 Ga0495603_0002381_1424_2239 271
517 3300046455 Ga0495603_0021821 Ga0495603_0021821_41_856 271
518 3300046455 Ga0495603_0037916 Ga0495603_0037916_895_1710 271
519 3300046455 Ga0495603_0185250 Ga0495603_0185250_87_902 271
520 3300046457 Ga0495590_0004245 Ga0495590_0004245_860_1675 271
521 3300046457 Ga0495590_0004738 Ga0495590_0004738_3945_4760 271
522 3300046457 Ga0495590_0020240 Ga0495590_0020240_418_1233 271
523 3300046457 Ga0495590_0021327 Ga0495590_0021327_352_1167 271
524 3300046457 Ga0495590_0110041 Ga0495590_0110041_67_882 271
525 3300046458 Ga0495591_004826 Ga0495591_004826_1396_2211 271
526 3300046458 Ga0495591_005086 Ga0495591_005086_4259_5074 271
527 3300046458 Ga0495591_006137 Ga0495591_006137_15_830 271
528 3300046458 Ga0495591_006343 Ga0495591_006343_4162_4977 271
529 3300046458 Ga0495591_007626 Ga0495591_007626_122_937 271
530 3300046458 Ga0495591_011702 Ga0495591_011702_1261_2076 271
531 3300046458 Ga0495591_017012 Ga0495591_017012_171_986 271
532 3300046458 Ga0495591_024620 Ga0495591_024620_954_1769 271
533 3300046458 Ga0495591_048272 Ga0495591_048272_158_973 271
534 3300046459 Ga0495629_0209464 Ga0495629_0209464_179_994 271
535 3300046460 Ga0495638_0018185 Ga0495638_0018185_489_1304 271
536 3300046460 Ga0495638_0022371 Ga0495638_0022371_26_841 271
537 3300046460 Ga0495638_0035890 Ga0495638_0035890_88_903 271
538 3300046460 Ga0495638_0063604 Ga0495638_0063604_849_1664 271
539 3300046460 Ga0495638_0072792 Ga0495638_0072792_499_1314 271
540 3300046460 Ga0495638_0082030 Ga0495638_0082030_35_850 271
541 3300046460 Ga0495638_0085338 Ga0495638_0085338_59_874 271
542 3300046460 Ga0495638_0096764 Ga0495638_0096764_249_1064 271
543 3300046460 Ga0495638_0164514 Ga0495638_0164514_67_882 271
544 3300046460 Ga0495638_0222359 Ga0495638_0222359_207_1022 271
545 3300046460 Ga0495638_0272469 Ga0495638_0272469_51_866 271
546 3300046463 Ga0495653_0014639 Ga0495653_0014639_851_1666 271
547 3300046463 Ga0495653_0014669 Ga0495653_0014669_1127_1942 271
548 3300046463 Ga0495653_0052181 Ga0495653_0052181_972_1787 271
549 3300046463 Ga0495653_0061222 Ga0495653_0061222_569_1384 271
550 3300046463 Ga0495653_0108430 Ga0495653_0108430_39_854 271
551 3300046463 Ga0495653_0145074 Ga0495653_0145074_593_1408 271
552 3300046471 Ga0495650_0000853 Ga0495650_0000853_35369_36184 271
553 3300046471 Ga0495650_0008618 Ga0495650_0008618_916_1731 271
554 3300046471 Ga0495650_0009821 Ga0495650_0009821_4321_5136 271
555 3300046471 Ga0495650_0023447 Ga0495650_0023447_1394_2209 271
556 3300046471 Ga0495650_0023701 Ga0495650_0023701_117_932 271
557 3300046471 Ga0495650_0104783 Ga0495650_0104783_223_1038 271
558 3300046473 Ga0495582_0020275 Ga0495582_0020275_322_1137 271
559 3300046474 Ga0495605_0000903 Ga0495605_0000903_18453_19271 271
560 3300046474 Ga0495605_0001530 Ga0495605_0001530_9764_10579 271
561 3300046474 Ga0495605_0010787 Ga0495605_0010787_491_1306 271
562 3300046474 Ga0495605_0010841 Ga0495605_0010841_4109_4924 271
563 3300046474 Ga0495605_0012571 Ga0495605_0012571_1152_1967 271
564 3300046474 Ga0495605_0025150 Ga0495605_0025150_2129_2944 271
565 3300046474 Ga0495605_0029903 Ga0495605_0029903_682_1497 271
566 3300046474 Ga0495605_0075634 Ga0495605_0075634_90_905 271
567 3300046475 Ga0495639_0000158 Ga0495639_0000158_1482_2297 271
568 3300046475 Ga0495639_0006561 Ga0495639_0006561_4020_4835 271
569 3300046475 Ga0495639_0062583 Ga0495639_0062583_863_1678 271
570 3300046475 Ga0495639_0203296 Ga0495639_0203296_90_905 271
571 3300046491 Ga0495584_0006126 Ga0495584_0006126_1027_1842 271
572 3300046491 Ga0495584_0007034 Ga0495584_0007034_4442_5257 271
573 3300046491 Ga0495584_0007144 Ga0495584_0007144_826_1641 271
574 3300046491 Ga0495584_0008147 Ga0495584_0008147_4459_5274 271
575 3300046491 Ga0495584_0027676 Ga0495584_0027676_1114_1929 271
576 3300046491 Ga0495584_0028398 Ga0495584_0028398_728_1543 271
577 3300046491 Ga0495584_0039964 Ga0495584_0039964_1027_1842 271
