F487430
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 982 | 410 | 831 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0009001|Ga0495610_0009001_4430_5260 |
| Length | 276 |
| Sequence | MDSWVDGQPADSLSLKDRGLAYGDGLFETIAVHRGQPILLDRHLARLADGCSRLAIAADIELIRHELLSYAAAMGEGVLKLILSRGDGLRGYAPDPAAPGRRILQGNPPAVYPAAHAEHGVRLFPCSTRLATQPLLAGLKHLNRLEQVLARAEWQDSEHAEGLMLDQAGRVIEGVFSNVFLLRDGVLITPDLKRCGVAGVMRAEILFQAESLAIPTQIADISLEQLQWADEVFLCNSVYGVWPVRAYAALSWPVGPLTRKLKNHCPRPTGCLIRET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 10 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 11 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 14 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 15 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 16 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 17 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 18 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 19 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 20 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 21 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 22 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 23 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 24 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 25 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 26 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 27 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 28 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 29 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 30 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 31 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 32 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 33 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 34 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 35 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 36 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 37 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 38 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 39 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 40 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 41 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 42 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 43 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 44 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 45 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 46 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 47 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 48 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 49 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 50 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 51 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 52 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 53 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 54 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 55 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 56 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 57 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 58 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 59 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 60 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 61 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 62 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 63 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 64 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 65 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 66 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 67 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 68 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 69 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 70 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 71 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 72 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 73 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 74 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 75 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 76 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 77 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 78 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 79 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 80 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 81 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 82 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 83 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 84 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 85 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 86 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 87 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 88 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 89 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 90 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 91 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 92 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 93 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 94 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 95 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 96 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 97 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 98 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 99 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 100 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 101 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 102 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 103 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 104 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 105 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 106 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 107 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 108 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 109 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 110 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 111 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 112 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 113 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 114 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 115 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 116 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 117 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 118 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 119 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 120 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 121 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 122 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 123 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 124 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 125 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 126 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 127 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 128 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 129 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 130 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 131 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 132 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 133 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 134 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 135 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 136 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 137 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 138 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 139 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 140 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 141 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 142 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 143 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 144 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 145 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 146 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 147 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 148 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 149 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 150 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 151 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 152 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 153 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 154 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 155 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 156 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 157 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 163 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 167 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 169 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 170 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 171 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 172 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 173 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 174 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 175 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 176 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 177 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 196 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 197 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 198 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 199 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 201 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 203 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 214 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 215 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 218 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 250 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 255 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 256 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 257 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 258 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 261 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 262 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 263 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 264 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 265 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 266 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 267 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 268 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 269 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 270 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 271 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 272 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 273 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 274 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 275 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 276 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 277 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 278 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 279 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 280 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 281 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 282 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 283 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 284 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 285 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 286 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 367 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 368 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 373 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 374 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 375 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 376 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 377 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 378 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 379 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 380 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 381 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 387 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 388 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 393 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 394 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 395 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 396 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 397 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 398 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 399 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 400 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 401 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 402 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 403 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 404 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 405 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 406 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 407 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 408 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 409 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 410 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.42 |
| Metatranscriptomes | 0.2 |
| Isolates | 15.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.94 |
| Nodule | 2.34 |
| Rhizoplane | 4.07 |
| Rhizosphere | 75.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_5007 | 2124908027 | Bacteria | 12299 |
| 2 | JGI25156J39149_1006926 | 3300002705 | Bacteria | 3042 |
| 3 | JGI25162J39368_1000732 | 3300002737 | Bacteria | 22514 |
| 4 | JGI25163J39215_1000824 | 3300002771 | Bacteria | 7443 |
| 5 | JGI25163J39215_1000932 | 3300002771 | Bacteria | 6678 |
| 6 | JGI25164J39214_1000085 | 3300002772 | Bacteria | 92776 |
| 7 | JGI25164J39214_1000296 | 3300002772 | Bacteria | 34311 |
| 8 | JGI25164J39214_1000469 | 3300002772 | Bacteria | 20276 |
| 9 | JGI25165J46597_1000090 | 3300003214 | Bacteria | 168833 |
| 10 | JGI25165J46597_1000528 | 3300003214 | Bacteria | 35737 |
| 11 | JGI25165J46597_1000864 | 3300003214 | Bacteria | 21703 |
| 12 | rootH1_10315725 | 3300003323 | Bacteria | 1700 |
| 13 | Ga0055538_1000132 | 3300003751 | Bacteria | 54508 |
| 14 | Ga0055539_1000177 | 3300003752 | Bacteria | 54508 |