578 3300046491 Ga0495584_0100022 Ga0495584_0100022_452_1267 271
579 3300046492 Ga0495585_0008120 Ga0495585_0008120_4433_5251 271
580 3300046492 Ga0495585_0009359 Ga0495585_0009359_589_1404 271
581 3300046492 Ga0495585_0010239 Ga0495585_0010239_4048_4863 271
582 3300046492 Ga0495585_0014589 Ga0495585_0014589_2626_3441 271
583 3300046492 Ga0495585_0014716 Ga0495585_0014716_2626_3441 271
584 3300046492 Ga0495585_0022053 Ga0495585_0022053_2807_3622 271
585 3300046492 Ga0495585_0203333 Ga0495585_0203333_68_883 271
586 3300046492 Ga0495585_0223347 Ga0495585_0223347_68_883 271
587 3300046499 Ga0495594_0010942 Ga0495594_0010942_122_937 271
588 3300046499 Ga0495594_0011583 Ga0495594_0011583_3295_4110 271
589 3300046499 Ga0495594_0017129 Ga0495594_0017129_2728_3543 271
590 3300046499 Ga0495594_0056928 Ga0495594_0056928_1086_1901 271
591 3300046500 Ga0495596_0004892 Ga0495596_0004892_4219_5034 271
592 3300046500 Ga0495596_0045684 Ga0495596_0045684_362_1177 271
593 3300046501 Ga0495607_0000869 Ga0495607_0000869_4671_5489 271
594 3300046501 Ga0495607_0006360 Ga0495607_0006360_7345_8160 271
595 3300046501 Ga0495607_0007341 Ga0495607_0007341_1692_2510 271
596 3300046501 Ga0495607_0009030 Ga0495607_0009030_1485_2300 271
597 3300046501 Ga0495607_0014781 Ga0495607_0014781_243_1058 271
598 3300046501 Ga0495607_0025554 Ga0495607_0025554_60_875 271
599 3300046501 Ga0495607_0031783 Ga0495607_0031783_1582_2397 271
600 3300046501 Ga0495607_0033106 Ga0495607_0033106_158_973 271
601 3300046501 Ga0495607_0033463 Ga0495607_0033463_2247_3062 271
602 3300046501 Ga0495607_0037857 Ga0495607_0037857_1968_2783 271
603 3300046501 Ga0495607_0069096 Ga0495607_0069096_194_1009 271
604 3300046501 Ga0495607_0145855 Ga0495607_0145855_352_1167 271
605 3300046501 Ga0495607_0149734 Ga0495607_0149734_370_1185 271
606 3300046501 Ga0495607_0189997 Ga0495607_0189997_194_1009 271
607 3300046506 Ga0495583_0000521 Ga0495583_0000521_49075_49890 271
608 3300046506 Ga0495583_0008207 Ga0495583_0008207_4463_5278 271
609 3300046506 Ga0495583_0009383 Ga0495583_0009383_907_1722 271
610 3300046506 Ga0495583_0017192 Ga0495583_0017192_769_1584 271
611 3300046506 Ga0495583_0018242 Ga0495583_0018242_1031_1846 271
612 3300046506 Ga0495583_0052920 Ga0495583_0052920_949_1764 271
613 3300046506 Ga0495583_0090412 Ga0495583_0090412_34_852 271
614 3300046507 Ga0495606_0008218 Ga0495606_0008218_4689_5504 271
615 3300046507 Ga0495606_0014967 Ga0495606_0014967_1127_1942 271
616 3300046507 Ga0495606_0015945 Ga0495606_0015945_1336_2151 271
617 3300046507 Ga0495606_0017185 Ga0495606_0017185_4447_5262 271
618 3300046507 Ga0495606_0020027 Ga0495606_0020027_1111_1926 271
619 3300046507 Ga0495606_0021665 Ga0495606_0021665_1023_1838 271
620 3300046507 Ga0495606_0021913 Ga0495606_0021913_863_1678 271
621 3300046512 Ga0495610_0009088 Ga0495610_0009088_1046_1861 271
622 3300046512 Ga0495610_0009663 Ga0495610_0009663_4285_5100 271
623 3300046512 Ga0495610_0010838 Ga0495610_0010838_360_1175 271
624 3300046512 Ga0495610_0010961 Ga0495610_0010961_886_1701 271
625 3300046512 Ga0495610_0011192 Ga0495610_0011192_4123_4938 271
626 3300046512 Ga0495610_0016561 Ga0495610_0016561_2331_3146 271
627 3300046512 Ga0495610_0017103 Ga0495610_0017103_1925_2740 271
628 3300046512 Ga0495610_0021570 Ga0495610_0021570_1333_2148 271
629 3300046513 Ga0495616_0006907 Ga0495616_0006907_5761_6576 271
630 3300046513 Ga0495616_0007521 Ga0495616_0007521_1110_1925 271
631 3300046513 Ga0495616_0031688 Ga0495616_0031688_1235_2050 271
632 3300046513 Ga0495616_0036809 Ga0495616_0036809_1100_1915 271
633 3300046513 Ga0495616_0040658 Ga0495616_0040658_312_1127 271
634 3300046513 Ga0495616_0040746 Ga0495616_0040746_754_1569 271
635 3300046513 Ga0495616_0074250 Ga0495616_0074250_397_1212 271
636 3300046513 Ga0495616_0107565 Ga0495616_0107565_458_1273 271
637 3300046513 Ga0495616_0162218 Ga0495616_0162218_165_980 271
638 3300046515 Ga0495620_0002844 Ga0495620_0002844_4435_5250 271
639 3300046515 Ga0495620_0007056 Ga0495620_0007056_5171_5986 271
640 3300046515 Ga0495620_0010613 Ga0495620_0010613_932_1747 271
641 3300046515 Ga0495620_0017763 Ga0495620_0017763_222_1037 271
642 3300046515 Ga0495620_0020290 Ga0495620_0020290_1812_2627 271
643 3300046515 Ga0495620_0061060 Ga0495620_0061060_555_1370 271
644 3300046516 Ga0495628_0181046 Ga0495628_0181046_78_893 271
645 3300046517 Ga0495630_0016649 Ga0495630_0016649_451_1266 271
646 3300046517 Ga0495630_0018980 Ga0495630_0018980_31_846 271
647 3300046517 Ga0495630_0229999 Ga0495630_0229999_156_971 271
648 3300046518 Ga0495631_0000478 Ga0495631_0000478_1388_2203 271
649 3300046518 Ga0495631_0013312 Ga0495631_0013312_125_940 271
650 3300046518 Ga0495631_0015929 Ga0495631_0015929_1856_2671 271
651 3300046518 Ga0495631_0036200 Ga0495631_0036200_1356_2171 271
652 3300046518 Ga0495631_0064148 Ga0495631_0064148_73_888 271
653 3300046518 Ga0495631_0096372 Ga0495631_0096372_50_865 271
654 3300046518 Ga0495631_0137474 Ga0495631_0137474_204_1019 271
655 3300046519 Ga0495632_0008307 Ga0495632_0008307_4463_5278 271
656 3300046519 Ga0495632_0008784 Ga0495632_0008784_4252_5067 271
657 3300046519 Ga0495632_0009540 Ga0495632_0009540_4460_5275 271
658 3300046519 Ga0495632_0012646 Ga0495632_0012646_83_898 271
659 3300046519 Ga0495632_0021411 Ga0495632_0021411_1554_2369 271
660 3300046519 Ga0495632_0046790 Ga0495632_0046790_83_898 271
661 3300046519 Ga0495632_0065324 Ga0495632_0065324_59_874 271
662 3300046519 Ga0495632_0152365 Ga0495632_0152365_106_921 271
663 3300046520 Ga0495637_0005988 Ga0495637_0005988_4299_5114 271
664 3300046520 Ga0495637_0006397 Ga0495637_0006397_4456_5271 271
665 3300046520 Ga0495637_0008319 Ga0495637_0008319_1135_1950 271
666 3300046520 Ga0495637_0013389 Ga0495637_0013389_1472_2287 271
667 3300046520 Ga0495637_0016295 Ga0495637_0016295_2037_2852 271
668 3300046520 Ga0495637_0019368 Ga0495637_0019368_1286_2101 271
669 3300046520 Ga0495637_0024487 Ga0495637_0024487_1512_2327 271
670 3300046520 Ga0495637_0028419 Ga0495637_0028419_1547_2362 271
671 3300046520 Ga0495637_0028490 Ga0495637_0028490_1090_1905 271
672 3300046520 Ga0495637_0056372 Ga0495637_0056372_753_1568 271
673 3300046522 Ga0495643_0004605 Ga0495643_0004605_4057_4872 271
674 3300046522 Ga0495643_0009458 Ga0495643_0009458_659_1474 271
675 3300046522 Ga0495643_0030091 Ga0495643_0030091_318_1133 271
676 3300046522 Ga0495643_0035228 Ga0495643_0035228_141_956 271
677 3300046522 Ga0495643_0060090 Ga0495643_0060090_1127_1942 271
678 3300046522 Ga0495643_0074811 Ga0495643_0074811_916_1731 271
679 3300046522 Ga0495643_0093988 Ga0495643_0093988_171_986 271
680 3300046522 Ga0495643_0168391 Ga0495643_0168391_72_887 271
681 3300046523 Ga0495644_0003999 Ga0495644_0003999_4196_5011 271
682 3300046523 Ga0495644_0017355 Ga0495644_0017355_148_963 271
683 3300046523 Ga0495644_0025760 Ga0495644_0025760_1368_2183 271
684 3300046523 Ga0495644_0036872 Ga0495644_0036872_720_1535 271
685 3300046523 Ga0495644_0107092 Ga0495644_0107092_158_973 271
686 3300046524 Ga0495648_0003220 Ga0495648_0003220_1128_1943 271
687 3300046524 Ga0495648_0011986 Ga0495648_0011986_4568_5383 271
688 3300046524 Ga0495648_0012916 Ga0495648_0012916_1399_2214 271
689 3300046524 Ga0495648_0013468 Ga0495648_0013468_4727_5542 271
690 3300046524 Ga0495648_0016867 Ga0495648_0016867_445_1260 271
691 3300046524 Ga0495648_0017468 Ga0495648_0017468_4242_5057 271
692 3300046524 Ga0495648_0025421 Ga0495648_0025421_661_1476 271
693 3300046524 Ga0495648_0053097 Ga0495648_0053097_635_1450 271
694 3300046524 Ga0495648_0053759 Ga0495648_0053759_152_967 271
695 3300046524 Ga0495648_0057512 Ga0495648_0057512_1089_1904 271
696 3300046524 Ga0495648_0169917 Ga0495648_0169917_27_842 271
697 3300046526 Ga0495666_0020490 Ga0495666_0020490_333_1148 271
698 3300046526 Ga0495666_0185577 Ga0495666_0185577_118_933 271
699 3300046528 Ga0495642_0003041 Ga0495642_0003041_4479_5294 271
700 3300046528 Ga0495642_0003357 Ga0495642_0003357_4123_4938 271