| 15 | Ga0055533_1000179 | 3300003756 | Bacteria | 54508 |
| 16 | Ga0055532_1000179 | 3300003758 | Bacteria | 54508 |
| 17 | Ga0055525_1000097 | 3300003759 | Bacteria | 137371 |
| 18 | Ga0055525_1000408 | 3300003759 | Bacteria | 26491 |
| 19 | Ga0055527_1000198 | 3300003760 | Bacteria | 39703 |
| 20 | Ga0055535_1000795 | 3300003761 | Bacteria | 22979 |
| 21 | Ga0055535_1001887 | 3300003761 | Bacteria | 8869 |
| 22 | Ga0055542_1000441 | 3300003762 | Bacteria | 39703 |
| 23 | Ga0055542_1001802 | 3300003762 | Bacteria | 8869 |
| 24 | Ga0055529_1000591 | 3300003763 | Bacteria | 28451 |
| 25 | Ga0055529_1001179 | 3300003763 | Bacteria | 10659 |
| 26 | Ga0055536_1003265 | 3300003781 | Bacteria | 8790 |
| 27 | Ga0055530_10000671 | 3300003791 | Bacteria | 29135 |
| 28 | Ga0055530_10004397 | 3300003791 | Bacteria | 7269 |
| 29 | Ga0055540_1000400 | 3300003792 | Bacteria | 35238 |
| 30 | Ga0055531_10000202 | 3300003794 | Bacteria | 65776 |
| 31 | Ga0055541_1000118 | 3300003841 | Bacteria | 54508 |
| 32 | Ga0065714_10004576 | 3300005288 | Bacteria | 5814 |
| 33 | Ga0065714_10008187 | 3300005288 | Bacteria | 5174 |
| 34 | Ga0065714_10010654 | 3300005288 | Bacteria | 3220 |
| 35 | Ga0065714_10015583 | 3300005288 | Bacteria | 3679 |
| 36 | Ga0065714_10076538 | 3300005288 | Bacteria | 2779 |
| 37 | Ga0065714_10077353 | 3300005288 | Bacteria | 2698 |
| 38 | Ga0065714_10087468 | 3300005288 | Bacteria | 2056 |
| 39 | Ga0065714_10198784 | 3300005288 | Bacteria | 902 |
| 40 | Ga0065714_10203413 | 3300005288 | Bacteria | 886 |
| 41 | Ga0065715_10002678 | 3300005293 | Bacteria | 5970 |
| 42 | Ga0070661_100000284 | 3300005344 | Bacteria | 41018 |
| 43 | Ga0070669_100001202 | 3300005353 | Bacteria | 18859 |
| 44 | Ga0070663_100010411 | 3300005455 | Bacteria | 5796 |
| 45 | Ga0070662_100000804 | 3300005457 | Bacteria | 19304 |
| 46 | Ga0068853_100003812 | 3300005539 | Bacteria | 11552 |
| 47 | Ga0070696_100037356 | 3300005546 | Bacteria | 3351 |
| 48 | Ga0070693_100011231 | 3300005547 | Bacteria | 4507 |
| 49 | Ga0070665_100013903 | 3300005548 | Bacteria | 8097 |
| 50 | Ga0068855_100078707 | 3300005563 | Bacteria | 3824 |
| 51 | Ga0070664_100000681 | 3300005564 | Bacteria | 25939 |
| 52 | Ga0070664_100127710 | 3300005564 | Bacteria | 2232 |
| 53 | Ga0068854_100023043 | 3300005578 | Bacteria | 4250 |
| 54 | Ga0068856_100004288 | 3300005614 | Bacteria | 14229 |
| 55 | Ga0068851_10000011 | 3300005834 | Bacteria | 178585 |
| 56 | Ga0075363_100149968 | 3300006048 | Bacteria | 1316 |
| 57 | Ga0075432_10004638 | 3300006058 | Bacteria | 4681 |
| 58 | Ga0075432_10008264 | 3300006058 | Bacteria | 3547 |
| 59 | Ga0075362_10156000 | 3300006177 | Bacteria | 1097 |
| 60 | Ga0075362_10191915 | 3300006177 | Bacteria | 992 |
| 61 | Ga0075369_10029817 | 3300006186 | Bacteria | 2294 |
| 62 | Ga0075436_100086856 | 3300006914 | Bacteria | 2173 |
| 63 | Ga0079104_1000668 | 3300006946 | Bacteria | 32257 |
| 64 | Ga0079104_1020161 | 3300006946 | Bacteria | 1844 |
| 65 | Ga0105251_10007772 | 3300009011 | Bacteria | 6536 |
| 66 | Ga0105251_10008998 | 3300009011 | Bacteria | 5954 |
| 67 | Ga0105251_10034102 | 3300009011 | Bacteria | 2522 |
| 68 | Ga0105251_10039370 | 3300009011 | Bacteria | 2311 |
| 69 | Ga0105251_10073371 | 3300009011 | Bacteria | 1590 |
| 70 | Ga0105244_10004356 | 3300009036 | Bacteria | 9764 |
| 71 | Ga0105244_10008269 | 3300009036 | Bacteria | 6512 |
| 72 | Ga0105244_10013981 | 3300009036 | Bacteria | 4661 |
| 73 | Ga0105244_10022306 | 3300009036 | Bacteria | 3486 |
| 74 | Ga0105244_10026665 | 3300009036 | Bacteria | 3123 |
| 75 | Ga0105244_10036096 | 3300009036 | Bacteria | 2592 |
| 76 | Ga0105244_10172892 | 3300009036 | Bacteria | 1028 |
| 77 | Ga0105250_10000074 | 3300009092 | Bacteria | 91652 |
| 78 | Ga0105250_10004551 | 3300009092 | Bacteria | 6358 |
| 79 | Ga0105250_10005278 | 3300009092 | Bacteria | 5804 |
| 80 | Ga0105250_10043120 | 3300009092 | Bacteria | 1808 |
| 81 | Ga0105250_10050418 | 3300009092 | Bacteria | 1670 |
| 82 | Ga0105250_10072769 | 3300009092 | Bacteria | 1390 |
| 83 | Ga0105250_10093544 | 3300009092 | Bacteria | 1224 |
| 84 | Ga0105240_10084626 | 3300009093 | Bacteria | 3888 |
| 85 | Ga0105243_10012583 | 3300009148 | Bacteria | 6396 |
| 86 | Ga0105243_10031266 | 3300009148 | Bacteria | 4104 |
| 87 | Ga0105243_10036090 | 3300009148 | Bacteria | 3834 |
| 88 | Ga0105243_10041987 | 3300009148 | Bacteria | 3578 |
| 89 | Ga0105242_10000626 | 3300009176 | Bacteria | 27761 |
| 90 | Ga0105248_10011709 | 3300009177 | Bacteria | 9671 |
| 91 | Ga0105237_10001599 | 3300009545 | Bacteria | 29440 |
| 92 | Ga0105237_10001820 | 3300009545 | Bacteria | 27503 |
| 93 | Ga0105238_10184205 | 3300009551 | Bacteria | 2065 |
| 94 | Ga0105249_10601321 | 3300009553 | Bacteria | 1154 |
| 95 | Ga0105246_10010995 | 3300011119 | Bacteria | 5610 |
| 96 | Ga0105246_10110849 | 3300011119 | Bacteria | 2016 |
| 97 | Ga0157373_10012012 | 3300013100 | Bacteria | 6365 |
| 98 | Ga0157373_10012417 | 3300013100 | Bacteria | 6262 |
| 99 | Ga0157373_10015562 | 3300013100 | Bacteria | 5560 |
| 100 | Ga0157373_10017236 | 3300013100 | Bacteria | 5260 |
| 101 | Ga0157373_10022847 | 3300013100 | Bacteria | 4535 |
| 102 | Ga0157373_10055876 | 3300013100 | Bacteria | 2804 |
| 103 | Ga0157371_10013522 | 3300013102 | Bacteria | 6195 |
| 104 | Ga0157371_10019628 | 3300013102 | Bacteria | 4980 |
| 105 | Ga0157371_10124521 | 3300013102 | Bacteria | 1833 |
| 106 | Ga0157371_10142386 | 3300013102 | Bacteria | 1708 |
| 107 | Ga0157371_10283324 | 3300013102 | Bacteria | 1197 |
| 108 | Ga0157370_10024052 | 3300013104 | Bacteria | 6039 |
| 109 | Ga0157370_10036318 | 3300013104 | Bacteria | 4783 |
| 110 | Ga0157370_10115524 | 3300013104 | Bacteria | 2507 |
| 111 | Ga0157370_10122730 | 3300013104 | Bacteria | 2426 |
| 112 | Ga0157370_10151347 | 3300013104 | Bacteria | 2159 |
| 113 | Ga0157370_10217875 | 3300013104 | Bacteria | 1768 |
| 114 | Ga0157370_10259338 | 3300013104 | Bacteria | 1607 |
| 115 | Ga0157370_10484147 | 3300013104 | Bacteria | 1137 |
| 116 | Ga0157369_10003663 | 3300013105 | Bacteria | 18241 |
| 117 | Ga0157369_10027825 | 3300013105 | Bacteria | 6263 |
| 118 | Ga0157369_10028899 | 3300013105 | Bacteria | 6133 |
| 119 | Ga0157369_10029490 | 3300013105 | Bacteria | 6062 |
| 120 | Ga0157369_10142074 | 3300013105 | Bacteria | 2540 |
| 121 | Ga0157369_10220782 | 3300013105 | Bacteria | 1984 |
| 122 | Ga0157369_10221488 | 3300013105 | Bacteria | 1981 |
| 123 | Ga0157369_10497624 | 3300013105 | Bacteria | 1261 |
| 124 | Ga0163162_10000495 | 3300013306 | Bacteria | 36598 |
| 125 | Ga0163162_10081968 | 3300013306 | Bacteria | 3297 |
| 126 | Ga0163162_10278969 | 3300013306 | Bacteria | 1803 |
| 127 | Ga0157372_10235741 | 3300013307 | Bacteria | 2122 |
| 128 | Ga0157375_10021676 | 3300013308 | Bacteria | 5898 |
| 129 | Ga0157375_10027977 | 3300013308 | Bacteria | 5277 |
| 130 | Ga0157375_10171941 | 3300013308 | Bacteria | 2314 |
| 131 | Ga0182008_10001674 | 3300014497 | Bacteria | 14583 |
| 132 | Ga0182008_10008849 | 3300014497 | Bacteria | 5464 |
| 133 | Ga0182008_10009722 | 3300014497 | Bacteria | 5179 |
| 134 | Ga0182008_10009866 | 3300014497 | Bacteria | 5133 |
| 135 | Ga0182008_10010494 | 3300014497 | Bacteria | 4955 |
| 136 | Ga0182008_10017589 | 3300014497 | Bacteria | 3707 |
| 137 | Ga0182008_10018048 | 3300014497 | Bacteria | 3655 |
| 138 | Ga0182008_10146610 | 3300014497 | Bacteria | 1183 |
| 139 | Ga0182006_1004541 | 3300015261 | Bacteria | 6831 |
| 140 | Ga0182006_1004981 | 3300015261 | Bacteria | 6400 |
| 141 | Ga0182006_1006695 | 3300015261 | Bacteria | 5331 |
| 142 | Ga0182006_1011431 | 3300015261 | Bacteria | 3905 |
| 143 | Ga0182006_1024345 | 3300015261 | Bacteria | 2497 |
| 144 | Ga0182006_1035810 | 3300015261 | Bacteria | 1975 |
| 145 | Ga0182006_1041324 | 3300015261 | Bacteria | 1810 |
| 146 | Ga0182007_10004029 | 3300015262 | Bacteria | 6776 |
| 147 | Ga0182007_10011611 | 3300015262 | Bacteria | 3423 |
| 148 | Ga0182007_10104577 | 3300015262 | Bacteria | 939 |
| 149 | Ga0182005_1002599 | 3300015265 | Bacteria | 6381 |
| 150 | Ga0182005_1002754 | 3300015265 | Bacteria | 6133 |
| 151 | Ga0163161_10010440 | 3300017792 | Bacteria | 6430 |
| 152 | Ga0163161_10011813 | 3300017792 | Bacteria | 6056 |
| 153 | Ga0163161_10012997 | 3300017792 | Bacteria | 5785 |
| 154 | Ga0163161_10087788 | 3300017792 | Bacteria | 2298 |
| 155 | Ga0163161_10117937 | 3300017792 | Bacteria | 1991 |
| 156 | Ga0163161_10271736 | 3300017792 | Bacteria | 1327 |
| 157 | Ga0206356_10901725 | 3300020070 | Bacteria | 1658 |
| 158 | Ga0206353_11308317 | 3300020082 | Bacteria | 4469 |
| 159 | Ga0209435_100479 | 3300025206 | Bacteria | 7904 |
| 160 | Ga0209760_100114 | 3300025207 | Bacteria | 57573 |
| 161 | Ga0209760_100337 | 3300025207 | Bacteria | 13875 |
| 162 | Ga0209784_100173 | 3300025224 | Bacteria | 55534 |
| 163 | Ga0209566_100226 | 3300025225 | Bacteria | 55534 |
| 164 | Ga0209674_100216 | 3300025226 | Bacteria | 55534 |
| 165 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 166 | Ga0209672_100389 | 3300025228 | Bacteria | 26663 |
| 167 | Ga0209147_100229 | 3300025229 | Bacteria | 55534 |
| 168 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 169 | Ga0209563_100224 | 3300025230 | Bacteria | 28175 |
| 170 | Ga0209563_100338 | 3300025230 | Bacteria | 17932 |
| 171 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 172 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 173 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 174 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 175 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 176 | Ga0209437_100105 | 3300025233 | Bacteria | 220034 |
| 177 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 178 | Ga0209258_100095 | 3300025242 | Bacteria | 223270 |
| 179 | Ga0209258_100386 | 3300025242 | Bacteria | 56316 |
| 180 | Ga0209646_1000387 | 3300025246 | Bacteria | 28229 |
| 181 | Ga0209646_1001353 | 3300025246 | Bacteria | 6760 |
| 182 | Ga0209026_1000335 | 3300025250 | Bacteria | 45678 |
| 183 | Ga0209677_100171 | 3300025253 | Bacteria | 55534 |
| 184 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 185 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 186 | Ga0209759_1008946 | 3300025256 | Bacteria | 3077 |
| 187 | Ga0209759_1008956 | 3300025256 | Bacteria | 3075 |
| 188 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 189 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 190 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 191 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 192 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 193 | Ga0209455_1000310 | 3300025272 | Bacteria | 49825 |
| 194 | Ga0209675_1001650 | 3300025291 | Bacteria | 12430 |
| 195 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 196 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 197 | Ga0209676_1000345 | 3300025292 | Bacteria | 88051 |
| 198 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 199 | Ga0209050_1000162 | 3300025298 | Bacteria | 155309 |
| 200 | Ga0209050_1002674 | 3300025298 | Bacteria | 14539 |
| 201 | Ga0209051_1000104 | 3300025303 | Bacteria | 161001 |
| 202 | Ga0209051_1020234 | 3300025303 | Bacteria | 2873 |
| 203 | Ga0209051_1023109 | 3300025303 | Bacteria | 2595 |
| 204 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 205 | Ga0207656_10000013 | 3300025321 | Bacteria | 160490 |
| 206 | Ga0207696_1000045 | 3300025711 | Bacteria | 296484 |
| 207 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 208 | Ga0207696_1002467 | 3300025711 | Bacteria | 9046 |
| 209 | Ga0207696_1013261 | 3300025711 | Bacteria | 2881 |
| 210 | Ga0207696_1014766 | 3300025711 | Bacteria | 2668 |
| 211 | Ga0207696_1019573 | 3300025711 | Bacteria | 2200 |
| 212 | Ga0207696_1021596 | 3300025711 | Bacteria | 2059 |
| 213 | Ga0207696_1057697 | 3300025711 | Bacteria | 1097 |
| 214 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 215 | Ga0207655_1000142 | 3300025728 | Bacteria | 137562 |
| 216 | Ga0207655_1008691 | 3300025728 | Bacteria | 6409 |
| 217 | Ga0207655_1011990 | 3300025728 | Bacteria | 5108 |
| 218 | Ga0207655_1016994 | 3300025728 | Bacteria | 3947 |
| 219 | Ga0207655_1017006 | 3300025728 | Bacteria | 3945 |
| 220 | Ga0207655_1017633 | 3300025728 | Bacteria | 3840 |
| 221 | Ga0207655_1028445 | 3300025728 | Bacteria | 2637 |
| 222 | Ga0207655_1034139 | 3300025728 | Bacteria | 2291 |
| 223 | Ga0207655_1034770 | 3300025728 | Bacteria | 2261 |
| 224 | Ga0207655_1040731 | 3300025728 | Bacteria | 2000 |
| 225 | Ga0207713_1000030 | 3300025735 | Bacteria | 284027 |
| 226 | Ga0207713_1001006 | 3300025735 | Bacteria | 24570 |
| 227 | Ga0207713_1002600 | 3300025735 | Bacteria | 13023 |
| 228 | Ga0207713_1010546 | 3300025735 | Bacteria | 5108 |
| 229 | Ga0207713_1022987 | 3300025735 | Bacteria | 2946 |
| 230 | Ga0207713_1058047 | 3300025735 | Bacteria | 1493 |
| 231 | Ga0207713_1058061 | 3300025735 | Bacteria | 1493 |
| 232 | Ga0207713_1060121 | 3300025735 | Bacteria | 1454 |
| 233 | Ga0207713_1063136 | 3300025735 | Bacteria | 1400 |
| 234 | Ga0207695_10001592 | 3300025913 | Bacteria | 36863 |
| 235 | Ga0207671_10000165 | 3300025914 | Bacteria | 103178 |
| 236 | Ga0207671_10001137 | 3300025914 | Bacteria | 31975 |
| 237 | Ga0207649_10000013 | 3300025920 | Bacteria | 255009 |
| 238 | Ga0207681_10001353 | 3300025923 | Bacteria | 15834 |
| 239 | Ga0207694_10068547 | 3300025924 | Bacteria | 2770 |
| 240 | Ga0207650_10000077 | 3300025925 | Bacteria | 132010 |
| 241 | Ga0207650_10000457 | 3300025925 | Bacteria | 34586 |
| 242 | Ga0207706_10002991 | 3300025933 | Bacteria | 16297 |
| 243 | Ga0207706_10013867 | 3300025933 | Bacteria | 7310 |
| 244 | Ga0207686_10019202 | 3300025934 | Bacteria | 3883 |
| 245 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 246 | Ga0207709_10005497 | 3300025935 | Bacteria | 7192 |
| 247 | Ga0207709_10031319 | 3300025935 | Bacteria | 3105 |
| 248 | Ga0207711_10192460 | 3300025941 | Bacteria | 1859 |
| 249 | Ga0207679_10000005 | 3300025945 | Bacteria | 525011 |
| 250 | Ga0207667_10081214 | 3300025949 | Bacteria | 3358 |
| 251 | Ga0207640_10105810 | 3300025981 | Bacteria | 1983 |
| 252 | Ga0207639_10002794 | 3300026041 | Bacteria | 11720 |
| 253 | Ga0207678_10001305 | 3300026067 | Bacteria | 23111 |
| 254 | Ga0207702_10000231 | 3300026078 | Bacteria | 64867 |
| 255 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 256 | Ga0209281_1002389 | 3300027111 | Bacteria | 7645 |
| 257 | Ga0209371_1000359 | 3300027312 | Bacteria | 49211 |
| 258 | Ga0207428_10036878 | 3300027907 | Bacteria | 3983 |
| 259 | Ga0207428_10085243 | 3300027907 | Bacteria | 2461 |
| 260 | Ga0207428_10087582 | 3300027907 | Bacteria | 2423 |
| 261 | Ga0207428_10104020 | 3300027907 | Bacteria | 2192 |
| 262 | Ga0207428_10211549 | 3300027907 | Bacteria | 1456 |