701 3300046528 Ga0495642_0004114 Ga0495642_0004114_449_1264 271
702 3300046530 Ga0495654_0000875 Ga0495654_0000875_17021_17836 271
703 3300046530 Ga0495654_0006669 Ga0495654_0006669_4259_5074 271
704 3300046530 Ga0495654_0006958 Ga0495654_0006958_1131_1946 271
705 3300046530 Ga0495654_0007930 Ga0495654_0007930_1324_2139 271
706 3300046530 Ga0495654_0007957 Ga0495654_0007957_4165_4980 271
707 3300046530 Ga0495654_0017519 Ga0495654_0017519_656_1471 271
708 3300046530 Ga0495654_0025971 Ga0495654_0025971_571_1386 271
709 3300046530 Ga0495654_0026914 Ga0495654_0026914_81_896 271
710 3300046530 Ga0495654_0042315 Ga0495654_0042315_36_854 271
711 3300046530 Ga0495654_0056846 Ga0495654_0056846_107_922 271
712 3300046530 Ga0495654_0138496 Ga0495654_0138496_17_832 271
713 3300046530 Ga0495654_0174293 Ga0495654_0174293_89_904 271
714 3300046535 Ga0495586_0087407 Ga0495586_0087407_784_1599 271
715 3300046538 Ga0495609_0000349 Ga0495609_0000349_4784_5599 271
716 3300046538 Ga0495609_0005802 Ga0495609_0005802_1135_1950 271
717 3300046538 Ga0495609_0021143 Ga0495609_0021143_343_1158 271
718 3300046538 Ga0495609_0071736 Ga0495609_0071736_679_1494 271
719 3300046538 Ga0495609_0154400 Ga0495609_0154400_92_907 271
720 3300046542 Ga0495597_0000221 Ga0495597_0000221_4851_5669 271
721 3300046542 Ga0495597_0007884 Ga0495597_0007884_4151_4966 271
722 3300046542 Ga0495597_0030946 Ga0495597_0030946_1000_1815 271
723 3300046542 Ga0495597_0034302 Ga0495597_0034302_1465_2280 271
724 3300046542 Ga0495597_0054950 Ga0495597_0054950_136_951 271
725 3300046542 Ga0495597_0067832 Ga0495597_0067832_81_896 271
726 3300046542 Ga0495597_0117828 Ga0495597_0117828_168_983 271
727 3300046543 Ga0495645_0159026 Ga0495645_0159026_30_845 271
728 3300046557 Ga0495622_0004041 Ga0495622_0004041_4925_5740 271
729 3300046557 Ga0495622_0004608 Ga0495622_0004608_4441_5256 271
730 3300046557 Ga0495622_0014806 Ga0495622_0014806_777_1592 271
731 3300046557 Ga0495622_0027627 Ga0495622_0027627_661_1476 271
732 3300046557 Ga0495622_0031579 Ga0495622_0031579_606_1421 271
733 3300046557 Ga0495622_0195993 Ga0495622_0195993_46_861 271
734 3300046557 Ga0495622_0209532 Ga0495622_0209532_12_827 271
735 3300046558 Ga0495633_0000287 Ga0495633_0000287_4762_5577 271
736 3300046558 Ga0495633_0019202 Ga0495633_0019202_1506_2321 271
737 3300046558 Ga0495633_0133599 Ga0495633_0133599_164_979 271
738 3300046558 Ga0495633_0165922 Ga0495633_0165922_31_846 271
739 3300046615 Ga0495656_0043668 Ga0495656_0043668_147_962 271
740 3300046616 Ga0495668_0008686 Ga0495668_0008686_4108_4923 271
741 3300046616 Ga0495668_0010764 Ga0495668_0010764_703_1518 271
742 3300046616 Ga0495668_0193595 Ga0495668_0193595_180_995 271
743 3300046642 Ga0495634_0012371 Ga0495634_0012371_4378_5193 271
744 3300046642 Ga0495634_0348377 Ga0495634_0348377_61_876 271
745 3300046648 Ga0495611_0000679 Ga0495611_0000679_17513_18328 271
746 3300046648 Ga0495611_0001919 Ga0495611_0001919_4407_5222 271
747 3300046648 Ga0495611_0010339 Ga0495611_0010339_2645_3460 271
748 3300046648 Ga0495611_0017803 Ga0495611_0017803_2124_2939 271
749 3300046648 Ga0495611_0060545 Ga0495611_0060545_111_926 271
750 3300046660 Ga0495625_0002270 Ga0495625_0002270_19401_20216 271
751 3300046660 Ga0495625_0014956 Ga0495625_0014956_1103_1918 271
752 3300046660 Ga0495625_0018168 Ga0495625_0018168_4589_5404 271
753 3300046660 Ga0495625_0051669 Ga0495625_0051669_676_1491 271
754 3300046660 Ga0495625_0052634 Ga0495625_0052634_795_1610 271
755 3300046660 Ga0495625_0055293 Ga0495625_0055293_95_910 271
756 3300046660 Ga0495625_0089787 Ga0495625_0089787_1204_2019 271
757 3300046660 Ga0495625_0097873 Ga0495625_0097873_613_1428 271
758 3300046660 Ga0495625_0328531 Ga0495625_0328531_48_863 271
759 3300046663 Ga0495635_0011871 Ga0495635_0011871_4477_5292 271
760 3300046663 Ga0495635_0078913 Ga0495635_0078913_293_1108 271
761 3300046664 Ga0495659_0002188 Ga0495659_0002188_4427_5242 271
762 3300046664 Ga0495659_0017081 Ga0495659_0017081_1352_2167 271
763 3300046664 Ga0495659_0074843 Ga0495659_0074843_62_877 271
764 3300046664 Ga0495659_0127726 Ga0495659_0127726_43_858 271
765 3300046665 Ga0495661_0000028 Ga0495661_0000028_4739_5554 271
766 3300046665 Ga0495661_0000596 Ga0495661_0000596_4776_5591 271
767 3300046665 Ga0495661_0032749 Ga0495661_0032749_1966_2781 271
768 3300046665 Ga0495661_0089635 Ga0495661_0089635_701_1516 271
769 3300046665 Ga0495661_0230404 Ga0495661_0230404_118_933 271
770 3300046674 Ga0495588_0046567 Ga0495588_0046567_1282_2097 271
771 3300046679 Ga0495623_0011027 Ga0495623_0011027_4451_5266 271
772 3300046679 Ga0495623_0040153 Ga0495623_0040153_1028_1843 271
773 3300046680 Ga0495646_0034820 Ga0495646_0034820_663_1478 271
774 3300046689 Ga0495613_0028914 Ga0495613_0028914_91_906 271
775 3300046689 Ga0495613_0035907 Ga0495613_0035907_551_1366 271
776 3300046690 Ga0495624_0010386 Ga0495624_0010386_1150_1965 271
777 3300046691 Ga0495670_0005708 Ga0495670_0005708_4938_5753 271
778 3300046691 Ga0495670_0005850 Ga0495670_0005850_4443_5258 271
779 3300046691 Ga0495670_0007057 Ga0495670_0007057_3830_4645 271
780 3300046691 Ga0495670_0009118 Ga0495670_0009118_1378_2193 271
781 3300046691 Ga0495670_0031281 Ga0495670_0031281_734_1549 271
782 3300046691 Ga0495670_0061676 Ga0495670_0061676_168_983 271
783 3300046692 Ga0495671_0007066 Ga0495671_0007066_1131_1946 271
784 3300046692 Ga0495671_0011040 Ga0495671_0011040_2477_3292 271
785 3300046692 Ga0495671_0011460 Ga0495671_0011460_1132_1947 271
786 3300046692 Ga0495671_0018162 Ga0495671_0018162_2789_3604 271
787 3300046692 Ga0495671_0020947 Ga0495671_0020947_769_1584 271
788 3300046692 Ga0495671_0022238 Ga0495671_0022238_2116_2931 271
789 3300046692 Ga0495671_0044886 Ga0495671_0044886_64_879 271
790 3300046692 Ga0495671_0111003 Ga0495671_0111003_221_1036 271
791 3300046692 Ga0495671_0224292 Ga0495671_0224292_46_861 271
792 3300046692 Ga0495671_0229791 Ga0495671_0229791_65_880 271
793 3300046694 Ga0495649_0003758 Ga0495649_0003758_8454_9269 271
794 3300046694 Ga0495649_0007939 Ga0495649_0007939_1134_1949 271
795 3300046694 Ga0495649_0013301 Ga0495649_0013301_157_972 271
796 3300046694 Ga0495649_0027148 Ga0495649_0027148_1087_1902 271
797 3300046694 Ga0495649_0029908 Ga0495649_0029908_2057_2872 271
798 3300046694 Ga0495649_0049367 Ga0495649_0049367_680_1495 271
799 3300046694 Ga0495649_0087794 Ga0495649_0087794_59_874 271
800 3300046694 Ga0495649_0159131 Ga0495649_0159131_342_1157 271
801 3300046694 Ga0495649_0204193 Ga0495649_0204193_152_967 271
802 3300046794 Ga0495589_0005797 Ga0495589_0005797_1755_2570 271
803 3300046794 Ga0495589_0006835 Ga0495589_0006835_727_1542 271
804 3300046794 Ga0495589_0007574 Ga0495589_0007574_805_1620 271
805 3300046794 Ga0495589_0009516 Ga0495589_0009516_139_954 271
806 3300046794 Ga0495589_0012887 Ga0495589_0012887_939_1754 271
807 3300046794 Ga0495589_0018694 Ga0495589_0018694_2549_3364 271
808 3300046794 Ga0495589_0021020 Ga0495589_0021020_154_969 271
809 3300046794 Ga0495589_0035241 Ga0495589_0035241_618_1433 271
810 3300046794 Ga0495589_0053171 Ga0495589_0053171_1136_1951 271
811 3300046809 Ga0495600_0275706 Ga0495600_0275706_24_839 271
812 3300046810 Ga0495660_0001754 Ga0495660_0001754_13248_14063 271
813 3300046810 Ga0495660_0005255 Ga0495660_0005255_4795_5613 271
814 3300046810 Ga0495660_0014627 Ga0495660_0014627_3334_4149 271
815 3300046810 Ga0495660_0034942 Ga0495660_0034942_1204_2019 271
816 3300046810 Ga0495660_0051904 Ga0495660_0051904_774_1589 271
817 3300046810 Ga0495660_0082870 Ga0495660_0082870_62_877 271
818 3300046810 Ga0495660_0126811 Ga0495660_0126811_393_1208 271
819 3300047315 Ga0495581_0020117 Ga0495581_0020117_829_1644 271
820 3300047317 Ga0495604_0014492 Ga0495604_0014492_1030_1845 271
821 3300047317 Ga0495604_0019863 Ga0495604_0019863_435_1250 271
822 3300047317 Ga0495604_0080550 Ga0495604_0080550_1413_2228 271
823 3300047317 Ga0495604_0172488 Ga0495604_0172488_682_1497 271
824 3300047318 Ga0495636_0023199 Ga0495636_0023199_1480_2295 271