| 263 | Ga0268256_1000305 | 3300030500 | Bacteria | 49210 |
| 264 | Ga0316177_1078523 | 3300030731 | Bacteria | 2810 |
| 265 | Ga0316178_1072945 | 3300030735 | Bacteria | 12828 |
| 266 | Ga0307408_100022832 | 3300031548 | Bacteria | 4255 |
| 267 | Ga0307412_10011186 | 3300031911 | Bacteria | 5193 |
| 268 | Ga0307412_10058519 | 3300031911 | Bacteria | 2578 |
| 269 | Ga0307409_100121203 | 3300031995 | Bacteria | 2215 |
| 270 | Ga0307510_10030497 | 3300033180 | Bacteria | 6112 |
| 271 | Ga0439438_003655 | 3300041405 | Bacteria | 6144 |
| 272 | Ga0439438_003712 | 3300041405 | Bacteria | 6070 |
| 273 | Ga0439438_004492 | 3300041405 | Bacteria | 5334 |
| 274 | Ga0439438_004546 | 3300041405 | Bacteria | 5289 |
| 275 | Ga0439438_004833 | 3300041405 | Bacteria | 5076 |
| 276 | Ga0439438_009790 | 3300041405 | Bacteria | 3080 |
| 277 | Ga0439438_039860 | 3300041405 | Bacteria | 1222 |
| 278 | Ga0439447_002684 | 3300041407 | Bacteria | 6443 |
| 279 | Ga0439447_003481 | 3300041407 | Bacteria | 5593 |
| 280 | Ga0439447_003500 | 3300041407 | Bacteria | 5572 |
| 281 | Ga0439447_004420 | 3300041407 | Bacteria | 4837 |
| 282 | Ga0439447_012937 | 3300041407 | Bacteria | 2381 |
| 283 | Ga0439447_024393 | 3300041407 | Bacteria | 1566 |
| 284 | Ga0439466_0002247 | 3300041411 | Bacteria | 7566 |
| 285 | Ga0439466_0003822 | 3300041411 | Bacteria | 5814 |
| 286 | Ga0439466_0004509 | 3300041411 | Bacteria | 5353 |
| 287 | Ga0439466_0014661 | 3300041411 | Bacteria | 2851 |
| 288 | Ga0439466_0050707 | 3300041411 | Bacteria | 1360 |
| 289 | Ga0439465_0003421 | 3300041413 | Bacteria | 5176 |
| 290 | Ga0451807_2733865 | 3300041486 | Bacteria | 1223 |
| 291 | Ga0439431_0004399 | 3300041997 | Bacteria | 3097 |
| 292 | Ga0439445_0011758 | 3300042004 | Bacteria | 2091 |
| 293 | Ga0439432_003190 | 3300042006 | Bacteria | 6103 |
| 294 | Ga0439432_009415 | 3300042006 | Bacteria | 3407 |
| 295 | Ga0439432_016417 | 3300042006 | Bacteria | 2491 |
| 296 | Ga0439432_020478 | 3300042006 | Bacteria | 2197 |
| 297 | Ga0439451_002492 | 3300042009 | Bacteria | 3732 |
| 298 | Ga0439452_002545 | 3300042010 | Bacteria | 6713 |
| 299 | Ga0439452_003098 | 3300042010 | Bacteria | 5895 |
| 300 | Ga0439452_004023 | 3300042010 | Bacteria | 5013 |
| 301 | Ga0439452_005077 | 3300042010 | Bacteria | 4296 |
| 302 | Ga0439452_013941 | 3300042010 | Bacteria | 2244 |
| 303 | Ga0439456_010689 | 3300042013 | Bacteria | 1898 |
| 304 | Ga0439456_011613 | 3300042013 | Bacteria | 1823 |
| 305 | Ga0439456_039622 | 3300042013 | Bacteria | 1019 |
| 306 | Ga0439456_040073 | 3300042013 | Bacteria | 1014 |
| 307 | Ga0439456_046051 | 3300042013 | Bacteria | 950 |
| 308 | Ga0439463_001951 | 3300042016 | Bacteria | 5365 |
| 309 | Ga0439463_021196 | 3300042016 | Bacteria | 1623 |
| 310 | Ga0450911_002967 | 3300042115 | Bacteria | 3130 |
| 311 | Ga0450911_003734 | 3300042115 | Bacteria | 2622 |
| 312 | Ga0450911_006215 | 3300042115 | Bacteria | 1791 |
| 313 | Ga0450911_011144 | 3300042115 | Bacteria | 1234 |
| 314 | Ga0450919_010851 | 3300042121 | Bacteria | 1037 |
| 315 | Ga0450920_005991 | 3300042122 | Bacteria | 2175 |
| 316 | Ga0450922_001519 | 3300042124 | Bacteria | 2273 |
| 317 | Ga0450890_000530 | 3300042127 | Bacteria | 5625 |
| 318 | Ga0450902_000722 | 3300042137 | Bacteria | 4224 |
| 319 | Ga0450902_001237 | 3300042137 | Bacteria | 3438 |
| 320 | Ga0450902_026099 | 3300042137 | Bacteria | 976 |
| 321 | Ga0450903_004755 | 3300042138 | Bacteria | 2300 |
| 322 | Ga0450903_007767 | 3300042138 | Bacteria | 1759 |
| 323 | Ga0450905_012500 | 3300042142 | Bacteria | 1196 |
| 324 | Ga0450906_002265 | 3300042145 | Bacteria | 4217 |
| 325 | Ga0450907_001033 | 3300042146 | Bacteria | 6517 |
| 326 | Ga0450907_007198 | 3300042146 | Bacteria | 1857 |
| 327 | Ga0439446_0007648 | 3300042156 | Bacteria | 2847 |
| 328 | Ga0450908_003567 | 3300042184 | Bacteria | 3030 |
| 329 | Ga0450908_004856 | 3300042184 | Bacteria | 2584 |
| 330 | Ga0450909_000392 | 3300042185 | Bacteria | 5578 |
| 331 | Ga0450909_018263 | 3300042185 | Bacteria | 1041 |
| 332 | Ga0450909_028066 | 3300042185 | Bacteria | 850 |
| 333 | Ga0439434_0001710 | 3300042435 | Bacteria | 6369 |
| 334 | Ga0439434_0027940 | 3300042435 | Bacteria | 1707 |
| 335 | Ga0439464_0016553 | 3300042439 | Bacteria | 1994 |
| 336 | Ga0439460_0002977 | 3300042461 | Bacteria | 4085 |
| 337 | Ga0439460_0035001 | 3300042461 | Bacteria | 1450 |
| 338 | Ga0450918_018789 | 3300042531 | Bacteria | 1206 |
| 339 | Ga0450901_000122 | 3300042533 | Bacteria | 8475 |
| 340 | Ga0439440_0006677 | 3300042993 | Bacteria | 2328 |
| 341 | Ga0495617_000225 | 3300046452 | Bacteria | 34294 |
| 342 | Ga0495617_003852 | 3300046452 | Bacteria | 5530 |
| 343 | Ga0495617_004477 | 3300046452 | Bacteria | 5082 |
| 344 | Ga0495617_039187 | 3300046452 | Bacteria | 1584 |
| 345 | Ga0495617_057299 | 3300046452 | Bacteria | 1291 |
| 346 | Ga0495627_000257 | 3300046453 | Bacteria | 54471 |
| 347 | Ga0495627_000451 | 3300046453 | Bacteria | 35736 |
| 348 | Ga0495627_009457 | 3300046453 | Bacteria | 3585 |
| 349 | Ga0495627_067071 | 3300046453 | Bacteria | 1052 |
| 350 | Ga0495592_0288559 | 3300046454 | Bacteria | 1070 |
| 351 | Ga0495603_0002381 | 3300046455 | Bacteria | 11047 |
| 352 | Ga0495603_0021821 | 3300046455 | Bacteria | 3877 |
| 353 | Ga0495603_0037916 | 3300046455 | Bacteria | 2891 |
| 354 | Ga0495603_0185250 | 3300046455 | Bacteria | 1204 |
| 355 | Ga0495590_0004245 | 3300046457 | Bacteria | 5791 |
| 356 | Ga0495590_0004738 | 3300046457 | Bacteria | 5454 |
| 357 | Ga0495590_0020240 | 3300046457 | Bacteria | 2365 |
| 358 | Ga0495590_0021327 | 3300046457 | Bacteria | 2296 |
| 359 | Ga0495590_0110041 | 3300046457 | Bacteria | 983 |
| 360 | Ga0495591_004826 | 3300046458 | Bacteria | 6429 |
| 361 | Ga0495591_005086 | 3300046458 | Bacteria | 6175 |
| 362 | Ga0495591_006137 | 3300046458 | Bacteria | 5384 |
| 363 | Ga0495591_006343 | 3300046458 | Bacteria | 5248 |
| 364 | Ga0495591_007626 | 3300046458 | Bacteria | 4568 |
| 365 | Ga0495591_011702 | 3300046458 | Bacteria | 3304 |
| 366 | Ga0495591_017012 | 3300046458 | Bacteria | 2510 |
| 367 | Ga0495591_024620 | 3300046458 | Bacteria | 1904 |
| 368 | Ga0495591_048272 | 3300046458 | Bacteria | 1174 |
| 369 | Ga0495629_0209464 | 3300046459 | Bacteria | 1346 |
| 370 | Ga0495638_0018185 | 3300046460 | Bacteria | 4671 |
| 371 | Ga0495638_0020515 | 3300046460 | Bacteria | 4365 |
| 372 | Ga0495638_0022371 | 3300046460 | Bacteria | 4151 |
| 373 | Ga0495638_0035890 | 3300046460 | Bacteria | 3158 |
| 374 | Ga0495638_0037932 | 3300046460 | Bacteria | 3064 |
| 375 | Ga0495638_0063604 | 3300046460 | Bacteria | 2275 |
| 376 | Ga0495638_0072792 | 3300046460 | Bacteria | 2099 |
| 377 | Ga0495638_0082030 | 3300046460 | Bacteria | 1956 |
| 378 | Ga0495638_0085338 | 3300046460 | Bacteria | 1909 |
| 379 | Ga0495638_0096764 | 3300046460 | Bacteria | 1771 |
| 380 | Ga0495638_0164514 | 3300046460 | Bacteria | 1277 |
| 381 | Ga0495638_0222359 | 3300046460 | Bacteria | 1054 |
| 382 | Ga0495638_0272469 | 3300046460 | Bacteria | 923 |
| 383 | Ga0495653_0014639 | 3300046463 | Bacteria | 6399 |
| 384 | Ga0495653_0014669 | 3300046463 | Bacteria | 6393 |
| 385 | Ga0495653_0052181 | 3300046463 | Bacteria | 3135 |
| 386 | Ga0495653_0061222 | 3300046463 | Bacteria | 2848 |
| 387 | Ga0495653_0108430 | 3300046463 | Bacteria | 1999 |
| 388 | Ga0495653_0145074 | 3300046463 | Bacteria | 1664 |
| 389 | Ga0495650_0000853 | 3300046471 | Bacteria | 36611 |
| 390 | Ga0495650_0008618 | 3300046471 | Bacteria | 5915 |
| 391 | Ga0495650_0009821 | 3300046471 | Bacteria | 5404 |
| 392 | Ga0495650_0023447 | 3300046471 | Bacteria | 2937 |
| 393 | Ga0495650_0023701 | 3300046471 | Bacteria | 2916 |
| 394 | Ga0495650_0104783 | 3300046471 | Bacteria | 1057 |
| 395 | Ga0495582_0020275 | 3300046473 | Bacteria | 3638 |
| 396 | Ga0495605_0000903 | 3300046474 | Bacteria | 20403 |
| 397 | Ga0495605_0001530 | 3300046474 | Bacteria | 15010 |
| 398 | Ga0495605_0010787 | 3300046474 | Bacteria | 5106 |
| 399 | Ga0495605_0010841 | 3300046474 | Bacteria | 5090 |
| 400 | Ga0495605_0012571 | 3300046474 | Bacteria | 4689 |
| 401 | Ga0495605_0025150 | 3300046474 | Bacteria | 3104 |
| 402 | Ga0495605_0029903 | 3300046474 | Bacteria | 2797 |
| 403 | Ga0495605_0075634 | 3300046474 | Bacteria | 1583 |
| 404 | Ga0495639_0000158 | 3300046475 | Bacteria | 34960 |
| 405 | Ga0495639_0006561 | 3300046475 | Bacteria | 5004 |
| 406 | Ga0495639_0062583 | 3300046475 | Bacteria | 1707 |
| 407 | Ga0495639_0203296 | 3300046475 | Bacteria | 970 |
| 408 | Ga0495584_0006126 | 3300046491 | Bacteria | 6323 |
| 409 | Ga0495584_0007034 | 3300046491 | Bacteria | 5877 |
| 410 | Ga0495584_0007144 | 3300046491 | Bacteria | 5834 |
| 411 | Ga0495584_0008147 | 3300046491 | Bacteria | 5443 |
| 412 | Ga0495584_0027676 | 3300046491 | Bacteria | 2872 |
| 413 | Ga0495584_0028398 | 3300046491 | Bacteria | 2834 |
| 414 | Ga0495584_0039964 | 3300046491 | Bacteria | 2369 |
| 415 | Ga0495584_0100022 | 3300046491 | Bacteria | 1465 |
| 416 | Ga0495585_0008120 | 3300046492 | Bacteria | 6378 |
| 417 | Ga0495585_0009359 | 3300046492 | Bacteria | 5879 |
| 418 | Ga0495585_0010239 | 3300046492 | Bacteria | 5595 |
| 419 | Ga0495585_0014589 | 3300046492 | Bacteria | 4572 |
| 420 | Ga0495585_0014716 | 3300046492 | Bacteria | 4551 |
| 421 | Ga0495585_0022053 | 3300046492 | Bacteria | 3655 |
| 422 | Ga0495585_0203333 | 3300046492 | Bacteria | 1007 |
| 423 | Ga0495585_0223347 | 3300046492 | Bacteria | 949 |
| 424 | Ga0495594_0010942 | 3300046499 | Bacteria | 4707 |
| 425 | Ga0495594_0011583 | 3300046499 | Bacteria | 4585 |
| 426 | Ga0495594_0017129 | 3300046499 | Bacteria | 3824 |
| 427 | Ga0495594_0056928 | 3300046499 | Bacteria | 2158 |
| 428 | Ga0495596_0004892 | 3300046500 | Bacteria | 6425 |
| 429 | Ga0495596_0045684 | 3300046500 | Bacteria | 1722 |
| 430 | Ga0495607_0000869 | 3300046501 | Bacteria | 28344 |
| 431 | Ga0495607_0006360 | 3300046501 | Bacteria | 8317 |
| 432 | Ga0495607_0007341 | 3300046501 | Bacteria | 7637 |
| 433 | Ga0495607_0009030 | 3300046501 | Bacteria | 6778 |
| 434 | Ga0495607_0014781 | 3300046501 | Bacteria | 5074 |
| 435 | Ga0495607_0025554 | 3300046501 | Bacteria | 3671 |
| 436 | Ga0495607_0031783 | 3300046501 | Bacteria | 3229 |
| 437 | Ga0495607_0033106 | 3300046501 | Bacteria | 3147 |
| 438 | Ga0495607_0033463 | 3300046501 | Bacteria | 3127 |
| 439 | Ga0495607_0037857 | 3300046501 | Bacteria | 2893 |
| 440 | Ga0495607_0059837 | 3300046501 | Bacteria | 2170 |
| 441 | Ga0495607_0069096 | 3300046501 | Bacteria | 1978 |
| 442 | Ga0495607_0145855 | 3300046501 | Bacteria | 1216 |
| 443 | Ga0495607_0149734 | 3300046501 | Bacteria | 1195 |
| 444 | Ga0495607_0189997 | 3300046501 | Bacteria | 1023 |
| 445 | Ga0495583_0000521 | 3300046506 | Bacteria | 54646 |
| 446 | Ga0495583_0008207 | 3300046506 | Bacteria | 6414 |
| 447 | Ga0495583_0009383 | 3300046506 | Bacteria | 5853 |
| 448 | Ga0495583_0017192 | 3300046506 | Bacteria | 3852 |
| 449 | Ga0495583_0018242 | 3300046506 | Bacteria | 3697 |
| 450 | Ga0495583_0052920 | 3300046506 | Bacteria | 1844 |
| 451 | Ga0495583_0090412 | 3300046506 | Bacteria | 1319 |
| 452 | Ga0495606_0008218 | 3300046507 | Bacteria | 9122 |
| 453 | Ga0495606_0014967 | 3300046507 | Bacteria | 6015 |
| 454 | Ga0495606_0015945 | 3300046507 | Bacteria | 5759 |
| 455 | Ga0495606_0017185 | 3300046507 | Bacteria | 5480 |
| 456 | Ga0495606_0020027 | 3300046507 | Bacteria | 4950 |
| 457 | Ga0495606_0021665 | 3300046507 | Bacteria | 4701 |
| 458 | Ga0495606_0021913 | 3300046507 | Bacteria | 4672 |
| 459 | Ga0495610_0009001 | 3300046512 | Bacteria | 6375 |
| 460 | Ga0495610_0009088 | 3300046512 | Bacteria | 6330 |
| 461 | Ga0495610_0009663 | 3300046512 | Bacteria | 6072 |
| 462 | Ga0495610_0010838 | 3300046512 | Bacteria | 5628 |
| 463 | Ga0495610_0010961 | 3300046512 | Bacteria | 5583 |
| 464 | Ga0495610_0011192 | 3300046512 | Bacteria | 5502 |
| 465 | Ga0495610_0016561 | 3300046512 | Bacteria | 4236 |
| 466 | Ga0495610_0017103 | 3300046512 | Bacteria | 4145 |
| 467 | Ga0495610_0021570 | 3300046512 | Bacteria | 3538 |
| 468 | Ga0495610_0022453 | 3300046512 | Bacteria | 3451 |
| 469 | Ga0495616_0006907 | 3300046513 | Bacteria | 6835 |
| 470 | Ga0495616_0007521 | 3300046513 | Bacteria | 6520 |
| 471 | Ga0495616_0031688 | 3300046513 | Bacteria | 2766 |
| 472 | Ga0495616_0036809 | 3300046513 | Bacteria | 2522 |
| 473 | Ga0495616_0040658 | 3300046513 | Bacteria | 2374 |
| 474 | Ga0495616_0040746 | 3300046513 | Bacteria | 2371 |
| 475 | Ga0495616_0074250 | 3300046513 | Bacteria | 1639 |
| 476 | Ga0495616_0107565 | 3300046513 | Bacteria | 1299 |
| 477 | Ga0495616_0162218 | 3300046513 | Bacteria | 1004 |
| 478 | Ga0495620_0002844 | 3300046515 | Bacteria | 9940 |
| 479 | Ga0495620_0007056 | 3300046515 | Bacteria | 6128 |
| 480 | Ga0495620_0010613 | 3300046515 | Bacteria | 4851 |
| 481 | Ga0495620_0017763 | 3300046515 | Bacteria | 3538 |
| 482 | Ga0495620_0020290 | 3300046515 | Bacteria | 3248 |
| 483 | Ga0495620_0061060 | 3300046515 | Bacteria | 1569 |
| 484 | Ga0495628_0181046 | 3300046516 | Bacteria | 1594 |
| 485 | Ga0495630_0016649 | 3300046517 | Bacteria | 5376 |
| 486 | Ga0495630_0018980 | 3300046517 | Bacteria | 5053 |
| 487 | Ga0495630_0229999 | 3300046517 | Bacteria | 1416 |
| 488 | Ga0495631_0000478 | 3300046518 | Bacteria | 26772 |
| 489 | Ga0495631_0013312 | 3300046518 | Bacteria | 3995 |
| 490 | Ga0495631_0015929 | 3300046518 | Bacteria | 3592 |
| 491 | Ga0495631_0036200 | 3300046518 | Bacteria | 2205 |
| 492 | Ga0495631_0064148 | 3300046518 | Bacteria | 1590 |
| 493 | Ga0495631_0096372 | 3300046518 | Bacteria | 1273 |
| 494 | Ga0495631_0137474 | 3300046518 | Bacteria | 1049 |
| 495 | Ga0495632_0008307 | 3300046519 | Bacteria | 6392 |
| 496 | Ga0495632_0008784 | 3300046519 | Bacteria | 6155 |
| 497 | Ga0495632_0009540 | 3300046519 | Bacteria | 5838 |
| 498 | Ga0495632_0012646 | 3300046519 | Bacteria | 4857 |
| 499 | Ga0495632_0021411 | 3300046519 | Bacteria | 3483 |
| 500 | Ga0495632_0046790 | 3300046519 | Bacteria | 2148 |
| 501 | Ga0495632_0065324 | 3300046519 | Bacteria | 1757 |
| 502 | Ga0495632_0152365 | 3300046519 | Bacteria | 1068 |
| 503 | Ga0495637_0005988 | 3300046520 | Bacteria | 6148 |
| 504 | Ga0495637_0006397 | 3300046520 | Bacteria | 5916 |
| 505 | Ga0495637_0008319 | 3300046520 | Bacteria | 5101 |
| 506 | Ga0495637_0013389 | 3300046520 | Bacteria | 3892 |
| 507 | Ga0495637_0016295 | 3300046520 | Bacteria | 3475 |
| 508 | Ga0495637_0019368 | 3300046520 | Bacteria | 3147 |
| 509 | Ga0495637_0024487 | 3300046520 | Bacteria | 2731 |
| 510 | Ga0495637_0028419 | 3300046520 | Bacteria | 2498 |
| 511 | Ga0495637_0028490 | 3300046520 | Bacteria | 2494 |
| 512 | Ga0495637_0056372 | 3300046520 | Bacteria | 1626 |
| 513 | Ga0495643_0004605 | 3300046522 | Bacteria | 9598 |
| 514 | Ga0495643_0009458 | 3300046522 | Bacteria | 6057 |