825 3300047319 Ga0495674_0022886 Ga0495674_0022886_492_1307 271
826 3300047320 Ga0495672_0004119 Ga0495672_0004119_432_1247 271
827 3300047320 Ga0495672_0010951 Ga0495672_0010951_4221_5036 271
828 3300047320 Ga0495672_0010991 Ga0495672_0010991_1135_1950 271
829 3300047320 Ga0495672_0011802 Ga0495672_0011802_4192_5007 271
830 3300047320 Ga0495672_0012546 Ga0495672_0012546_4762_5580 271
831 3300047320 Ga0495672_0012897 Ga0495672_0012897_3841_4656 271
832 3300047320 Ga0495672_0025964 Ga0495672_0025964_1489_2304 271
833 3300047320 Ga0495672_0067681 Ga0495672_0067681_759_1574 271
834 3300047320 Ga0495672_0188097 Ga0495672_0188097_32_847 271
835 3300047321 Ga0495676_0019306 Ga0495676_0019306_1928_2743 271
836 3300047321 Ga0495676_0044259 Ga0495676_0044259_654_1469 271
837 3300047321 Ga0495676_0346046 Ga0495676_0346046_32_847 271
838 3300047322 Ga0495680_0016282 Ga0495680_0016282_1133_1948 271
839 3300047322 Ga0495680_0020043 Ga0495680_0020043_775_1590 271
840 3300047322 Ga0495680_0020798 Ga0495680_0020798_4462_5277 271
841 3300047322 Ga0495680_0022963 Ga0495680_0022963_833_1648 271
842 3300047322 Ga0495680_0061528 Ga0495680_0061528_1992_2807 271
843 3300047322 Ga0495680_0110478 Ga0495680_0110478_732_1547 271
844 3300047323 Ga0495683_0000053 Ga0495683_0000053_116174_116989 271
845 3300047323 Ga0495683_0000176 Ga0495683_0000176_1130_1945 271
846 3300047323 Ga0495683_0006693 Ga0495683_0006693_4158_4973 271
847 3300047323 Ga0495683_0027993 Ga0495683_0027993_254_1069 271
848 3300047323 Ga0495683_0032221 Ga0495683_0032221_1793_2608 271
849 3300047323 Ga0495683_0106796 Ga0495683_0106796_316_1131 271
850 3300047443 Ga0495687_000676 Ga0495687_000676_37845_38660 271
851 3300047443 Ga0495687_008412 Ga0495687_008412_654_1469 271
852 3300047443 Ga0495687_011711 Ga0495687_011711_2735_3550 271
853 3300047443 Ga0495687_016205 Ga0495687_016205_2731_3546 271
854 3300047444 Ga0495675_0069826 Ga0495675_0069826_549_1364 271
855 3300047445 Ga0495677_0004418 Ga0495677_0004418_4429_5244 271
856 3300047446 Ga0495679_002285 Ga0495679_002285_4334_5149 271
857 3300047446 Ga0495679_013289 Ga0495679_013289_504_1319 271
858 3300047446 Ga0495679_015209 Ga0495679_015209_37_852 271
859 3300047446 Ga0495679_073427 Ga0495679_073427_37_852 271
860 3300047447 Ga0495685_006994 Ga0495685_006994_2319_3134 271
861 3300047447 Ga0495685_022697 Ga0495685_022697_1012_1827 271
862 3300047469 Ga0495673_0000938 Ga0495673_0000938_1127_1942 271
863 3300047469 Ga0495673_0001495 Ga0495673_0001495_4843_5661 271
864 3300047469 Ga0495673_0002985 Ga0495673_0002985_8020_8835 271
865 3300047469 Ga0495673_0007204 Ga0495673_0007204_4504_5319 271
866 3300047469 Ga0495673_0007237 Ga0495673_0007237_4478_5293 271
867 3300047469 Ga0495673_0008958 Ga0495673_0008958_63_878 271
868 3300047469 Ga0495673_0012088 Ga0495673_0012088_1128_1943 271
869 3300047469 Ga0495673_0015257 Ga0495673_0015257_492_1307 271
870 3300047469 Ga0495673_0020580 Ga0495673_0020580_166_981 271
871 3300047469 Ga0495673_0039272 Ga0495673_0039272_1271_2086 271
872 3300047469 Ga0495673_0064910 Ga0495673_0064910_147_962 271
873 3300047470 Ga0495681_0000588 Ga0495681_0000588_25849_26664 271
874 3300047470 Ga0495681_0005805 Ga0495681_0005805_189_1004 271
875 3300047470 Ga0495681_0009539 Ga0495681_0009539_602_1420 271
876 3300047470 Ga0495681_0009601 Ga0495681_0009601_1130_1945 271
877 3300047470 Ga0495681_0010451 Ga0495681_0010451_692_1507 271
878 3300047470 Ga0495681_0010626 Ga0495681_0010626_464_1279 271
879 3300047470 Ga0495681_0010743 Ga0495681_0010743_3844_4659 271
880 3300047470 Ga0495681_0020902 Ga0495681_0020902_988_1803 271
881 3300047470 Ga0495681_0023530 Ga0495681_0023530_1088_1903 271
882 3300047470 Ga0495681_0029275 Ga0495681_0029275_410_1225 271
883 3300047470 Ga0495681_0035413 Ga0495681_0035413_13_828 271
884 3300047470 Ga0495681_0041589 Ga0495681_0041589_1262_2077 271
885 3300047470 Ga0495681_0100436 Ga0495681_0100436_264_1079 271
886 3300047470 Ga0495681_0151076 Ga0495681_0151076_34_849 271
887 3300047471 Ga0495684_0154978 Ga0495684_0154978_517_1332 271
888 3300047471 Ga0495684_0365772 Ga0495684_0365772_195_1010 271
889 3300047472 Ga0495686_0018147 Ga0495686_0018147_3865_4680 271
890 3300047472 Ga0495686_0021228 Ga0495686_0021228_2707_3522 271
891 3300047472 Ga0495686_0023740 Ga0495686_0023740_355_1170 271
892 3300047472 Ga0495686_0039147 Ga0495686_0039147_347_1162 271
893 3300047673 Ga0495593_0059771 Ga0495593_0059771_34_849 271
894 3300047673 Ga0495593_0128828 Ga0495593_0128828_300_1115 271
895 3300047673 Ga0495593_0209231 Ga0495593_0209231_31_846 271
896 3300048088 Ga0495602_0133851 Ga0495602_0133851_1110_1925 271
897 3300048088 Ga0495602_0232462 Ga0495602_0232462_151_966 271
898 3300048091 Ga0495626_0000721 Ga0495626_0000721_28971_29786 271
899 3300048091 Ga0495626_0002158 Ga0495626_0002158_1127_1942 271
900 3300048091 Ga0495626_0007151 Ga0495626_0007151_923_1738 271
901 3300048091 Ga0495626_0007269 Ga0495626_0007269_1136_1951 271
902 3300048091 Ga0495626_0008235 Ga0495626_0008235_4107_4922 271
903 3300048091 Ga0495626_0009970 Ga0495626_0009970_3845_4660 271
904 3300048091 Ga0495626_0010027 Ga0495626_0010027_62_877 271
905 3300048091 Ga0495626_0036297 Ga0495626_0036297_693_1508 271
906 3300048905 Ga0496102_0017499 Ga0496102_0017499_1015_1830 271
907 3300048906 Ga0496103_0008923 Ga0496103_0008923_4108_4923 271
908 3300048908 Ga0496105_0379909 Ga0496105_0379909_201_1016 271
909 3300048913 Ga0496110_0178192 Ga0496110_0178192_583_1398 271
910 3300048914 Ga0496111_0094149 Ga0496111_0094149_1309_2124 271
911 3300048918 Ga0496115_0432897 Ga0496115_0432897_127_942 271
912 3300048919 Ga0496116_0001102 Ga0496116_0001102_682_1497 271
913 3300048919 Ga0496116_0001892 Ga0496116_0001892_20259_21074 271
914 3300048919 Ga0496116_0013194 Ga0496116_0013194_4465_5280 271
915 3300048919 Ga0496116_0028107 Ga0496116_0028107_2807_3622 271
916 3300048919 Ga0496116_0036122 Ga0496116_0036122_1545_2360 271
917 3300048919 Ga0496116_0063853 Ga0496116_0063853_536_1351 271
918 3300048920 Ga0496117_0002125 Ga0496117_0002125_896_1711 271
919 3300048920 Ga0496117_0003138 Ga0496117_0003138_17781_18596 271
920 3300048920 Ga0496117_0021272 Ga0496117_0021272_56_871 271
921 3300048920 Ga0496117_0049167 Ga0496117_0049167_480_1295 271
922 3300048920 Ga0496117_0106235 Ga0496117_0106235_937_1752 271
923 3300048920 Ga0496117_0120247 Ga0496117_0120247_790_1605 271
924 3300048920 Ga0496117_0229352 Ga0496117_0229352_202_1017 271
925 3300048921 Ga0496118_0025614 Ga0496118_0025614_3976_4791 271
926 3300048921 Ga0496118_0032940 Ga0496118_0032940_621_1436 271
927 3300048921 Ga0496118_0041866 Ga0496118_0041866_685_1500 271
928 3300048921 Ga0496118_0157774 Ga0496118_0157774_11_826 271
929 3300048921 Ga0496118_0191515 Ga0496118_0191515_250_1065 271
930 3300048921 Ga0496118_0227488 Ga0496118_0227488_254_1069 271
931 3300048922 Ga0496119_0025020 Ga0496119_0025020_2957_3772 271
932 3300048922 Ga0496119_0089649 Ga0496119_0089649_648_1463 271
933 3300048922 Ga0496119_0110366 Ga0496119_0110366_633_1448 271
934 3300048923 Ga0496120_0032235 Ga0496120_0032235_1078_1893 271
935 3300048923 Ga0496120_0202094 Ga0496120_0202094_129_944 271
936 3300048924 Ga0496121_0000781 Ga0496121_0000781_56032_56847 271
937 3300048924 Ga0496121_0046437 Ga0496121_0046437_2239_3054 271
938 3300048924 Ga0496121_0075467 Ga0496121_0075467_1449_2264 271
939 3300048924 Ga0496121_0193598 Ga0496121_0193598_613_1428 271
940 3300048925 Ga0496122_0001762 Ga0496122_0001762_3448_4263 271
941 3300048925 Ga0496122_0018352 Ga0496122_0018352_1067_1882 271
942 3300048925 Ga0496122_0018887 Ga0496122_0018887_1081_1896 271
943 3300048926 Ga0496123_0001295 Ga0496123_0001295_3828_4643 271
944 3300048926 Ga0496123_0014533 Ga0496123_0014533_4591_5406 271
945 3300048927 Ga0496124_0002323 Ga0496124_0002323_23929_24744 271
946 3300048927 Ga0496124_0026032 Ga0496124_0026032_4213_5028 271