| 515 | Ga0495643_0030091 | 3300046522 | Bacteria | 3034 |
| 516 | Ga0495643_0035228 | 3300046522 | Bacteria | 2757 |
| 517 | Ga0495643_0060090 | 3300046522 | Bacteria | 2018 |
| 518 | Ga0495643_0074811 | 3300046522 | Bacteria | 1773 |
| 519 | Ga0495643_0093988 | 3300046522 | Bacteria | 1543 |
| 520 | Ga0495643_0110761 | 3300046522 | Bacteria | 1396 |
| 521 | Ga0495643_0168391 | 3300046522 | Bacteria | 1073 |
| 522 | Ga0495644_0003999 | 3300046523 | Bacteria | 5797 |
| 523 | Ga0495644_0017355 | 3300046523 | Bacteria | 2752 |
| 524 | Ga0495644_0025760 | 3300046523 | Bacteria | 2231 |
| 525 | Ga0495644_0036872 | 3300046523 | Bacteria | 1844 |
| 526 | Ga0495644_0107092 | 3300046523 | Bacteria | 1059 |
| 527 | Ga0495648_0003220 | 3300046524 | Bacteria | 14476 |
| 528 | Ga0495648_0011986 | 3300046524 | Bacteria | 6497 |
| 529 | Ga0495648_0012916 | 3300046524 | Bacteria | 6201 |
| 530 | Ga0495648_0013468 | 3300046524 | Bacteria | 6043 |
| 531 | Ga0495648_0016867 | 3300046524 | Bacteria | 5248 |
| 532 | Ga0495648_0017468 | 3300046524 | Bacteria | 5125 |
| 533 | Ga0495648_0025421 | 3300046524 | Bacteria | 4009 |
| 534 | Ga0495648_0053097 | 3300046524 | Bacteria | 2457 |
| 535 | Ga0495648_0053759 | 3300046524 | Bacteria | 2437 |
| 536 | Ga0495648_0057512 | 3300046524 | Bacteria | 2331 |
| 537 | Ga0495648_0169917 | 3300046524 | Bacteria | 1118 |
| 538 | Ga0495666_0020490 | 3300046526 | Bacteria | 3275 |
| 539 | Ga0495666_0185577 | 3300046526 | Bacteria | 959 |
| 540 | Ga0495642_0003041 | 3300046528 | Bacteria | 6680 |
| 541 | Ga0495642_0003357 | 3300046528 | Bacteria | 6326 |
| 542 | Ga0495642_0004114 | 3300046528 | Bacteria | 5674 |
| 543 | Ga0495654_0000875 | 3300046530 | Bacteria | 22618 |
| 544 | Ga0495654_0006669 | 3300046530 | Bacteria | 6535 |
| 545 | Ga0495654_0006958 | 3300046530 | Bacteria | 6373 |
| 546 | Ga0495654_0007930 | 3300046530 | Bacteria | 5899 |
| 547 | Ga0495654_0007957 | 3300046530 | Bacteria | 5888 |
| 548 | Ga0495654_0017519 | 3300046530 | Bacteria | 3765 |
| 549 | Ga0495654_0025971 | 3300046530 | Bacteria | 3015 |
| 550 | Ga0495654_0026914 | 3300046530 | Bacteria | 2952 |
| 551 | Ga0495654_0042315 | 3300046530 | Bacteria | 2262 |
| 552 | Ga0495654_0056846 | 3300046530 | Bacteria | 1891 |
| 553 | Ga0495654_0137139 | 3300046530 | Bacteria | 1093 |
| 554 | Ga0495654_0138496 | 3300046530 | Bacteria | 1086 |
| 555 | Ga0495654_0174293 | 3300046530 | Bacteria | 935 |
| 556 | Ga0495586_0087407 | 3300046535 | Bacteria | 1718 |
| 557 | Ga0495609_0000349 | 3300046538 | Bacteria | 40285 |
| 558 | Ga0495609_0005802 | 3300046538 | Bacteria | 6409 |
| 559 | Ga0495609_0021143 | 3300046538 | Bacteria | 3001 |
| 560 | Ga0495609_0071736 | 3300046538 | Bacteria | 1521 |
| 561 | Ga0495609_0154400 | 3300046538 | Bacteria | 975 |
| 562 | Ga0495597_0000221 | 3300046542 | Bacteria | 52360 |
| 563 | Ga0495597_0007884 | 3300046542 | Bacteria | 5369 |
| 564 | Ga0495597_0008152 | 3300046542 | Bacteria | 5268 |
| 565 | Ga0495597_0030946 | 3300046542 | Bacteria | 2436 |
| 566 | Ga0495597_0034302 | 3300046542 | Bacteria | 2293 |
| 567 | Ga0495597_0054950 | 3300046542 | Bacteria | 1747 |
| 568 | Ga0495597_0067832 | 3300046542 | Bacteria | 1542 |
| 569 | Ga0495597_0117828 | 3300046542 | Bacteria | 1108 |
| 570 | Ga0495597_0151905 | 3300046542 | Bacteria | 949 |
| 571 | Ga0495645_0159026 | 3300046543 | Bacteria | 1563 |
| 572 | Ga0495622_0004041 | 3300046557 | Bacteria | 6846 |
| 573 | Ga0495622_0004608 | 3300046557 | Bacteria | 6385 |
| 574 | Ga0495622_0014806 | 3300046557 | Bacteria | 3625 |
| 575 | Ga0495622_0027627 | 3300046557 | Bacteria | 2648 |
| 576 | Ga0495622_0031579 | 3300046557 | Bacteria | 2474 |
| 577 | Ga0495622_0195993 | 3300046557 | Bacteria | 901 |
| 578 | Ga0495622_0209532 | 3300046557 | Bacteria | 866 |
| 579 | Ga0495633_0000287 | 3300046558 | Bacteria | 58020 |
| 580 | Ga0495633_0019202 | 3300046558 | Bacteria | 3457 |
| 581 | Ga0495633_0133599 | 3300046558 | Bacteria | 1148 |
| 582 | Ga0495633_0165922 | 3300046558 | Bacteria | 1018 |
| 583 | Ga0495656_0043668 | 3300046615 | Bacteria | 1883 |
| 584 | Ga0495668_0008686 | 3300046616 | Bacteria | 6314 |
| 585 | Ga0495668_0010764 | 3300046616 | Bacteria | 5523 |
| 586 | Ga0495668_0193595 | 3300046616 | Bacteria | 1113 |
| 587 | Ga0495634_0012371 | 3300046642 | Bacteria | 6179 |
| 588 | Ga0495634_0348377 | 3300046642 | Bacteria | 887 |
| 589 | Ga0495611_0000679 | 3300046648 | Bacteria | 19413 |
| 590 | Ga0495611_0001919 | 3300046648 | Bacteria | 9881 |
| 591 | Ga0495611_0010339 | 3300046648 | Bacteria | 3948 |
| 592 | Ga0495611_0017803 | 3300046648 | Bacteria | 3043 |
| 593 | Ga0495611_0060545 | 3300046648 | Bacteria | 1720 |
| 594 | Ga0495625_0002270 | 3300046660 | Bacteria | 21124 |
| 595 | Ga0495625_0014956 | 3300046660 | Bacteria | 6166 |
| 596 | Ga0495625_0018168 | 3300046660 | Bacteria | 5496 |
| 597 | Ga0495625_0051669 | 3300046660 | Bacteria | 2946 |
| 598 | Ga0495625_0052634 | 3300046660 | Bacteria | 2914 |
| 599 | Ga0495625_0055293 | 3300046660 | Bacteria | 2831 |
| 600 | Ga0495625_0089787 | 3300046660 | Bacteria | 2126 |
| 601 | Ga0495625_0097873 | 3300046660 | Bacteria | 2018 |
| 602 | Ga0495625_0328531 | 3300046660 | Bacteria | 972 |
| 603 | Ga0495635_0011871 | 3300046663 | Bacteria | 6105 |
| 604 | Ga0495635_0078913 | 3300046663 | Bacteria | 2253 |
| 605 | Ga0495659_0002188 | 3300046664 | Bacteria | 6375 |
| 606 | Ga0495659_0017081 | 3300046664 | Bacteria | 2400 |
| 607 | Ga0495659_0074843 | 3300046664 | Bacteria | 1274 |
| 608 | Ga0495659_0127726 | 3300046664 | Bacteria | 1006 |
| 609 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 610 | Ga0495661_0000596 | 3300046665 | Bacteria | 37123 |
| 611 | Ga0495661_0023404 | 3300046665 | Bacteria | 4011 |
| 612 | Ga0495661_0032749 | 3300046665 | Bacteria | 3283 |
| 613 | Ga0495661_0089635 | 3300046665 | Bacteria | 1752 |
| 614 | Ga0495661_0230404 | 3300046665 | Bacteria | 955 |
| 615 | Ga0495588_0046567 | 3300046674 | Bacteria | 2224 |
| 616 | Ga0495657_0396699 | 3300046675 | Bacteria | 812 |
| 617 | Ga0495623_0011027 | 3300046679 | Bacteria | 5847 |
| 618 | Ga0495623_0040153 | 3300046679 | Bacteria | 2988 |
| 619 | Ga0495646_0034820 | 3300046680 | Bacteria | 3125 |
| 620 | Ga0495613_0028914 | 3300046689 | Bacteria | 4122 |
| 621 | Ga0495613_0035907 | 3300046689 | Bacteria | 3676 |
| 622 | Ga0495624_0010386 | 3300046690 | Bacteria | 6418 |
| 623 | Ga0495670_0005708 | 3300046691 | Bacteria | 6104 |
| 624 | Ga0495670_0005850 | 3300046691 | Bacteria | 6026 |
| 625 | Ga0495670_0007057 | 3300046691 | Bacteria | 5531 |
| 626 | Ga0495670_0009118 | 3300046691 | Bacteria | 4878 |
| 627 | Ga0495670_0031281 | 3300046691 | Bacteria | 2644 |
| 628 | Ga0495670_0061676 | 3300046691 | Bacteria | 1885 |
| 629 | Ga0495671_0007066 | 3300046692 | Bacteria | 6428 |
| 630 | Ga0495671_0011040 | 3300046692 | Bacteria | 4986 |
| 631 | Ga0495671_0011460 | 3300046692 | Bacteria | 4875 |
| 632 | Ga0495671_0018162 | 3300046692 | Bacteria | 3734 |
| 633 | Ga0495671_0020947 | 3300046692 | Bacteria | 3440 |
| 634 | Ga0495671_0022238 | 3300046692 | Bacteria | 3323 |
| 635 | Ga0495671_0044886 | 3300046692 | Bacteria | 2214 |
| 636 | Ga0495671_0111003 | 3300046692 | Bacteria | 1339 |
| 637 | Ga0495671_0224292 | 3300046692 | Bacteria | 909 |
| 638 | Ga0495671_0229791 | 3300046692 | Bacteria | 897 |
| 639 | Ga0495649_0003758 | 3300046694 | Bacteria | 10081 |
| 640 | Ga0495649_0007939 | 3300046694 | Bacteria | 6419 |
| 641 | Ga0495649_0013301 | 3300046694 | Bacteria | 4752 |
| 642 | Ga0495649_0027148 | 3300046694 | Bacteria | 3177 |
| 643 | Ga0495649_0029908 | 3300046694 | Bacteria | 3009 |
| 644 | Ga0495649_0049367 | 3300046694 | Bacteria | 2285 |
| 645 | Ga0495649_0087794 | 3300046694 | Bacteria | 1659 |
| 646 | Ga0495649_0159131 | 3300046694 | Bacteria | 1184 |
| 647 | Ga0495649_0204193 | 3300046694 | Bacteria | 1025 |
| 648 | Ga0495589_0005797 | 3300046794 | Bacteria | 6514 |
| 649 | Ga0495589_0006835 | 3300046794 | Bacteria | 6001 |
| 650 | Ga0495589_0007574 | 3300046794 | Bacteria | 5688 |
| 651 | Ga0495589_0009516 | 3300046794 | Bacteria | 5050 |
| 652 | Ga0495589_0012887 | 3300046794 | Bacteria | 4320 |
| 653 | Ga0495589_0018694 | 3300046794 | Bacteria | 3552 |
| 654 | Ga0495589_0021020 | 3300046794 | Bacteria | 3335 |
| 655 | Ga0495589_0035241 | 3300046794 | Bacteria | 2510 |
| 656 | Ga0495589_0053171 | 3300046794 | Bacteria | 1999 |
| 657 | Ga0495600_0275706 | 3300046809 | Bacteria | 1066 |
| 658 | Ga0495660_0001754 | 3300046810 | Bacteria | 14453 |
| 659 | Ga0495660_0005255 | 3300046810 | Bacteria | 7766 |
| 660 | Ga0495660_0014627 | 3300046810 | Bacteria | 4538 |
| 661 | Ga0495660_0034942 | 3300046810 | Bacteria | 2810 |
| 662 | Ga0495660_0051904 | 3300046810 | Bacteria | 2229 |
| 663 | Ga0495660_0082870 | 3300046810 | Bacteria | 1678 |
| 664 | Ga0495660_0126811 | 3300046810 | Bacteria | 1284 |
| 665 | Ga0495581_0020117 | 3300047315 | Bacteria | 3875 |
| 666 | Ga0495604_0014492 | 3300047317 | Bacteria | 6287 |
| 667 | Ga0495604_0019863 | 3300047317 | Bacteria | 5375 |
| 668 | Ga0495604_0080550 | 3300047317 | Bacteria | 2439 |
| 669 | Ga0495604_0172488 | 3300047317 | Bacteria | 1520 |
| 670 | Ga0495636_0023199 | 3300047318 | Bacteria | 2510 |
| 671 | Ga0495674_0022886 | 3300047319 | Bacteria | 5758 |
| 672 | Ga0495672_0004119 | 3300047320 | Bacteria | 12105 |
| 673 | Ga0495672_0010951 | 3300047320 | Bacteria | 6430 |
| 674 | Ga0495672_0010991 | 3300047320 | Bacteria | 6414 |
| 675 | Ga0495672_0011802 | 3300047320 | Bacteria | 6137 |
| 676 | Ga0495672_0012546 | 3300047320 | Bacteria | 5909 |
| 677 | Ga0495672_0012897 | 3300047320 | Bacteria | 5795 |
| 678 | Ga0495672_0025964 | 3300047320 | Bacteria | 3744 |
| 679 | Ga0495672_0067681 | 3300047320 | Bacteria | 2033 |
| 680 | Ga0495672_0188097 | 3300047320 | Bacteria | 1040 |
| 681 | Ga0495676_0019306 | 3300047321 | Bacteria | 5997 |
| 682 | Ga0495676_0044259 | 3300047321 | Bacteria | 3634 |
| 683 | Ga0495676_0346046 | 3300047321 | Bacteria | 994 |
| 684 | Ga0495680_0016282 | 3300047322 | Bacteria | 6394 |
| 685 | Ga0495680_0020043 | 3300047322 | Bacteria | 5635 |
| 686 | Ga0495680_0020798 | 3300047322 | Bacteria | 5509 |
| 687 | Ga0495680_0022963 | 3300047322 | Bacteria | 5192 |
| 688 | Ga0495680_0061528 | 3300047322 | Bacteria | 2888 |
| 689 | Ga0495680_0110478 | 3300047322 | Bacteria | 2037 |
| 690 | Ga0495683_0000053 | 3300047323 | Bacteria | 121769 |
| 691 | Ga0495683_0000176 | 3300047323 | Bacteria | 62784 |
| 692 | Ga0495683_0006693 | 3300047323 | Bacteria | 6277 |
| 693 | Ga0495683_0027993 | 3300047323 | Bacteria | 2881 |
| 694 | Ga0495683_0032221 | 3300047323 | Bacteria | 2670 |
| 695 | Ga0495683_0106796 | 3300047323 | Bacteria | 1340 |
| 696 | Ga0495687_000676 | 3300047443 | Bacteria | 38731 |
| 697 | Ga0495687_008412 | 3300047443 | Bacteria | 5909 |
| 698 | Ga0495687_011711 | 3300047443 | Bacteria | 4692 |
| 699 | Ga0495687_016205 | 3300047443 | Bacteria | 3754 |
| 700 | Ga0495675_0069826 | 3300047444 | Bacteria | 2217 |
| 701 | Ga0495677_0004418 | 3300047445 | Bacteria | 5399 |
| 702 | Ga0495679_002285 | 3300047446 | Bacteria | 9890 |
| 703 | Ga0495679_013289 | 3300047446 | Bacteria | 3099 |
| 704 | Ga0495679_015209 | 3300047446 | Bacteria | 2821 |
| 705 | Ga0495679_073427 | 3300047446 | Bacteria | 981 |
| 706 | Ga0495685_006994 | 3300047447 | Bacteria | 3713 |
| 707 | Ga0495685_022697 | 3300047447 | Bacteria | 2160 |
| 708 | Ga0495673_0000938 | 3300047469 | Bacteria | 26443 |
| 709 | Ga0495673_0001495 | 3300047469 | Bacteria | 18488 |
| 710 | Ga0495673_0002985 | 3300047469 | Bacteria | 11401 |
| 711 | Ga0495673_0007204 | 3300047469 | Bacteria | 6428 |
| 712 | Ga0495673_0007237 | 3300047469 | Bacteria | 6413 |
| 713 | Ga0495673_0008958 | 3300047469 | Bacteria | 5574 |
| 714 | Ga0495673_0012088 | 3300047469 | Bacteria | 4598 |
| 715 | Ga0495673_0015257 | 3300047469 | Bacteria | 3962 |
| 716 | Ga0495673_0020580 | 3300047469 | Bacteria | 3282 |
| 717 | Ga0495673_0039272 | 3300047469 | Bacteria | 2148 |
| 718 | Ga0495673_0064910 | 3300047469 | Bacteria | 1551 |
| 719 | Ga0495673_0161633 | 3300047469 | Bacteria | 859 |
| 720 | Ga0495681_0000588 | 3300047470 | Bacteria | 27772 |
| 721 | Ga0495681_0005805 | 3300047470 | Bacteria | 8201 |
| 722 | Ga0495681_0009539 | 3300047470 | Bacteria | 5964 |
| 723 | Ga0495681_0009601 | 3300047470 | Bacteria | 5943 |
| 724 | Ga0495681_0010451 | 3300047470 | Bacteria | 5617 |
| 725 | Ga0495681_0010626 | 3300047470 | Bacteria | 5561 |
| 726 | Ga0495681_0010743 | 3300047470 | Bacteria | 5516 |
| 727 | Ga0495681_0020902 | 3300047470 | Bacteria | 3539 |
| 728 | Ga0495681_0023530 | 3300047470 | Bacteria | 3270 |
| 729 | Ga0495681_0029275 | 3300047470 | Bacteria | 2820 |
| 730 | Ga0495681_0035413 | 3300047470 | Bacteria | 2479 |
| 731 | Ga0495681_0041589 | 3300047470 | Bacteria | 2230 |
| 732 | Ga0495681_0100436 | 3300047470 | Bacteria | 1265 |
| 733 | Ga0495681_0151076 | 3300047470 | Bacteria | 974 |
| 734 | Ga0495684_0154978 | 3300047471 | Bacteria | 1711 |
| 735 | Ga0495684_0365772 | 3300047471 | Bacteria | 1020 |
| 736 | Ga0495686_0018147 | 3300047472 | Bacteria | 4726 |
| 737 | Ga0495686_0021228 | 3300047472 | Bacteria | 4318 |
| 738 | Ga0495686_0023740 | 3300047472 | Bacteria | 4038 |
| 739 | Ga0495686_0039147 | 3300047472 | Bacteria | 3029 |
| 740 | Ga0495686_0285183 | 3300047472 | Bacteria | 917 |
| 741 | Ga0495593_0059771 | 3300047673 | Bacteria | 1997 |
| 742 | Ga0495593_0128828 | 3300047673 | Bacteria | 1285 |
| 743 | Ga0495593_0209231 | 3300047673 | Bacteria | 979 |
| 744 | Ga0495602_0133851 | 3300048088 | Bacteria | 1972 |
| 745 | Ga0495602_0232462 | 3300048088 | Bacteria | 1384 |
| 746 | Ga0495626_0000721 | 3300048091 | Bacteria | 30932 |
| 747 | Ga0495626_0002158 | 3300048091 | Bacteria | 14181 |
| 748 | Ga0495626_0007151 | 3300048091 | Bacteria | 6241 |
| 749 | Ga0495626_0007269 | 3300048091 | Bacteria | 6177 |
| 750 | Ga0495626_0008235 | 3300048091 | Bacteria | 5736 |
| 751 | Ga0495626_0009970 | 3300048091 | Bacteria | 5102 |
| 752 | Ga0495626_0010027 | 3300048091 | Bacteria | 5082 |
| 753 | Ga0495626_0036297 | 3300048091 | Bacteria | 2348 |
| 754 | Ga0496102_0017499 | 3300048905 | Bacteria | 6277 |
| 755 | Ga0496103_0008923 | 3300048906 | Bacteria | 5944 |
| 756 | Ga0496105_0379909 | 3300048908 | Bacteria | 1124 |
| 757 | Ga0496110_0178192 | 3300048913 | Bacteria | 1930 |
| 758 | Ga0496111_0094149 | 3300048914 | Bacteria | 2197 |
| 759 | Ga0496115_0432897 | 3300048918 | Bacteria | 1064 |
| 760 | Ga0496116_0001102 | 3300048919 | Bacteria | 32408 |
| 761 | Ga0496116_0001892 | 3300048919 | Bacteria | 22607 |
| 762 | Ga0496116_0013194 | 3300048919 | Bacteria | 6683 |
| 763 | Ga0496116_0028107 | 3300048919 | Bacteria | 4080 |
| 764 | Ga0496116_0036122 | 3300048919 | Bacteria | 3462 |