947 3300048927 Ga0496124_0154606 Ga0496124_0154606_434_1249 271
948 3300048927 Ga0496124_0162748 Ga0496124_0162748_763_1578 271
949 3300048927 Ga0496124_0173757 Ga0496124_0173757_300_1115 271
950 3300048928 Ga0496125_0002291 Ga0496125_0002291_911_1726 271
951 3300048928 Ga0496125_0019099 Ga0496125_0019099_1427_2242 271
952 3300048928 Ga0496125_0054616 Ga0496125_0054616_220_1035 271
953 3300048928 Ga0496125_0149095 Ga0496125_0149095_493_1308 271
954 3300048929 Ga0496126_0146537 Ga0496126_0146537_536_1351 271
955 3300048929 Ga0496126_0166247 Ga0496126_0166247_235_1050 271
956 3300048929 Ga0496126_0582464 Ga0496126_0582464_58_873 271
957 3300049459 Ga0495678_000362 Ga0495678_000362_4775_5590 271
958 3300049459 Ga0495678_007338 Ga0495678_007338_4208_5023 271
959 3300049459 Ga0495678_007420 Ga0495678_007420_4484_5299 271
960 3300049459 Ga0495678_010370 Ga0495678_010370_2857_3672 271
961 3300049459 Ga0495678_017505 Ga0495678_017505_2337_3152 271
962 3300049459 Ga0495678_020346 Ga0495678_020346_76_891 271
963 3300049459 Ga0495678_030754 Ga0495678_030754_740_1555 271
964 3300049459 Ga0495678_038732 Ga0495678_038732_124_939 271
965 3300049459 Ga0495678_050308 Ga0495678_050308_32_847 271
966 3300049459 Ga0495678_057954 Ga0495678_057954_117_932 271
967 3300049459 Ga0495678_058781 Ga0495678_058781_554_1369 271
968 3300049459 Ga0495678_068185 Ga0495678_068185_121_936 271
969 3300049459 Ga0495678_122652 Ga0495678_122652_11_826 271
970 3300049460 Ga0495682_0000344 Ga0495682_0000344_28776_29591 271
971 3300049460 Ga0495682_0016549 Ga0495682_0016549_609_1424 271
972 3300049460 Ga0495682_0124754 Ga0495682_0124754_61_876 271
973 3300049665 Ga0501227_065892 Ga0501227_065892_75_890 271
974 3300049758 Ga0501241_015355 Ga0501241_015355_277_1092 271
975 3300049853 Ga0501226_000022 Ga0501226_000022_89510_90325 271
976 3300050490 nmdc:mga03n38_176280_c1 nmdc:mga03n38_176280_c1_204_1019 271
977 3300050491 nmdc:mga00v17_267365_c1 nmdc:mga00v17_267365_c1_137_952 271
978 3300050491 nmdc:mga00v17_73054_c1 nmdc:mga00v17_73054_c1_1264_2079 271
979 3300050514 nmdc:mga08x19_267819_c1 nmdc:mga08x19_267819_c1_292_1107 271
980 3300050516 nmdc:mga0sz30_22593_c1 nmdc:mga0sz30_22593_c1_223_1038 271
981 3300053140 Ga0500573_0031135 Ga0500573_0031135_1700_2518 271
982 3300053161 Ga0500634_0011370 Ga0500634_0011370_2983_3798 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

25

247

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4r-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa 0.9756 3 271
2y4r-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa 0.9685 3 271
1et0-assembly1.cif.gz_A crystal structure of aminodeoxychorismate lyase from escherichia coli 0.9536 3 265
6bb9-assembly1.cif.gz_B the crystal structure of 4-amino-4-deoxychorismate lyase from salmonella typhimurium lt2 0.9452 3 266
1et0-assembly1.cif.gz_A crystal structure of aminodeoxychorismate lyase from escherichia coli 0.9428 3 265
ID Description Score Start End Superfamily
2xpfB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.978 112 271 3.20.10.10
2xpfB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.972 112 271 3.20.10.10
1i2lA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9542 121 264 3.20.10.10
2xpfA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9459 3 111 3.30.470.10
1i2lA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9416 121 264 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A2R7QY79-F1-model_v4 deleted 0.9828 18 174
AF-A0A3D0JQH8-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9791 1 226 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A8B5BEA2-F1-model_v4 deleted 0.9775 1 271
AF-A0A0B8PEA7-F1-model_v4 Aminodeoxychorismate lyase 0.975 164 267 GO:0005829
GO:0008153
GO:0008696
AF-A0A250KY99-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9727 69 267 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656

Feature Viewer

pLDDT pTM Quality
91.74 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map