| 765 | Ga0496116_0063853 | 3300048919 | Bacteria | 2370 |
| 766 | Ga0496117_0002125 | 3300048920 | Bacteria | 25937 |
| 767 | Ga0496117_0003138 | 3300048920 | Bacteria | 19704 |
| 768 | Ga0496117_0021272 | 3300048920 | Bacteria | 5255 |
| 769 | Ga0496117_0049167 | 3300048920 | Bacteria | 3003 |
| 770 | Ga0496117_0106235 | 3300048920 | Bacteria | 1762 |
| 771 | Ga0496117_0120247 | 3300048920 | Bacteria | 1615 |
| 772 | Ga0496117_0229352 | 3300048920 | Bacteria | 1027 |
| 773 | Ga0496118_0025614 | 3300048921 | Bacteria | 5050 |
| 774 | Ga0496118_0032940 | 3300048921 | Bacteria | 4259 |
| 775 | Ga0496118_0041866 | 3300048921 | Bacteria | 3620 |
| 776 | Ga0496118_0157774 | 3300048921 | Bacteria | 1408 |
| 777 | Ga0496118_0191515 | 3300048921 | Bacteria | 1222 |
| 778 | Ga0496118_0227488 | 3300048921 | Bacteria | 1079 |
| 779 | Ga0496119_0025020 | 3300048922 | Bacteria | 4179 |
| 780 | Ga0496119_0089649 | 3300048922 | Bacteria | 1750 |
| 781 | Ga0496119_0110366 | 3300048922 | Bacteria | 1528 |
| 782 | Ga0496120_0032235 | 3300048923 | Bacteria | 3161 |
| 783 | Ga0496120_0202094 | 3300048923 | Bacteria | 961 |
| 784 | Ga0496121_0000781 | 3300048924 | Bacteria | 58375 |
| 785 | Ga0496121_0046437 | 3300048924 | Bacteria | 3717 |
| 786 | Ga0496121_0075467 | 3300048924 | Bacteria | 2693 |
| 787 | Ga0496121_0193598 | 3300048924 | Bacteria | 1455 |
| 788 | Ga0496122_0001762 | 3300048925 | Bacteria | 33218 |
| 789 | Ga0496122_0018352 | 3300048925 | Bacteria | 6472 |
| 790 | Ga0496122_0018887 | 3300048925 | Bacteria | 6333 |
| 791 | Ga0496123_0001295 | 3300048926 | Bacteria | 35624 |
| 792 | Ga0496123_0014533 | 3300048926 | Bacteria | 6518 |
| 793 | Ga0496123_0159601 | 3300048926 | Bacteria | 1204 |
| 794 | Ga0496124_0002323 | 3300048927 | Bacteria | 25088 |
| 795 | Ga0496124_0026032 | 3300048927 | Bacteria | 5282 |
| 796 | Ga0496124_0154606 | 3300048927 | Bacteria | 1795 |
| 797 | Ga0496124_0162748 | 3300048927 | Bacteria | 1737 |
| 798 | Ga0496124_0173757 | 3300048927 | Bacteria | 1665 |
| 799 | Ga0496125_0002291 | 3300048928 | Bacteria | 25314 |
| 800 | Ga0496125_0019099 | 3300048928 | Bacteria | 6479 |
| 801 | Ga0496125_0054616 | 3300048928 | Bacteria | 3262 |
| 802 | Ga0496125_0149095 | 3300048928 | Bacteria | 1610 |
| 803 | Ga0496126_0146537 | 3300048929 | Bacteria | 2027 |
| 804 | Ga0496126_0166247 | 3300048929 | Bacteria | 1882 |
| 805 | Ga0496126_0582464 | 3300048929 | Bacteria | 884 |
| 806 | Ga0495678_000362 | 3300049459 | Bacteria | 46331 |
| 807 | Ga0495678_007338 | 3300049459 | Bacteria | 5724 |
| 808 | Ga0495678_007420 | 3300049459 | Bacteria | 5681 |
| 809 | Ga0495678_010370 | 3300049459 | Bacteria | 4535 |
| 810 | Ga0495678_017505 | 3300049459 | Bacteria | 3246 |
| 811 | Ga0495678_020346 | 3300049459 | Bacteria | 2941 |
| 812 | Ga0495678_030754 | 3300049459 | Bacteria | 2243 |
| 813 | Ga0495678_038732 | 3300049459 | Bacteria | 1926 |
| 814 | Ga0495678_050308 | 3300049459 | Bacteria | 1615 |
| 815 | Ga0495678_057954 | 3300049459 | Bacteria | 1465 |
| 816 | Ga0495678_058781 | 3300049459 | Bacteria | 1452 |
| 817 | Ga0495678_068185 | 3300049459 | Bacteria | 1312 |
| 818 | Ga0495678_122652 | 3300049459 | Bacteria | 870 |
| 819 | Ga0495682_0000344 | 3300049460 | Bacteria | 34342 |
| 820 | Ga0495682_0016549 | 3300049460 | Bacteria | 2790 |
| 821 | Ga0495682_0124754 | 3300049460 | Bacteria | 921 |
| 822 | Ga0501227_065892 | 3300049665 | Bacteria | 935 |
| 823 | Ga0501241_015355 | 3300049758 | Bacteria | 1392 |
| 824 | Ga0501226_000022 | 3300049853 | Bacteria | 111874 |
| 825 | nmdc:mga03n38_176280_c1 | 3300050490 | Bacteria | 1092 |
| 826 | nmdc:mga00v17_267365_c1 | 3300050491 | Bacteria | 1110 |
| 827 | nmdc:mga00v17_73054_c1 | 3300050491 | Bacteria | 2129 |
| 828 | nmdc:mga08x19_267819_c1 | 3300050514 | Bacteria | 1182 |
| 829 | nmdc:mga0sz30_22593_c1 | 3300050516 | Bacteria | 2554 |
| 830 | Ga0500573_0031135 | 3300053140 | Bacteria | 3078 |
| 831 | Ga0500634_0011370 | 3300053161 | Bacteria | 4591 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0396699 | Ga0495657_0396699_20_721 | 233 |
| 2 | 3300025291 | Ga0209675_1001650 | Ga0209675_10016508 | 234 |
| 3 | 3300046512 | Ga0495610_0022453 | Ga0495610_0022453_10_714 | 234 |
| 4 | 3300046460 | Ga0495638_0037932 | Ga0495638_0037932_171_878 | 235 |
| 5 | 3300009036 | Ga0105244_10004356 | Ga0105244_1000435610 | 248 |
| 6 | 3300042439 | Ga0439464_0016553 | Ga0439464_0016553_992_1807 | 253 |
| 7 | 3300031548 | Ga0307408_100022832 | Ga0307408_1000228322 | 258 |
| 8 | 3300042013 | Ga0439456_010689 | Ga0439456_010689_1090_1869 | 259 |
| 9 | 3300042138 | Ga0450903_007767 | Ga0450903_007767_11_790 | 259 |
| 10 | 3300042185 | Ga0450909_028066 | Ga0450909_028066_41_820 | 259 |
| 11 | 3300046460 | Ga0495638_0020515 | Ga0495638_0020515_3565_4344 | 259 |
| 12 | 3300046501 | Ga0495607_0059837 | Ga0495607_0059837_1377_2156 | 259 |
| 13 | 3300046522 | Ga0495643_0110761 | Ga0495643_0110761_28_807 | 259 |
| 14 | 3300046530 | Ga0495654_0137139 | Ga0495654_0137139_279_1058 | 259 |
| 15 | 3300046542 | Ga0495597_0008152 | Ga0495597_0008152_4464_5243 | 259 |
| 16 | 3300046542 | Ga0495597_0151905 | Ga0495597_0151905_19_798 | 259 |
| 17 | 3300046665 | Ga0495661_0023404 | Ga0495661_0023404_3203_3982 | 259 |
| 18 | 3300047469 | Ga0495673_0161633 | Ga0495673_0161633_55_834 | 259 |
| 19 | 3300047472 | Ga0495686_0285183 | Ga0495686_0285183_18_797 | 259 |
| 20 | 3300002705 | JGI25156J39149_1006926 | JGI25156J39149_10069263 | 262 |
| 21 | 3300002737 | JGI25162J39368_1000732 | JGI25162J39368_10007329 | 262 |
| 22 | 3300002772 | JGI25164J39214_1000085 | JGI25164J39214_10000859 | 262 |
| 23 | 3300003214 | JGI25165J46597_1000090 | JGI25165J46597_100009086 | 262 |
| 24 | 3300003759 | Ga0055525_1000097 | Ga0055525_100009753 | 262 |
| 25 | 3300003760 | Ga0055527_1000198 | Ga0055527_100019820 | 262 |
| 26 | 3300003761 | Ga0055535_1000795 | Ga0055535_100079516 | 262 |
| 27 | 3300003761 | Ga0055535_1001887 | Ga0055535_10018879 | 262 |
| 28 | 3300003762 | Ga0055542_1000441 | Ga0055542_100044120 | 262 |
| 29 | 3300003762 | Ga0055542_1001802 | Ga0055542_10018023 | 262 |
| 30 | 3300003763 | Ga0055529_1000591 | Ga0055529_100059111 | 262 |
| 31 | 3300003763 | Ga0055529_1001179 | Ga0055529_100117910 | 262 |
| 32 | 3300005455 | Ga0070663_100010411 | Ga0070663_1000104112 | 262 |
| 33 | 3300005546 | Ga0070696_100037356 | Ga0070696_1000373562 | 262 |
| 34 | 3300005547 | Ga0070693_100011231 | Ga0070693_1000112313 | 262 |
| 35 | 3300005563 | Ga0068855_100078707 | Ga0068855_1000787072 | 262 |
| 36 | 3300005614 | Ga0068856_100004288 | Ga0068856_1000042882 | 262 |
| 37 | 3300009093 | Ga0105240_10084626 | Ga0105240_100846262 | 262 |
| 38 | 3300009545 | Ga0105237_10001820 | Ga0105237_1000182012 | 262 |
| 39 | 3300009551 | Ga0105238_10184205 | Ga0105238_101842052 | 262 |
| 40 | 3300013104 | Ga0157370_10024052 | Ga0157370_100240525 | 262 |
| 41 | 3300013105 | Ga0157369_10003663 | Ga0157369_1000366317 | 262 |
| 42 | 3300020070 | Ga0206356_10901725 | Ga0206356_109017251 | 262 |
| 43 | 3300020082 | Ga0206353_11308317 | Ga0206353_113083175 | 262 |
| 44 | 3300025228 | Ga0209672_100007 | Ga0209672_100007187 | 262 |
| 45 | 3300025228 | Ga0209672_100389 | Ga0209672_1003893 | 262 |
| 46 | 3300025230 | Ga0209563_100079 | Ga0209563_10007952 | 262 |
| 47 | 3300025231 | Ga0207427_100033 | Ga0207427_100033232 | 262 |
| 48 | 3300025233 | Ga0209437_100105 | Ga0209437_100105131 | 262 |
| 49 | 3300025242 | Ga0209258_100046 | Ga0209258_100046150 | 262 |
| 50 | 3300025242 | Ga0209258_100095 | Ga0209258_100095179 | 262 |
| 51 | 3300025246 | Ga0209646_1001353 | Ga0209646_10013539 | 262 |
| 52 | 3300025250 | Ga0209026_1000335 | Ga0209026_100033519 | 262 |
| 53 | 3300025254 | Ga0209148_1000039 | Ga0209148_1000039391 | 262 |
| 54 | 3300025254 | Ga0209148_1000098 | Ga0209148_100009821 | 262 |
| 55 | 3300025256 | Ga0209759_1008956 | Ga0209759_10089564 | 262 |
| 56 | 3300025261 | Ga0209233_1000080 | Ga0209233_1000080232 | 262 |
| 57 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010187 | 262 |
| 58 | 3300025272 | Ga0209455_1000034 | Ga0209455_1000034392 | 262 |
| 59 | 3300025272 | Ga0209455_1000310 | Ga0209455_100031021 | 262 |
| 60 | 3300025913 | Ga0207695_10001592 | Ga0207695_100015926 | 262 |
| 61 | 3300025914 | Ga0207671_10001137 | Ga0207671_1000113735 | 262 |
| 62 | 3300025924 | Ga0207694_10068547 | Ga0207694_100685472 | 262 |
| 63 | 3300025949 | Ga0207667_10081214 | Ga0207667_100812142 | 262 |
| 64 | 3300025981 | Ga0207640_10105810 | Ga0207640_101058103 | 262 |
| 65 | 3300026067 | Ga0207678_10001305 | Ga0207678_1000130512 | 262 |
| 66 | 3300026078 | Ga0207702_10000231 | Ga0207702_1000023112 | 262 |
| 67 | iso_pu_bacteria | 3007252601 | 3007253137 | 266 |
| 68 | iso_pu_bacteria | 3007315729 | 3007318085 | 266 |
| 69 | iso_pu_bacteria | 2511231004 | 2511256779 | 267 |
| 70 | iso_pu_bacteria | 2511231006 | 2511266738 | 267 |
| 71 | iso_pu_bacteria | 2511231007 | 2511274726 | 267 |
| 72 | iso_pu_bacteria | 2511231008 | 2511277746 | 267 |
| 73 | iso_pu_bacteria | 2511231010 | 2511287627 | 267 |
| 74 | iso_pu_bacteria | 2511231011 | 2511297540 | 267 |
| 75 | iso_pu_bacteria | 2511231012 | 2511303141 | 267 |
| 76 | iso_pu_bacteria | 2511231014 | 2511314148 | 267 |
| 77 | iso_pu_bacteria | 2511231015 | 2511319695 | 267 |
| 78 | iso_pu_bacteria | 2511231016 | 2511329036 | 267 |
| 79 | iso_pu_bacteria | 2511231017 | 2511330503 | 267 |
| 80 | iso_pu_bacteria | 2511231018 | 2511339682 | 267 |
| 81 | iso_pu_bacteria | 2511231019 | 2511344981 | 267 |
| 82 | iso_pu_bacteria | 2511231020 | 2511350712 | 267 |
| 83 | iso_pu_bacteria | 2511231021 | 2511360103 | 267 |
| 84 | iso_pu_bacteria | 2511231022 | 2511360766 | 267 |
| 85 | iso_pu_bacteria | 2511231023 | 2511371462 | 267 |
| 86 | iso_pu_bacteria | 2511231031 | 2511410696 | 267 |
| 87 | iso_pu_bacteria | 2512047018 | 2512324763 | 267 |
| 88 | iso_pu_bacteria | 2554235341 | 2555668778 | 267 |
| 89 | iso_pu_bacteria | 2582580891 | 2583793841 | 267 |
| 90 | iso_pu_bacteria | 2597489887 | 2597856969 | 267 |
| 91 | iso_pu_bacteria | 2597489889 | 2597871259 | 267 |
| 92 | iso_pu_bacteria | 2599185160 | 2599357153 | 267 |
| 93 | iso_pu_bacteria | 2599185161 | 2599362060 | 267 |
| 94 | iso_pu_bacteria | 2599185162 | 2599368380 | 267 |
| 95 | iso_pu_bacteria | 2599185163 | 2599375169 | 267 |
| 96 | iso_pu_bacteria | 2599185164 | 2599382258 | 267 |
| 97 | iso_pu_bacteria | 2599185165 | 2599388705 | 267 |
| 98 | iso_pu_bacteria | 2599185166 | 2599394027 | 267 |
| 99 | iso_pu_bacteria | 2599185167 | 2599402025 | 267 |
| 100 | iso_pu_bacteria | 2599185168 | 2599405792 | 267 |
| 101 | iso_pu_bacteria | 2599185179 | 2599454283 | 267 |
| 102 | iso_pu_bacteria | 2599185181 | 2599464346 | 267 |
| 103 | iso_pu_bacteria | 2599185182 | 2599468666 | 267 |
| 104 | iso_pu_bacteria | 2599185185 | 2599483993 | 267 |
| 105 | iso_pu_bacteria | 2599185186 | 2599493365 | 267 |
| 106 | iso_pu_bacteria | 2599185188 | 2599504316 | 267 |
| 107 | iso_pu_bacteria | 2599185189 | 2599510653 | 267 |
| 108 | iso_pu_bacteria | 2599185190 | 2599512321 | 267 |
| 109 | iso_pu_bacteria | 2599185191 | 2599520480 | 267 |
| 110 | iso_pu_bacteria | 2599185257 | 2599801644 | 267 |
| 111 | iso_pu_bacteria | 2599185290 | 2599890997 | 267 |
| 112 | iso_pu_bacteria | 2599185300 | 2599933423 | 267 |
| 113 | iso_pu_bacteria | 2599185356 | 2600216623 | 267 |
| 114 | iso_pu_bacteria | 2600254931 | 2600365932 | 267 |
| 115 | iso_pu_bacteria | 2600255296 | 2601689290 | 267 |
| 116 | iso_pu_bacteria | 2600255313 | 2601776784 | 267 |
| 117 | iso_pu_bacteria | 2600255318 | 2601796409 | 267 |
| 118 | iso_pu_bacteria | 2603880185 | 2606073559 | 267 |
| 119 | iso_pu_bacteria | 2603880199 | 2606126797 | 267 |
| 120 | iso_pu_bacteria | 2606217733 | 2608381787 | 267 |
| 121 | iso_pu_bacteria | 2619619299 | 2621298057 | 267 |
| 122 | iso_pu_bacteria | 2623620443 | 2624482057 | 267 |
| 123 | iso_pu_bacteria | 2623620446 | 2624490858 | 267 |
| 124 | iso_pu_bacteria | 2643221565 | 2643845097 | 267 |
| 125 | iso_pu_bacteria | 2643221571 | 2643871789 | 267 |
| 126 | iso_pu_bacteria | 2643221589 | 2643956623 | 267 |
| 127 | iso_pu_bacteria | 2643221602 | 2644025334 | 267 |
| 128 | iso_pu_bacteria | 2643221633 | 2644187685 | 267 |
| 129 | iso_pu_bacteria | 2643221713 | 2644624288 | 267 |
| 130 | iso_pu_bacteria | 2667528171 | 2671098699 | 267 |
| 131 | iso_pu_bacteria | 2671180172 | 2671768593 | 267 |
| 132 | iso_pu_bacteria | 2675903420 | 2677900199 | 267 |
| 133 | iso_pu_bacteria | 2713897148 | 2715751367 | 267 |
| 134 | iso_pu_bacteria | 2713897149 | 2715758358 | 267 |
| 135 | iso_pu_bacteria | 2718217725 | 2718635299 | 267 |
| 136 | iso_pu_bacteria | 2721755607 | 2723250166 | 267 |
| 137 | iso_pu_bacteria | 2738541265 | 2738675189 | 267 |
| 138 | iso_pu_bacteria | 2738541282 | 2738753593 | 267 |
| 139 | iso_pu_bacteria | 2738541303 | 2738862582 | 267 |
| 140 | iso_pu_bacteria | 2738543004 | 2739197040 | 267 |
| 141 | iso_pu_bacteria | 2738543015 | 2739259109 | 267 |
| 142 | iso_pu_bacteria | 2738543025 | 2739315094 | 267 |
| 143 | iso_pu_bacteria | 2740892503 | 2743736394 | 267 |
| 144 | iso_pu_bacteria | 2773857670 | 2774122696 | 267 |
| 145 | iso_pu_bacteria | 2773857673 | 2774132995 | 267 |
| 146 | iso_pu_bacteria | 2784132063 | 2784263178 | 267 |
| 147 | iso_pu_bacteria | 2784132072 | 2784317934 | 267 |
| 148 | iso_pu_bacteria | 2791355520 | 2794595940 | 267 |
| 149 | iso_pu_bacteria | 2808606373 | 2808907606 | 267 |
| 150 | iso_pu_bacteria | 2808606377 | 2808929853 | 267 |
| 151 | iso_pu_bacteria | 2808606381 | 2808952072 | 267 |
| 152 | iso_pu_bacteria | 2808606382 | 2808957201 | 267 |
| 153 | iso_pu_bacteria | 2808606445 | 2809218981 | 267 |
| 154 | iso_pu_bacteria | 2816332298 | 2817492803 | 267 |
| 155 | iso_pu_bacteria | 2818991456 | 2819655795 | 267 |
| 156 | iso_pu_bacteria | 2818991464 | 2819703820 | 267 |
| 157 | iso_pu_bacteria | 2823421272 | 2823424428 | 267 |
| 158 | iso_pu_bacteria | 2826581358 | 2826583629 | 267 |
| 159 | iso_pu_bacteria | 2834028612 | 2834031592 | 267 |
| 160 | iso_pu_bacteria | 2842815866 | 2842818125 | 267 |
| 161 | iso_pu_bacteria | 2842826826 | 2842827385 | 267 |
| 162 | iso_pu_bacteria | 2842832357 | 2842836659 | 267 |
| 163 | iso_pu_bacteria | 2842837860 | 2842843064 | 267 |
| 164 | iso_pu_bacteria | 2842843487 | 2842844775 | 267 |
| 165 | iso_pu_bacteria | 2842849001 | 2842849240 | 267 |
| 166 | iso_pu_bacteria | 2852657418 | 2852661383 | 267 |
| 167 | iso_pu_bacteria | 2860339153 | 2860340959 | 267 |
| 168 | iso_pu_bacteria | 2878029506 | 2878034038 | 267 |
| 169 | iso_pu_bacteria | 2880230671 | 2880234663 | 267 |
| 170 | iso_pu_bacteria | 2904518522 | 2904521203 | 267 |
| 171 | iso_pu_bacteria | 2904550169 | 2904555232 | 267 |
| 172 | iso_pu_bacteria | 2917070673 | 2917072554 | 267 |
| 173 | iso_pu_bacteria | 2919063839 | 2919069340 | 267 |
| 174 | iso_pu_bacteria | 2919385768 | 2919388138 | 267 |
| 175 | iso_pu_bacteria | 2919456309 | 2919460940 | 267 |
| 176 | iso_pu_bacteria | 2919487758 | 2919489675 | 267 |
| 177 | iso_pu_bacteria | 2919501602 | 2919504155 | 267 |
| 178 | iso_pu_bacteria | 2919697872 | 2919703284 | 267 |
| 179 | iso_pu_bacteria | 2923153595 | 2923155408 | 267 |
| 180 | iso_pu_bacteria | 2926063275 | 2926065272 | 267 |
| 181 | iso_pu_bacteria | 2929189879 | 2929193971 | 267 |
| 182 | iso_pu_bacteria | 2931390751 | 2931395263 | 267 |
| 183 | iso_pu_bacteria | 2931396565 | 2931396701 | 267 |
| 184 | iso_pu_bacteria | 2935353572 | 2935354718 | 267 |
| 185 | iso_pu_bacteria | 2939636861 | 2939637498 | 267 |
| 186 | iso_pu_bacteria | 2946027586 | 2946032465 | 267 |
| 187 | iso_pu_bacteria | 2947233263 | 2947239274 | 267 |
| 188 | iso_pu_bacteria | 2969304461 | 2969308818 | 267 |
| 189 | iso_pu_bacteria | 2974289157 | 2974289805 | 267 |
| 190 | iso_pu_bacteria | 2984286254 | 2984290625 | 267 |
| 191 | iso_pu_bacteria | 2998139840 | 2998144121 | 267 |
| 192 | iso_pu_bacteria | 3007395558 | 3007400947 | 267 |
| 193 | iso_pu_bacteria | 3007419365 | 3007424368 | 267 |
| 194 | iso_pu_bacteria | 3007511990 | 3007515873 | 267 |
| 195 | iso_pu_bacteria | 3007614139 | 3007619615 | 267 |
| 196 | iso_pu_bacteria | 3007619802 | 3007619953 | 267 |
| 197 | iso_pu_bacteria | 3007718800 | 3007719046 | 267 |
| 198 | iso_pu_bacteria | 3007855910 | 3007858896 | 267 |
| 199 | iso_pu_bacteria | 3007861166 | 3007865551 | 267 |
| 200 | iso_pu_bacteria | 8015687852 | 8015689629 | 267 |
| 201 | iso_pu_bacteria | 8019775933 | 8019779415 | 267 |
| 202 | iso_pu_bacteria | 8029995093 | 8029996760 | 267 |
| 203 | iso_pu_bacteria | 8054285046 | 8054289523 | 267 |
| 204 | iso_pu_bacteria | 8054347763 | 8054349106 | 267 |
| 205 | iso_pu_bacteria | 8055770955 | 8055772765 | 267 |
| 206 | iso_pu_bacteria | 8055817908 | 8055822703 | 267 |
| 207 | iso_pu_bacteria | 8056125926 | 8056130392 | 267 |
| 208 | iso_pu_bacteria | 8056131705 | 8056136154 | 267 |
| 209 | iso_pu_bacteria | 8056148874 | 8056150032 | 267 |
| 210 | iso_pu_bacteria | 8056155041 | 8056155168 | 267 |
| 211 | iso_pu_bacteria | 8056161164 | 8056162411 | 267 |
| 212 | iso_pu_bacteria | 8056166840 | 8056167163 | 267 |
| 213 | iso_pu_bacteria | 8056172158 | 8056173132 | 267 |
| 214 | iso_pu_bacteria | 8056177738 | 8056180120 | 267 |
| 215 | iso_pu_bacteria | 8056569372 | 8056572859 | 267 |
| 216 | 3300046512 | Ga0495610_0009001 | Ga0495610_0009001_4430_5260 | 268 |
| 217 | iso_pu_bacteria | 2597489888 | 2597862606 | 268 |
| 218 | iso_pu_bacteria | 637000220 | 637319138 | 268 |
| 219 | 3300009011 | Ga0105251_10073371 | Ga0105251_100733712 | 270 |
| 220 | 3300013102 | Ga0157371_10019628 | Ga0157371_100196286 | 270 |
| 221 | 3300015261 | Ga0182006_1006695 | Ga0182006_10066954 | 270 |
| 222 | 3300027312 | Ga0209371_1000359 | Ga0209371_10003593 | 270 |
| 223 | 3300030500 | Ga0268256_1000305 | Ga0268256_10003053 | 270 |
| 224 | 3300042010 | Ga0439452_013941 | Ga0439452_013941_960_1772 | 270 |
| 225 | 3300048926 | Ga0496123_0159601 | Ga0496123_0159601_203_1015 | 270 |
| 226 | 2124908027 | MRS2a_Contig_5007 | MRS2a_00558570 | 271 |
| 227 | 3300002771 | JGI25163J39215_1000824 | JGI25163J39215_10008242 | 271 |
| 228 | 3300002771 | JGI25163J39215_1000932 | JGI25163J39215_10009322 | 271 |
| 229 | 3300002772 | JGI25164J39214_1000296 | JGI25164J39214_10002963 | 271 |
| 230 | 3300002772 | JGI25164J39214_1000469 | JGI25164J39214_100046920 | 271 |
| 231 | 3300003214 | JGI25165J46597_1000528 | JGI25165J46597_10005283 | 271 |
| 232 | 3300003214 | JGI25165J46597_1000864 | JGI25165J46597_100086420 | 271 |
| 233 | 3300003323 | rootH1_10315725 | rootH1_103157252 | 271 |
| 234 | 3300003751 | Ga0055538_1000132 | Ga0055538_100013220 | 271 |
| 235 | 3300003752 | Ga0055539_1000177 | Ga0055539_100017720 | 271 |
| 236 | 3300003756 | Ga0055533_1000179 | Ga0055533_100017920 | 271 |
| 237 | 3300003758 | Ga0055532_1000179 | Ga0055532_100017937 | 271 |
| 238 | 3300003759 | Ga0055525_1000408 | Ga0055525_100040820 | 271 |
| 239 | 3300003781 | Ga0055536_1003265 | Ga0055536_10032652 | 271 |
| 240 | 3300003791 | Ga0055530_10000671 | Ga0055530_1000067131 | 271 |
| 241 | 3300003791 | Ga0055530_10004397 | Ga0055530_100043978 | 271 |
| 242 | 3300003792 | Ga0055540_1000400 | Ga0055540_100040039 | 271 |
| 243 | 3300003794 | Ga0055531_10000202 | Ga0055531_1000020231 | 271 |
| 244 | 3300003841 | Ga0055541_1000118 | Ga0055541_100011820 | 271 |
| 245 | 3300005288 | Ga0065714_10004576 | Ga0065714_100045762 | 271 |
| 246 | 3300005288 | Ga0065714_10008187 | Ga0065714_100081872 | 271 |
| 247 | 3300005288 | Ga0065714_10010654 | Ga0065714_100106543 | 271 |
| 248 | 3300005288 | Ga0065714_10015583 | Ga0065714_100155832 | 271 |
| 249 | 3300005288 | Ga0065714_10076538 | Ga0065714_100765382 | 271 |
| 250 | 3300005288 | Ga0065714_10077353 | Ga0065714_100773532 | 271 |
| 251 | 3300005288 | Ga0065714_10087468 | Ga0065714_100874681 | 271 |
| 252 | 3300005288 | Ga0065714_10198784 | Ga0065714_101987841 | 271 |
| 253 | 3300005288 | Ga0065714_10203413 | Ga0065714_102034131 | 271 |
| 254 | 3300005293 | Ga0065715_10002678 | Ga0065715_100026782 | 271 |
| 255 | 3300005344 | Ga0070661_100000284 | Ga0070661_10000028419 | 271 |
| 256 | 3300005353 | Ga0070669_100001202 | Ga0070669_10000120219 | 271 |
| 257 | 3300005457 | Ga0070662_100000804 | Ga0070662_1000008047 | 271 |
| 258 | 3300005539 | Ga0068853_100003812 | Ga0068853_1000038126 | 271 |
| 259 | 3300005548 | Ga0070665_100013903 | Ga0070665_1000139038 | 271 |
| 260 | 3300005564 | Ga0070664_100000681 | Ga0070664_1000006818 | 271 |
| 261 | 3300005564 | Ga0070664_100127710 | Ga0070664_1001277102 | 271 |
| 262 | 3300005578 | Ga0068854_100023043 | Ga0068854_1000230434 | 271 |
| 263 | 3300005834 | Ga0068851_10000011 | Ga0068851_1000001186 | 271 |
| 264 | 3300006048 | Ga0075363_100149968 | Ga0075363_1001499682 | 271 |
| 265 | 3300006058 | Ga0075432_10004638 | Ga0075432_100046382 | 271 |
| 266 | 3300006058 | Ga0075432_10008264 | Ga0075432_100082642 | 271 |
| 267 | 3300006177 | Ga0075362_10156000 | Ga0075362_101560002 | 271 |
| 268 | 3300006177 | Ga0075362_10191915 | Ga0075362_101919151 | 271 |
| 269 | 3300006186 | Ga0075369_10029817 | Ga0075369_100298172 | 271 |
| 270 | 3300006914 | Ga0075436_100086856 | Ga0075436_1000868562 | 271 |
| 271 | 3300006946 | Ga0079104_1000668 | Ga0079104_100066828 | 271 |
| 272 | 3300006946 | Ga0079104_1020161 | Ga0079104_10201612 | 271 |
| 273 | 3300009011 | Ga0105251_10007772 | Ga0105251_100077726 | 271 |
| 274 | 3300009011 | Ga0105251_10008998 | Ga0105251_100089982 | 271 |
| 275 | 3300009011 | Ga0105251_10034102 | Ga0105251_100341022 | 271 |
| 276 | 3300009011 | Ga0105251_10039370 | Ga0105251_100393702 | 271 |
| 277 | 3300009036 | Ga0105244_10008269 | Ga0105244_100082692 | 271 |
| 278 | 3300009036 | Ga0105244_10013981 | Ga0105244_100139814 | 271 |
| 279 | 3300009036 | Ga0105244_10022306 | Ga0105244_100223062 | 271 |
| 280 | 3300009036 | Ga0105244_10026665 | Ga0105244_100266652 | 271 |
| 281 | 3300009036 | Ga0105244_10036096 | Ga0105244_100360962 | 271 |
| 282 | 3300009036 | Ga0105244_10172892 | Ga0105244_101728921 | 271 |
| 283 | 3300009092 | Ga0105250_10000074 | Ga0105250_100000747 | 271 |
| 284 | 3300009092 | Ga0105250_10004551 | Ga0105250_100045516 | 271 |
| 285 | 3300009092 | Ga0105250_10005278 | Ga0105250_100052782 | 271 |
| 286 | 3300009092 | Ga0105250_10043120 | Ga0105250_100431202 | 271 |
| 287 | 3300009092 | Ga0105250_10050418 | Ga0105250_100504182 | 271 |
| 288 | 3300009092 | Ga0105250_10072769 | Ga0105250_100727692 | 271 |
| 289 | 3300009092 | Ga0105250_10093544 | Ga0105250_100935442 | 271 |
| 290 | 3300009148 | Ga0105243_10012583 | Ga0105243_100125832 | 271 |
| 291 | 3300009148 | Ga0105243_10031266 | Ga0105243_100312664 | 271 |
| 292 | 3300009148 | Ga0105243_10036090 | Ga0105243_100360903 | 271 |
| 293 | 3300009148 | Ga0105243_10041987 | Ga0105243_100419873 | 271 |
| 294 | 3300009176 | Ga0105242_10000626 | Ga0105242_100006266 | 271 |
| 295 | 3300009177 | Ga0105248_10011709 | Ga0105248_100117092 | 271 |
| 296 | 3300009545 | Ga0105237_10001599 | Ga0105237_1000159912 | 271 |
| 297 | 3300009553 | Ga0105249_10601321 | Ga0105249_106013212 | 271 |
| 298 | 3300011119 | Ga0105246_10010995 | Ga0105246_100109953 | 271 |
| 299 | 3300011119 | Ga0105246_10110849 | Ga0105246_101108492 | 271 |
| 300 | 3300013100 | Ga0157373_10012012 | Ga0157373_100120122 | 271 |
| 301 | 3300013100 | Ga0157373_10012417 | Ga0157373_100124176 | 271 |
| 302 | 3300013100 | Ga0157373_10015562 | Ga0157373_100155622 | 271 |
| 303 | 3300013100 | Ga0157373_10017236 | Ga0157373_100172362 | 271 |
| 304 | 3300013100 | Ga0157373_10022847 | Ga0157373_100228474 | 271 |
| 305 | 3300013100 | Ga0157373_10055876 | Ga0157373_100558762 | 271 |
| 306 | 3300013102 | Ga0157371_10013522 | Ga0157371_100135225 | 271 |
| 307 | 3300013102 | Ga0157371_10124521 | Ga0157371_101245211 | 271 |
| 308 | 3300013102 | Ga0157371_10142386 | Ga0157371_101423861 | 271 |
| 309 | 3300013102 | Ga0157371_10283324 | Ga0157371_102833242 | 271 |
| 310 | 3300013104 | Ga0157370_10036318 | Ga0157370_100363185 | 271 |
| 311 | 3300013104 | Ga0157370_10115524 | Ga0157370_101155242 | 271 |
| 312 | 3300013104 | Ga0157370_10122730 | Ga0157370_101227302 | 271 |
| 313 | 3300013104 | Ga0157370_10151347 | Ga0157370_101513472 | 271 |
| 314 | 3300013104 | Ga0157370_10217875 | Ga0157370_102178752 | 271 |
| 315 | 3300013104 | Ga0157370_10259338 | Ga0157370_102593382 | 271 |
| 316 | 3300013104 | Ga0157370_10484147 | Ga0157370_104841471 | 271 |
| 317 | 3300013105 | Ga0157369_10027825 | Ga0157369_100278252 | 271 |
| 318 | 3300013105 | Ga0157369_10028899 | Ga0157369_100288992 | 271 |
| 319 | 3300013105 | Ga0157369_10029490 | Ga0157369_100294902 | 271 |
| 320 | 3300013105 | Ga0157369_10142074 | Ga0157369_101420742 | 271 |
| 321 | 3300013105 | Ga0157369_10220782 | Ga0157369_102207821 | 271 |
| 322 | 3300013105 | Ga0157369_10221488 | Ga0157369_102214882 | 271 |
| 323 | 3300013105 | Ga0157369_10497624 | Ga0157369_104976242 | 271 |
| 324 | 3300013306 | Ga0163162_10000495 | Ga0163162_1000049537 | 271 |
| 325 | 3300013306 | Ga0163162_10081968 | Ga0163162_100819683 | 271 |
| 326 | 3300013306 | Ga0163162_10278969 | Ga0163162_102789692 | 271 |
| 327 | 3300013307 | Ga0157372_10235741 | Ga0157372_102357412 | 271 |
| 328 | 3300013308 | Ga0157375_10021676 | Ga0157375_100216762 | 271 |
| 329 | 3300013308 | Ga0157375_10027977 | Ga0157375_100279772 | 271 |
| 330 | 3300013308 | Ga0157375_10171941 | Ga0157375_101719413 | 271 |
| 331 | 3300014497 | Ga0182008_10001674 | Ga0182008_1000167414 | 271 |
| 332 | 3300014497 | Ga0182008_10008849 | Ga0182008_100088492 | 271 |
| 333 | 3300014497 | Ga0182008_10009722 | Ga0182008_100097222 | 271 |
| 334 | 3300014497 | Ga0182008_10009866 | Ga0182008_100098665 | 271 |
| 335 | 3300014497 | Ga0182008_10010494 | Ga0182008_100104945 | 271 |
| 336 | 3300014497 | Ga0182008_10017589 | Ga0182008_100175892 | 271 |
| 337 | 3300014497 | Ga0182008_10018048 | Ga0182008_100180484 | 271 |
| 338 | 3300014497 | Ga0182008_10146610 | Ga0182008_101466102 | 271 |
| 339 | 3300015261 | Ga0182006_1004541 | Ga0182006_10045416 | 271 |
| 340 | 3300015261 | Ga0182006_1004981 | Ga0182006_10049816 | 271 |
| 341 | 3300015261 | Ga0182006_1011431 | Ga0182006_10114314 | 271 |
| 342 | 3300015261 | Ga0182006_1024345 | Ga0182006_10243453 | 271 |
| 343 | 3300015261 | Ga0182006_1035810 | Ga0182006_10358101 | 271 |
| 344 | 3300015261 | Ga0182006_1041324 | Ga0182006_10413242 | 271 |
| 345 | 3300015262 | Ga0182007_10004029 | Ga0182007_100040296 | 271 |
| 346 | 3300015262 | Ga0182007_10011611 | Ga0182007_100116112 | 271 |
| 347 | 3300015262 | Ga0182007_10104577 | Ga0182007_101045771 | 271 |
| 348 | 3300015265 | Ga0182005_1002599 | Ga0182005_10025992 | 271 |
| 349 | 3300015265 | Ga0182005_1002754 | Ga0182005_10027542 | 271 |
| 350 | 3300017792 | Ga0163161_10010440 | Ga0163161_100104406 | 271 |
| 351 | 3300017792 | Ga0163161_10011813 | Ga0163161_100118132 | 271 |
| 352 | 3300017792 | Ga0163161_10012997 | Ga0163161_100129972 | 271 |
| 353 | 3300017792 | Ga0163161_10087788 | Ga0163161_100877882 | 271 |
| 354 | 3300017792 | Ga0163161_10117937 | Ga0163161_101179371 | 271 |
| 355 | 3300017792 | Ga0163161_10271736 | Ga0163161_102717362 | 271 |
| 356 | 3300025206 | Ga0209435_100479 | Ga0209435_1004795 | 271 |
| 357 | 3300025207 | Ga0209760_100114 | Ga0209760_10011451 | 271 |
| 358 | 3300025207 | Ga0209760_100337 | Ga0209760_1003372 | 271 |
| 359 | 3300025224 | Ga0209784_100173 | Ga0209784_10017321 | 271 |
| 360 | 3300025225 | Ga0209566_100226 | Ga0209566_10022621 | 271 |
| 361 | 3300025226 | Ga0209674_100216 | Ga0209674_10021621 | 271 |
| 362 | 3300025229 | Ga0209147_100229 | Ga0209147_10022937 | 271 |
| 363 | 3300025230 | Ga0209563_100224 | Ga0209563_10022413 | 271 |
| 364 | 3300025230 | Ga0209563_100338 | Ga0209563_10033817 | 271 |
| 365 | 3300025231 | Ga0207427_100001 | Ga0207427_1000011041 | 271 |
| 366 | 3300025231 | Ga0207427_100008 | Ga0207427_100008423 | 271 |
| 367 | 3300025233 | Ga0209437_100003 | Ga0209437_100003331 | 271 |
| 368 | 3300025233 | Ga0209437_100014 | Ga0209437_100014288 | 271 |
| 369 | 3300025242 | Ga0209258_100386 | Ga0209258_10038637 | 271 |
| 370 | 3300025246 | Ga0209646_1000387 | Ga0209646_100038713 | 271 |
| 371 | 3300025253 | Ga0209677_100171 | Ga0209677_10017121 | 271 |
| 372 | 3300025256 | Ga0209759_1008946 | Ga0209759_10089462 | 271 |
| 373 | 3300025261 | Ga0209233_1000007 | Ga0209233_10000071041 | 271 |
| 374 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008288 | 271 |
| 375 | 3300025292 | Ga0209676_1000010 | Ga0209676_1000010248 | 271 |
| 376 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021355 | 271 |
| 377 | 3300025292 | Ga0209676_1000345 | Ga0209676_10003452 | 271 |
| 378 | 3300025298 | Ga0209050_1000081 | Ga0209050_10000812 | 271 |
| 379 | 3300025298 | Ga0209050_1000162 | Ga0209050_100016212 | 271 |
| 380 | 3300025298 | Ga0209050_1002674 | Ga0209050_10026742 | 271 |
| 381 | 3300025303 | Ga0209051_1000104 | Ga0209051_10001047 | 271 |
| 382 | 3300025303 | Ga0209051_1020234 | Ga0209051_10202342 | 271 |
| 383 | 3300025303 | Ga0209051_1023109 | Ga0209051_10231092 | 271 |
| 384 | 3300025304 | Ga0209257_1000040 | Ga0209257_1000040277 | 271 |
| 385 | 3300025321 | Ga0207656_10000013 | Ga0207656_1000001393 | 271 |
| 386 | 3300025711 | Ga0207696_1000045 | Ga0207696_1000045314 | 271 |
| 387 | 3300025711 | Ga0207696_1000097 | Ga0207696_100009719 | 271 |
| 388 | 3300025711 | Ga0207696_1002467 | Ga0207696_100246710 | 271 |
| 389 | 3300025711 | Ga0207696_1013261 | Ga0207696_10132612 | 271 |
| 390 | 3300025711 | Ga0207696_1014766 | Ga0207696_10147662 | 271 |
| 391 | 3300025711 | Ga0207696_1019573 | Ga0207696_10195732 | 271 |
| 392 | 3300025711 | Ga0207696_1021596 | Ga0207696_10215962 | 271 |
| 393 | 3300025711 | Ga0207696_1057697 | Ga0207696_10576972 | 271 |
| 394 | 3300025728 | Ga0207655_1000005 | Ga0207655_1000005844 | 271 |
| 395 | 3300025728 | Ga0207655_1000142 | Ga0207655_1000142106 | 271 |
| 396 | 3300025728 | Ga0207655_1008691 | Ga0207655_10086912 | 271 |
| 397 | 3300025728 | Ga0207655_1011990 | Ga0207655_10119902 | 271 |
| 398 | 3300025728 | Ga0207655_1016994 | Ga0207655_10169943 | 271 |
| 399 | 3300025728 | Ga0207655_1017006 | Ga0207655_10170065 | 271 |
| 400 | 3300025728 | Ga0207655_1017633 | Ga0207655_10176333 | 271 |
| 401 | 3300025728 | Ga0207655_1028445 | Ga0207655_10284452 | 271 |
| 402 | 3300025728 | Ga0207655_1034139 | Ga0207655_10341392 | 271 |
| 403 | 3300025728 | Ga0207655_1034770 | Ga0207655_10347702 | 271 |
| 404 | 3300025728 | Ga0207655_1040731 | Ga0207655_10407312 | 271 |
| 405 | 3300025735 | Ga0207713_1000030 | Ga0207713_1000030301 | 271 |
| 406 | 3300025735 | Ga0207713_1001006 | Ga0207713_10010062 | 271 |
| 407 | 3300025735 | Ga0207713_1002600 | Ga0207713_100260014 | 271 |
| 408 | 3300025735 | Ga0207713_1010546 | Ga0207713_10105465 | 271 |
| 409 | 3300025735 | Ga0207713_1022987 | Ga0207713_10229872 | 271 |
| 410 | 3300025735 | Ga0207713_1058047 | Ga0207713_10580471 | 271 |
| 411 | 3300025735 | Ga0207713_1058061 | Ga0207713_10580611 | 271 |
| 412 | 3300025735 | Ga0207713_1060121 | Ga0207713_10601212 | 271 |
| 413 | 3300025735 | Ga0207713_1063136 | Ga0207713_10631362 | 271 |
| 414 | 3300025914 | Ga0207671_10000165 | Ga0207671_1000016523 | 271 |
| 415 | 3300025920 | Ga0207649_10000013 | Ga0207649_10000013165 | 271 |
| 416 | 3300025923 | Ga0207681_10001353 | Ga0207681_1000135312 | 271 |
| 417 | 3300025925 | Ga0207650_10000077 | Ga0207650_100000773 | 271 |
| 418 | 3300025925 | Ga0207650_10000457 | Ga0207650_100004573 | 271 |
| 419 | 3300025933 | Ga0207706_10002991 | Ga0207706_100029917 | 271 |
| 420 | 3300025933 | Ga0207706_10013867 | Ga0207706_100138673 | 271 |
| 421 | 3300025934 | Ga0207686_10019202 | Ga0207686_100192022 | 271 |
| 422 | 3300025935 | Ga0207709_10000035 | Ga0207709_10000035242 | 271 |
| 423 | 3300025935 | Ga0207709_10005497 | Ga0207709_100054973 | 271 |
| 424 | 3300025935 | Ga0207709_10031319 | Ga0207709_100313192 | 271 |
| 425 | 3300025941 | Ga0207711_10192460 | Ga0207711_101924602 | 271 |
| 426 | 3300025945 | Ga0207679_10000005 | Ga0207679_10000005419 | 271 |
| 427 | 3300026041 | Ga0207639_10002794 | Ga0207639_100027946 | 271 |
| 428 | 3300027111 | Ga0209281_1000077 | Ga0209281_1000077229 | 271 |
| 429 | 3300027111 | Ga0209281_1002389 | Ga0209281_10023897 | 271 |
| 430 | 3300027907 | Ga0207428_10036878 | Ga0207428_100368785 | 271 |
| 431 | 3300027907 | Ga0207428_10085243 | Ga0207428_100852433 | 271 |
| 432 | 3300027907 | Ga0207428_10087582 | Ga0207428_100875822 | 271 |
| 433 | 3300027907 | Ga0207428_10104020 | Ga0207428_101040202 | 271 |
| 434 | 3300027907 | Ga0207428_10211549 | Ga0207428_102115492 | 271 |
| 435 | 3300030731 | Ga0316177_1078523 | Ga0316177_10785232 | 271 |
| 436 | 3300030735 | Ga0316178_1072945 | Ga0316178_10729451 | 271 |
| 437 | 3300031911 | Ga0307412_10011186 | Ga0307412_100111862 | 271 |
| 438 | 3300031911 | Ga0307412_10058519 | Ga0307412_100585192 | 271 |
| 439 | 3300031995 | Ga0307409_100121203 | Ga0307409_1001212032 | 271 |
| 440 | 3300033180 | Ga0307510_10030497 | Ga0307510_100304977 | 271 |
| 441 | 3300041405 | Ga0439438_003655 | Ga0439438_003655_4443_5258 | 271 |
| 442 | 3300041405 | Ga0439438_003712 | Ga0439438_003712_763_1578 | 271 |
| 443 | 3300041405 | Ga0439438_004492 | Ga0439438_004492_2867_3682 | 271 |
| 444 | 3300041405 | Ga0439438_004546 | Ga0439438_004546_243_1058 | 271 |
| 445 | 3300041405 | Ga0439438_004833 | Ga0439438_004833_495_1310 | 271 |
| 446 | 3300041405 | Ga0439438_009790 | Ga0439438_009790_1250_2065 | 271 |
| 447 | 3300041405 | Ga0439438_039860 | Ga0439438_039860_372_1187 | 271 |
| 448 | 3300041407 | Ga0439447_002684 | Ga0439447_002684_4434_5249 | 271 |
| 449 | 3300041407 | Ga0439447_003481 | Ga0439447_003481_677_1492 | 271 |
| 450 | 3300041407 | Ga0439447_003500 | Ga0439447_003500_216_1031 | 271 |
| 451 | 3300041407 | Ga0439447_004420 | Ga0439447_004420_3877_4692 | 271 |
| 452 | 3300041407 | Ga0439447_012937 | Ga0439447_012937_156_971 | 271 |
| 453 | 3300041407 | Ga0439447_024393 | Ga0439447_024393_226_1041 | 271 |
| 454 | 3300041411 | Ga0439466_0002247 | Ga0439466_0002247_312_1127 | 271 |
| 455 | 3300041411 | Ga0439466_0003822 | Ga0439466_0003822_3323_4138 | 271 |
| 456 | 3300041411 | Ga0439466_0004509 | Ga0439466_0004509_850_1665 | 271 |
| 457 | 3300041411 | Ga0439466_0014661 | Ga0439466_0014661_1658_2473 | 271 |
| 458 | 3300041411 | Ga0439466_0050707 | Ga0439466_0050707_285_1100 | 271 |
| 459 | 3300041413 | Ga0439465_0003421 | Ga0439465_0003421_115_930 | 271 |
| 460 | 3300041486 | Ga0451807_2733865 | Ga0451807_2733865_362_1177 | 271 |
| 461 | 3300041997 | Ga0439431_0004399 | Ga0439431_0004399_1097_1912 | 271 |
| 462 | 3300042004 | Ga0439445_0011758 | Ga0439445_0011758_137_952 | 271 |
| 463 | 3300042006 | Ga0439432_003190 | Ga0439432_003190_4137_4952 | 271 |
| 464 | 3300042006 | Ga0439432_009415 | Ga0439432_009415_1654_2469 | 271 |
| 465 | 3300042006 | Ga0439432_016417 | Ga0439432_016417_236_1051 | 271 |
| 466 | 3300042006 | Ga0439432_020478 | Ga0439432_020478_1068_1883 | 271 |
| 467 | 3300042009 | Ga0439451_002492 | Ga0439451_002492_921_1736 | 271 |
| 468 | 3300042010 | Ga0439452_002545 | Ga0439452_002545_4506_5321 | 271 |
| 469 | 3300042010 | Ga0439452_003098 | Ga0439452_003098_533_1348 | 271 |
| 470 | 3300042010 | Ga0439452_004023 | Ga0439452_004023_150_965 | 271 |
| 471 | 3300042010 | Ga0439452_005077 | Ga0439452_005077_909_1724 | 271 |
| 472 | 3300042013 | Ga0439456_011613 | Ga0439456_011613_182_997 | 271 |
| 473 | 3300042013 | Ga0439456_039622 | Ga0439456_039622_160_975 | 271 |
| 474 | 3300042013 | Ga0439456_040073 | Ga0439456_040073_68_883 | 271 |
| 475 | 3300042013 | Ga0439456_046051 | Ga0439456_046051_55_870 | 271 |
| 476 | 3300042016 | Ga0439463_001951 | Ga0439463_001951_3444_4259 | 271 |
| 477 | 3300042016 | Ga0439463_021196 | Ga0439463_021196_239_1054 | 271 |
| 478 | 3300042115 | Ga0450911_002967 | Ga0450911_002967_2220_3035 | 271 |
| 479 | 3300042115 | Ga0450911_003734 | Ga0450911_003734_741_1556 | 271 |
| 480 | 3300042115 | Ga0450911_006215 | Ga0450911_006215_734_1549 | 271 |
| 481 | 3300042115 | Ga0450911_011144 | Ga0450911_011144_261_1076 | 271 |
| 482 | 3300042121 | Ga0450919_010851 | Ga0450919_010851_138_953 | 271 |
| 483 | 3300042122 | Ga0450920_005991 | Ga0450920_005991_276_1091 | 271 |
| 484 | 3300042124 | Ga0450922_001519 | Ga0450922_001519_1275_2090 | 271 |
| 485 | 3300042127 | Ga0450890_000530 | Ga0450890_000530_315_1130 | 271 |
| 486 | 3300042137 | Ga0450902_000722 | Ga0450902_000722_459_1280 | 271 |
| 487 | 3300042137 | Ga0450902_001237 | Ga0450902_001237_197_1012 | 271 |
| 488 | 3300042137 | Ga0450902_026099 | Ga0450902_026099_55_870 | 271 |
| 489 | 3300042138 | Ga0450903_004755 | Ga0450903_004755_99_914 | 271 |
| 490 | 3300042142 | Ga0450905_012500 | Ga0450905_012500_282_1097 | 271 |
| 491 | 3300042145 | Ga0450906_002265 | Ga0450906_002265_3160_3975 | 271 |
| 492 | 3300042146 | Ga0450907_001033 | Ga0450907_001033_4572_5387 | 271 |
| 493 | 3300042146 | Ga0450907_007198 | Ga0450907_007198_484_1299 | 271 |
| 494 | 3300042156 | Ga0439446_0007648 | Ga0439446_0007648_1171_1986 | 271 |
| 495 | 3300042184 | Ga0450908_003567 | Ga0450908_003567_428_1243 | 271 |
| 496 | 3300042184 | Ga0450908_004856 | Ga0450908_004856_926_1741 | 271 |
| 497 | 3300042185 | Ga0450909_000392 | Ga0450909_000392_282_1097 | 271 |
| 498 | 3300042185 | Ga0450909_018263 | Ga0450909_018263_155_970 | 271 |
| 499 | 3300042435 | Ga0439434_0001710 | Ga0439434_0001710_4542_5357 | 271 |
| 500 | 3300042435 | Ga0439434_0027940 | Ga0439434_0027940_226_1041 | 271 |
| 501 | 3300042461 | Ga0439460_0002977 | Ga0439460_0002977_1031_1846 | 271 |
| 502 | 3300042461 | Ga0439460_0035001 | Ga0439460_0035001_483_1298 | 271 |
| 503 | 3300042531 | Ga0450918_018789 | Ga0450918_018789_177_992 | 271 |
| 504 | 3300042533 | Ga0450901_000122 | Ga0450901_000122_6911_7732 | 271 |
| 505 | 3300042993 | Ga0439440_0006677 | Ga0439440_0006677_267_1082 | 271 |
| 506 | 3300046452 | Ga0495617_000225 | Ga0495617_000225_1126_1941 | 271 |
| 507 | 3300046452 | Ga0495617_003852 | Ga0495617_003852_4689_5504 | 271 |
| 508 | 3300046452 | Ga0495617_004477 | Ga0495617_004477_166_981 | 271 |
| 509 | 3300046452 | Ga0495617_039187 | Ga0495617_039187_30_845 | 271 |
| 510 | 3300046452 | Ga0495617_057299 | Ga0495617_057299_347_1162 | 271 |
| 511 | 3300046453 | Ga0495627_000257 | Ga0495627_000257_4813_5631 | 271 |
| 512 | 3300046453 | Ga0495627_000451 | Ga0495627_000451_1091_1906 | 271 |
| 513 | 3300046453 | Ga0495627_009457 | Ga0495627_009457_449_1264 | 271 |
| 514 | 3300046453 | Ga0495627_067071 | Ga0495627_067071_108_929 | 271 |
| 515 | 3300046454 | Ga0495592_0288559 | Ga0495592_0288559_236_1051 | 271 |
| 516 | 3300046455 | Ga0495603_0002381 | Ga0495603_0002381_1424_2239 | 271 |
| 517 | 3300046455 | Ga0495603_0021821 | Ga0495603_0021821_41_856 | 271 |
| 518 | 3300046455 | Ga0495603_0037916 | Ga0495603_0037916_895_1710 | 271 |
| 519 | 3300046455 | Ga0495603_0185250 | Ga0495603_0185250_87_902 | 271 |
| 520 | 3300046457 | Ga0495590_0004245 | Ga0495590_0004245_860_1675 | 271 |
| 521 | 3300046457 | Ga0495590_0004738 | Ga0495590_0004738_3945_4760 | 271 |
| 522 | 3300046457 | Ga0495590_0020240 | Ga0495590_0020240_418_1233 | 271 |
| 523 | 3300046457 | Ga0495590_0021327 | Ga0495590_0021327_352_1167 | 271 |
| 524 | 3300046457 | Ga0495590_0110041 | Ga0495590_0110041_67_882 | 271 |
| 525 | 3300046458 | Ga0495591_004826 | Ga0495591_004826_1396_2211 | 271 |
| 526 | 3300046458 | Ga0495591_005086 | Ga0495591_005086_4259_5074 | 271 |
| 527 | 3300046458 | Ga0495591_006137 | Ga0495591_006137_15_830 | 271 |
| 528 | 3300046458 | Ga0495591_006343 | Ga0495591_006343_4162_4977 | 271 |
| 529 | 3300046458 | Ga0495591_007626 | Ga0495591_007626_122_937 | 271 |
| 530 | 3300046458 | Ga0495591_011702 | Ga0495591_011702_1261_2076 | 271 |
| 531 | 3300046458 | Ga0495591_017012 | Ga0495591_017012_171_986 | 271 |
| 532 | 3300046458 | Ga0495591_024620 | Ga0495591_024620_954_1769 | 271 |
| 533 | 3300046458 | Ga0495591_048272 | Ga0495591_048272_158_973 | 271 |
| 534 | 3300046459 | Ga0495629_0209464 | Ga0495629_0209464_179_994 | 271 |
| 535 | 3300046460 | Ga0495638_0018185 | Ga0495638_0018185_489_1304 | 271 |
| 536 | 3300046460 | Ga0495638_0022371 | Ga0495638_0022371_26_841 | 271 |
| 537 | 3300046460 | Ga0495638_0035890 | Ga0495638_0035890_88_903 | 271 |
| 538 | 3300046460 | Ga0495638_0063604 | Ga0495638_0063604_849_1664 | 271 |
| 539 | 3300046460 | Ga0495638_0072792 | Ga0495638_0072792_499_1314 | 271 |
| 540 | 3300046460 | Ga0495638_0082030 | Ga0495638_0082030_35_850 | 271 |
| 541 | 3300046460 | Ga0495638_0085338 | Ga0495638_0085338_59_874 | 271 |
| 542 | 3300046460 | Ga0495638_0096764 | Ga0495638_0096764_249_1064 | 271 |
| 543 | 3300046460 | Ga0495638_0164514 | Ga0495638_0164514_67_882 | 271 |
| 544 | 3300046460 | Ga0495638_0222359 | Ga0495638_0222359_207_1022 | 271 |
| 545 | 3300046460 | Ga0495638_0272469 | Ga0495638_0272469_51_866 | 271 |
| 546 | 3300046463 | Ga0495653_0014639 | Ga0495653_0014639_851_1666 | 271 |
| 547 | 3300046463 | Ga0495653_0014669 | Ga0495653_0014669_1127_1942 | 271 |
| 548 | 3300046463 | Ga0495653_0052181 | Ga0495653_0052181_972_1787 | 271 |
| 549 | 3300046463 | Ga0495653_0061222 | Ga0495653_0061222_569_1384 | 271 |
| 550 | 3300046463 | Ga0495653_0108430 | Ga0495653_0108430_39_854 | 271 |
| 551 | 3300046463 | Ga0495653_0145074 | Ga0495653_0145074_593_1408 | 271 |
| 552 | 3300046471 | Ga0495650_0000853 | Ga0495650_0000853_35369_36184 | 271 |
| 553 | 3300046471 | Ga0495650_0008618 | Ga0495650_0008618_916_1731 | 271 |
| 554 | 3300046471 | Ga0495650_0009821 | Ga0495650_0009821_4321_5136 | 271 |
| 555 | 3300046471 | Ga0495650_0023447 | Ga0495650_0023447_1394_2209 | 271 |
| 556 | 3300046471 | Ga0495650_0023701 | Ga0495650_0023701_117_932 | 271 |
| 557 | 3300046471 | Ga0495650_0104783 | Ga0495650_0104783_223_1038 | 271 |
| 558 | 3300046473 | Ga0495582_0020275 | Ga0495582_0020275_322_1137 | 271 |
| 559 | 3300046474 | Ga0495605_0000903 | Ga0495605_0000903_18453_19271 | 271 |
| 560 | 3300046474 | Ga0495605_0001530 | Ga0495605_0001530_9764_10579 | 271 |
| 561 | 3300046474 | Ga0495605_0010787 | Ga0495605_0010787_491_1306 | 271 |
| 562 | 3300046474 | Ga0495605_0010841 | Ga0495605_0010841_4109_4924 | 271 |
| 563 | 3300046474 | Ga0495605_0012571 | Ga0495605_0012571_1152_1967 | 271 |
| 564 | 3300046474 | Ga0495605_0025150 | Ga0495605_0025150_2129_2944 | 271 |
| 565 | 3300046474 | Ga0495605_0029903 | Ga0495605_0029903_682_1497 | 271 |
| 566 | 3300046474 | Ga0495605_0075634 | Ga0495605_0075634_90_905 | 271 |
| 567 | 3300046475 | Ga0495639_0000158 | Ga0495639_0000158_1482_2297 | 271 |
| 568 | 3300046475 | Ga0495639_0006561 | Ga0495639_0006561_4020_4835 | 271 |
| 569 | 3300046475 | Ga0495639_0062583 | Ga0495639_0062583_863_1678 | 271 |
| 570 | 3300046475 | Ga0495639_0203296 | Ga0495639_0203296_90_905 | 271 |
| 571 | 3300046491 | Ga0495584_0006126 | Ga0495584_0006126_1027_1842 | 271 |
| 572 | 3300046491 | Ga0495584_0007034 | Ga0495584_0007034_4442_5257 | 271 |
| 573 | 3300046491 | Ga0495584_0007144 | Ga0495584_0007144_826_1641 | 271 |
| 574 | 3300046491 | Ga0495584_0008147 | Ga0495584_0008147_4459_5274 | 271 |
| 575 | 3300046491 | Ga0495584_0027676 | Ga0495584_0027676_1114_1929 | 271 |
| 576 | 3300046491 | Ga0495584_0028398 | Ga0495584_0028398_728_1543 | 271 |
| 577 | 3300046491 | Ga0495584_0039964 | Ga0495584_0039964_1027_1842 | 271 |
| 578 | 3300046491 | Ga0495584_0100022 | Ga0495584_0100022_452_1267 | 271 |
| 579 | 3300046492 | Ga0495585_0008120 | Ga0495585_0008120_4433_5251 | 271 |
| 580 | 3300046492 | Ga0495585_0009359 | Ga0495585_0009359_589_1404 | 271 |
| 581 | 3300046492 | Ga0495585_0010239 | Ga0495585_0010239_4048_4863 | 271 |
| 582 | 3300046492 | Ga0495585_0014589 | Ga0495585_0014589_2626_3441 | 271 |
| 583 | 3300046492 | Ga0495585_0014716 | Ga0495585_0014716_2626_3441 | 271 |
| 584 | 3300046492 | Ga0495585_0022053 | Ga0495585_0022053_2807_3622 | 271 |
| 585 | 3300046492 | Ga0495585_0203333 | Ga0495585_0203333_68_883 | 271 |
| 586 | 3300046492 | Ga0495585_0223347 | Ga0495585_0223347_68_883 | 271 |
| 587 | 3300046499 | Ga0495594_0010942 | Ga0495594_0010942_122_937 | 271 |
| 588 | 3300046499 | Ga0495594_0011583 | Ga0495594_0011583_3295_4110 | 271 |
| 589 | 3300046499 | Ga0495594_0017129 | Ga0495594_0017129_2728_3543 | 271 |
| 590 | 3300046499 | Ga0495594_0056928 | Ga0495594_0056928_1086_1901 | 271 |
| 591 | 3300046500 | Ga0495596_0004892 | Ga0495596_0004892_4219_5034 | 271 |
| 592 | 3300046500 | Ga0495596_0045684 | Ga0495596_0045684_362_1177 | 271 |
| 593 | 3300046501 | Ga0495607_0000869 | Ga0495607_0000869_4671_5489 | 271 |
| 594 | 3300046501 | Ga0495607_0006360 | Ga0495607_0006360_7345_8160 | 271 |
| 595 | 3300046501 | Ga0495607_0007341 | Ga0495607_0007341_1692_2510 | 271 |
| 596 | 3300046501 | Ga0495607_0009030 | Ga0495607_0009030_1485_2300 | 271 |
| 597 | 3300046501 | Ga0495607_0014781 | Ga0495607_0014781_243_1058 | 271 |
| 598 | 3300046501 | Ga0495607_0025554 | Ga0495607_0025554_60_875 | 271 |
| 599 | 3300046501 | Ga0495607_0031783 | Ga0495607_0031783_1582_2397 | 271 |
| 600 | 3300046501 | Ga0495607_0033106 | Ga0495607_0033106_158_973 | 271 |
| 601 | 3300046501 | Ga0495607_0033463 | Ga0495607_0033463_2247_3062 | 271 |
| 602 | 3300046501 | Ga0495607_0037857 | Ga0495607_0037857_1968_2783 | 271 |
| 603 | 3300046501 | Ga0495607_0069096 | Ga0495607_0069096_194_1009 | 271 |
| 604 | 3300046501 | Ga0495607_0145855 | Ga0495607_0145855_352_1167 | 271 |
| 605 | 3300046501 | Ga0495607_0149734 | Ga0495607_0149734_370_1185 | 271 |
| 606 | 3300046501 | Ga0495607_0189997 | Ga0495607_0189997_194_1009 | 271 |
| 607 | 3300046506 | Ga0495583_0000521 | Ga0495583_0000521_49075_49890 | 271 |
| 608 | 3300046506 | Ga0495583_0008207 | Ga0495583_0008207_4463_5278 | 271 |
| 609 | 3300046506 | Ga0495583_0009383 | Ga0495583_0009383_907_1722 | 271 |
| 610 | 3300046506 | Ga0495583_0017192 | Ga0495583_0017192_769_1584 | 271 |
| 611 | 3300046506 | Ga0495583_0018242 | Ga0495583_0018242_1031_1846 | 271 |
| 612 | 3300046506 | Ga0495583_0052920 | Ga0495583_0052920_949_1764 | 271 |
| 613 | 3300046506 | Ga0495583_0090412 | Ga0495583_0090412_34_852 | 271 |
| 614 | 3300046507 | Ga0495606_0008218 | Ga0495606_0008218_4689_5504 | 271 |
| 615 | 3300046507 | Ga0495606_0014967 | Ga0495606_0014967_1127_1942 | 271 |
| 616 | 3300046507 | Ga0495606_0015945 | Ga0495606_0015945_1336_2151 | 271 |
| 617 | 3300046507 | Ga0495606_0017185 | Ga0495606_0017185_4447_5262 | 271 |
| 618 | 3300046507 | Ga0495606_0020027 | Ga0495606_0020027_1111_1926 | 271 |
| 619 | 3300046507 | Ga0495606_0021665 | Ga0495606_0021665_1023_1838 | 271 |
| 620 | 3300046507 | Ga0495606_0021913 | Ga0495606_0021913_863_1678 | 271 |
| 621 | 3300046512 | Ga0495610_0009088 | Ga0495610_0009088_1046_1861 | 271 |
| 622 | 3300046512 | Ga0495610_0009663 | Ga0495610_0009663_4285_5100 | 271 |
| 623 | 3300046512 | Ga0495610_0010838 | Ga0495610_0010838_360_1175 | 271 |
| 624 | 3300046512 | Ga0495610_0010961 | Ga0495610_0010961_886_1701 | 271 |
| 625 | 3300046512 | Ga0495610_0011192 | Ga0495610_0011192_4123_4938 | 271 |
| 626 | 3300046512 | Ga0495610_0016561 | Ga0495610_0016561_2331_3146 | 271 |
| 627 | 3300046512 | Ga0495610_0017103 | Ga0495610_0017103_1925_2740 | 271 |
| 628 | 3300046512 | Ga0495610_0021570 | Ga0495610_0021570_1333_2148 | 271 |
| 629 | 3300046513 | Ga0495616_0006907 | Ga0495616_0006907_5761_6576 | 271 |
| 630 | 3300046513 | Ga0495616_0007521 | Ga0495616_0007521_1110_1925 | 271 |
| 631 | 3300046513 | Ga0495616_0031688 | Ga0495616_0031688_1235_2050 | 271 |
| 632 | 3300046513 | Ga0495616_0036809 | Ga0495616_0036809_1100_1915 | 271 |
| 633 | 3300046513 | Ga0495616_0040658 | Ga0495616_0040658_312_1127 | 271 |
| 634 | 3300046513 | Ga0495616_0040746 | Ga0495616_0040746_754_1569 | 271 |
| 635 | 3300046513 | Ga0495616_0074250 | Ga0495616_0074250_397_1212 | 271 |
| 636 | 3300046513 | Ga0495616_0107565 | Ga0495616_0107565_458_1273 | 271 |
| 637 | 3300046513 | Ga0495616_0162218 | Ga0495616_0162218_165_980 | 271 |
| 638 | 3300046515 | Ga0495620_0002844 | Ga0495620_0002844_4435_5250 | 271 |
| 639 | 3300046515 | Ga0495620_0007056 | Ga0495620_0007056_5171_5986 | 271 |
| 640 | 3300046515 | Ga0495620_0010613 | Ga0495620_0010613_932_1747 | 271 |
| 641 | 3300046515 | Ga0495620_0017763 | Ga0495620_0017763_222_1037 | 271 |
| 642 | 3300046515 | Ga0495620_0020290 | Ga0495620_0020290_1812_2627 | 271 |
| 643 | 3300046515 | Ga0495620_0061060 | Ga0495620_0061060_555_1370 | 271 |
| 644 | 3300046516 | Ga0495628_0181046 | Ga0495628_0181046_78_893 | 271 |
| 645 | 3300046517 | Ga0495630_0016649 | Ga0495630_0016649_451_1266 | 271 |
| 646 | 3300046517 | Ga0495630_0018980 | Ga0495630_0018980_31_846 | 271 |
| 647 | 3300046517 | Ga0495630_0229999 | Ga0495630_0229999_156_971 | 271 |
| 648 | 3300046518 | Ga0495631_0000478 | Ga0495631_0000478_1388_2203 | 271 |
| 649 | 3300046518 | Ga0495631_0013312 | Ga0495631_0013312_125_940 | 271 |
| 650 | 3300046518 | Ga0495631_0015929 | Ga0495631_0015929_1856_2671 | 271 |
| 651 | 3300046518 | Ga0495631_0036200 | Ga0495631_0036200_1356_2171 | 271 |
| 652 | 3300046518 | Ga0495631_0064148 | Ga0495631_0064148_73_888 | 271 |
| 653 | 3300046518 | Ga0495631_0096372 | Ga0495631_0096372_50_865 | 271 |
| 654 | 3300046518 | Ga0495631_0137474 | Ga0495631_0137474_204_1019 | 271 |
| 655 | 3300046519 | Ga0495632_0008307 | Ga0495632_0008307_4463_5278 | 271 |
| 656 | 3300046519 | Ga0495632_0008784 | Ga0495632_0008784_4252_5067 | 271 |
| 657 | 3300046519 | Ga0495632_0009540 | Ga0495632_0009540_4460_5275 | 271 |
| 658 | 3300046519 | Ga0495632_0012646 | Ga0495632_0012646_83_898 | 271 |
| 659 | 3300046519 | Ga0495632_0021411 | Ga0495632_0021411_1554_2369 | 271 |
| 660 | 3300046519 | Ga0495632_0046790 | Ga0495632_0046790_83_898 | 271 |
| 661 | 3300046519 | Ga0495632_0065324 | Ga0495632_0065324_59_874 | 271 |
| 662 | 3300046519 | Ga0495632_0152365 | Ga0495632_0152365_106_921 | 271 |
| 663 | 3300046520 | Ga0495637_0005988 | Ga0495637_0005988_4299_5114 | 271 |
| 664 | 3300046520 | Ga0495637_0006397 | Ga0495637_0006397_4456_5271 | 271 |
| 665 | 3300046520 | Ga0495637_0008319 | Ga0495637_0008319_1135_1950 | 271 |
| 666 | 3300046520 | Ga0495637_0013389 | Ga0495637_0013389_1472_2287 | 271 |
| 667 | 3300046520 | Ga0495637_0016295 | Ga0495637_0016295_2037_2852 | 271 |
| 668 | 3300046520 | Ga0495637_0019368 | Ga0495637_0019368_1286_2101 | 271 |
| 669 | 3300046520 | Ga0495637_0024487 | Ga0495637_0024487_1512_2327 | 271 |
| 670 | 3300046520 | Ga0495637_0028419 | Ga0495637_0028419_1547_2362 | 271 |
| 671 | 3300046520 | Ga0495637_0028490 | Ga0495637_0028490_1090_1905 | 271 |
| 672 | 3300046520 | Ga0495637_0056372 | Ga0495637_0056372_753_1568 | 271 |
| 673 | 3300046522 | Ga0495643_0004605 | Ga0495643_0004605_4057_4872 | 271 |
| 674 | 3300046522 | Ga0495643_0009458 | Ga0495643_0009458_659_1474 | 271 |
| 675 | 3300046522 | Ga0495643_0030091 | Ga0495643_0030091_318_1133 | 271 |
| 676 | 3300046522 | Ga0495643_0035228 | Ga0495643_0035228_141_956 | 271 |
| 677 | 3300046522 | Ga0495643_0060090 | Ga0495643_0060090_1127_1942 | 271 |
| 678 | 3300046522 | Ga0495643_0074811 | Ga0495643_0074811_916_1731 | 271 |
| 679 | 3300046522 | Ga0495643_0093988 | Ga0495643_0093988_171_986 | 271 |
| 680 | 3300046522 | Ga0495643_0168391 | Ga0495643_0168391_72_887 | 271 |
| 681 | 3300046523 | Ga0495644_0003999 | Ga0495644_0003999_4196_5011 | 271 |
| 682 | 3300046523 | Ga0495644_0017355 | Ga0495644_0017355_148_963 | 271 |
| 683 | 3300046523 | Ga0495644_0025760 | Ga0495644_0025760_1368_2183 | 271 |
| 684 | 3300046523 | Ga0495644_0036872 | Ga0495644_0036872_720_1535 | 271 |
| 685 | 3300046523 | Ga0495644_0107092 | Ga0495644_0107092_158_973 | 271 |
| 686 | 3300046524 | Ga0495648_0003220 | Ga0495648_0003220_1128_1943 | 271 |
| 687 | 3300046524 | Ga0495648_0011986 | Ga0495648_0011986_4568_5383 | 271 |
| 688 | 3300046524 | Ga0495648_0012916 | Ga0495648_0012916_1399_2214 | 271 |
| 689 | 3300046524 | Ga0495648_0013468 | Ga0495648_0013468_4727_5542 | 271 |
| 690 | 3300046524 | Ga0495648_0016867 | Ga0495648_0016867_445_1260 | 271 |
| 691 | 3300046524 | Ga0495648_0017468 | Ga0495648_0017468_4242_5057 | 271 |
| 692 | 3300046524 | Ga0495648_0025421 | Ga0495648_0025421_661_1476 | 271 |
| 693 | 3300046524 | Ga0495648_0053097 | Ga0495648_0053097_635_1450 | 271 |
| 694 | 3300046524 | Ga0495648_0053759 | Ga0495648_0053759_152_967 | 271 |
| 695 | 3300046524 | Ga0495648_0057512 | Ga0495648_0057512_1089_1904 | 271 |
| 696 | 3300046524 | Ga0495648_0169917 | Ga0495648_0169917_27_842 | 271 |
| 697 | 3300046526 | Ga0495666_0020490 | Ga0495666_0020490_333_1148 | 271 |
| 698 | 3300046526 | Ga0495666_0185577 | Ga0495666_0185577_118_933 | 271 |
| 699 | 3300046528 | Ga0495642_0003041 | Ga0495642_0003041_4479_5294 | 271 |
| 700 | 3300046528 | Ga0495642_0003357 | Ga0495642_0003357_4123_4938 | 271 |
| 701 | 3300046528 | Ga0495642_0004114 | Ga0495642_0004114_449_1264 | 271 |
| 702 | 3300046530 | Ga0495654_0000875 | Ga0495654_0000875_17021_17836 | 271 |
| 703 | 3300046530 | Ga0495654_0006669 | Ga0495654_0006669_4259_5074 | 271 |
| 704 | 3300046530 | Ga0495654_0006958 | Ga0495654_0006958_1131_1946 | 271 |
| 705 | 3300046530 | Ga0495654_0007930 | Ga0495654_0007930_1324_2139 | 271 |
| 706 | 3300046530 | Ga0495654_0007957 | Ga0495654_0007957_4165_4980 | 271 |
| 707 | 3300046530 | Ga0495654_0017519 | Ga0495654_0017519_656_1471 | 271 |
| 708 | 3300046530 | Ga0495654_0025971 | Ga0495654_0025971_571_1386 | 271 |
| 709 | 3300046530 | Ga0495654_0026914 | Ga0495654_0026914_81_896 | 271 |
| 710 | 3300046530 | Ga0495654_0042315 | Ga0495654_0042315_36_854 | 271 |
| 711 | 3300046530 | Ga0495654_0056846 | Ga0495654_0056846_107_922 | 271 |
| 712 | 3300046530 | Ga0495654_0138496 | Ga0495654_0138496_17_832 | 271 |
| 713 | 3300046530 | Ga0495654_0174293 | Ga0495654_0174293_89_904 | 271 |
| 714 | 3300046535 | Ga0495586_0087407 | Ga0495586_0087407_784_1599 | 271 |
| 715 | 3300046538 | Ga0495609_0000349 | Ga0495609_0000349_4784_5599 | 271 |
| 716 | 3300046538 | Ga0495609_0005802 | Ga0495609_0005802_1135_1950 | 271 |
| 717 | 3300046538 | Ga0495609_0021143 | Ga0495609_0021143_343_1158 | 271 |
| 718 | 3300046538 | Ga0495609_0071736 | Ga0495609_0071736_679_1494 | 271 |
| 719 | 3300046538 | Ga0495609_0154400 | Ga0495609_0154400_92_907 | 271 |
| 720 | 3300046542 | Ga0495597_0000221 | Ga0495597_0000221_4851_5669 | 271 |
| 721 | 3300046542 | Ga0495597_0007884 | Ga0495597_0007884_4151_4966 | 271 |
| 722 | 3300046542 | Ga0495597_0030946 | Ga0495597_0030946_1000_1815 | 271 |
| 723 | 3300046542 | Ga0495597_0034302 | Ga0495597_0034302_1465_2280 | 271 |
| 724 | 3300046542 | Ga0495597_0054950 | Ga0495597_0054950_136_951 | 271 |
| 725 | 3300046542 | Ga0495597_0067832 | Ga0495597_0067832_81_896 | 271 |
| 726 | 3300046542 | Ga0495597_0117828 | Ga0495597_0117828_168_983 | 271 |
| 727 | 3300046543 | Ga0495645_0159026 | Ga0495645_0159026_30_845 | 271 |
| 728 | 3300046557 | Ga0495622_0004041 | Ga0495622_0004041_4925_5740 | 271 |
| 729 | 3300046557 | Ga0495622_0004608 | Ga0495622_0004608_4441_5256 | 271 |
| 730 | 3300046557 | Ga0495622_0014806 | Ga0495622_0014806_777_1592 | 271 |
| 731 | 3300046557 | Ga0495622_0027627 | Ga0495622_0027627_661_1476 | 271 |
| 732 | 3300046557 | Ga0495622_0031579 | Ga0495622_0031579_606_1421 | 271 |
| 733 | 3300046557 | Ga0495622_0195993 | Ga0495622_0195993_46_861 | 271 |
| 734 | 3300046557 | Ga0495622_0209532 | Ga0495622_0209532_12_827 | 271 |
| 735 | 3300046558 | Ga0495633_0000287 | Ga0495633_0000287_4762_5577 | 271 |
| 736 | 3300046558 | Ga0495633_0019202 | Ga0495633_0019202_1506_2321 | 271 |
| 737 | 3300046558 | Ga0495633_0133599 | Ga0495633_0133599_164_979 | 271 |
| 738 | 3300046558 | Ga0495633_0165922 | Ga0495633_0165922_31_846 | 271 |
| 739 | 3300046615 | Ga0495656_0043668 | Ga0495656_0043668_147_962 | 271 |
| 740 | 3300046616 | Ga0495668_0008686 | Ga0495668_0008686_4108_4923 | 271 |
| 741 | 3300046616 | Ga0495668_0010764 | Ga0495668_0010764_703_1518 | 271 |
| 742 | 3300046616 | Ga0495668_0193595 | Ga0495668_0193595_180_995 | 271 |
| 743 | 3300046642 | Ga0495634_0012371 | Ga0495634_0012371_4378_5193 | 271 |
| 744 | 3300046642 | Ga0495634_0348377 | Ga0495634_0348377_61_876 | 271 |
| 745 | 3300046648 | Ga0495611_0000679 | Ga0495611_0000679_17513_18328 | 271 |
| 746 | 3300046648 | Ga0495611_0001919 | Ga0495611_0001919_4407_5222 | 271 |
| 747 | 3300046648 | Ga0495611_0010339 | Ga0495611_0010339_2645_3460 | 271 |
| 748 | 3300046648 | Ga0495611_0017803 | Ga0495611_0017803_2124_2939 | 271 |
| 749 | 3300046648 | Ga0495611_0060545 | Ga0495611_0060545_111_926 | 271 |
| 750 | 3300046660 | Ga0495625_0002270 | Ga0495625_0002270_19401_20216 | 271 |
| 751 | 3300046660 | Ga0495625_0014956 | Ga0495625_0014956_1103_1918 | 271 |
| 752 | 3300046660 | Ga0495625_0018168 | Ga0495625_0018168_4589_5404 | 271 |
| 753 | 3300046660 | Ga0495625_0051669 | Ga0495625_0051669_676_1491 | 271 |
| 754 | 3300046660 | Ga0495625_0052634 | Ga0495625_0052634_795_1610 | 271 |
| 755 | 3300046660 | Ga0495625_0055293 | Ga0495625_0055293_95_910 | 271 |
| 756 | 3300046660 | Ga0495625_0089787 | Ga0495625_0089787_1204_2019 | 271 |
| 757 | 3300046660 | Ga0495625_0097873 | Ga0495625_0097873_613_1428 | 271 |
| 758 | 3300046660 | Ga0495625_0328531 | Ga0495625_0328531_48_863 | 271 |
| 759 | 3300046663 | Ga0495635_0011871 | Ga0495635_0011871_4477_5292 | 271 |
| 760 | 3300046663 | Ga0495635_0078913 | Ga0495635_0078913_293_1108 | 271 |
| 761 | 3300046664 | Ga0495659_0002188 | Ga0495659_0002188_4427_5242 | 271 |
| 762 | 3300046664 | Ga0495659_0017081 | Ga0495659_0017081_1352_2167 | 271 |
| 763 | 3300046664 | Ga0495659_0074843 | Ga0495659_0074843_62_877 | 271 |
| 764 | 3300046664 | Ga0495659_0127726 | Ga0495659_0127726_43_858 | 271 |
| 765 | 3300046665 | Ga0495661_0000028 | Ga0495661_0000028_4739_5554 | 271 |
| 766 | 3300046665 | Ga0495661_0000596 | Ga0495661_0000596_4776_5591 | 271 |
| 767 | 3300046665 | Ga0495661_0032749 | Ga0495661_0032749_1966_2781 | 271 |
| 768 | 3300046665 | Ga0495661_0089635 | Ga0495661_0089635_701_1516 | 271 |
| 769 | 3300046665 | Ga0495661_0230404 | Ga0495661_0230404_118_933 | 271 |
| 770 | 3300046674 | Ga0495588_0046567 | Ga0495588_0046567_1282_2097 | 271 |
| 771 | 3300046679 | Ga0495623_0011027 | Ga0495623_0011027_4451_5266 | 271 |
| 772 | 3300046679 | Ga0495623_0040153 | Ga0495623_0040153_1028_1843 | 271 |
| 773 | 3300046680 | Ga0495646_0034820 | Ga0495646_0034820_663_1478 | 271 |
| 774 | 3300046689 | Ga0495613_0028914 | Ga0495613_0028914_91_906 | 271 |
| 775 | 3300046689 | Ga0495613_0035907 | Ga0495613_0035907_551_1366 | 271 |
| 776 | 3300046690 | Ga0495624_0010386 | Ga0495624_0010386_1150_1965 | 271 |
| 777 | 3300046691 | Ga0495670_0005708 | Ga0495670_0005708_4938_5753 | 271 |
| 778 | 3300046691 | Ga0495670_0005850 | Ga0495670_0005850_4443_5258 | 271 |
| 779 | 3300046691 | Ga0495670_0007057 | Ga0495670_0007057_3830_4645 | 271 |
| 780 | 3300046691 | Ga0495670_0009118 | Ga0495670_0009118_1378_2193 | 271 |
| 781 | 3300046691 | Ga0495670_0031281 | Ga0495670_0031281_734_1549 | 271 |
| 782 | 3300046691 | Ga0495670_0061676 | Ga0495670_0061676_168_983 | 271 |
| 783 | 3300046692 | Ga0495671_0007066 | Ga0495671_0007066_1131_1946 | 271 |
| 784 | 3300046692 | Ga0495671_0011040 | Ga0495671_0011040_2477_3292 | 271 |
| 785 | 3300046692 | Ga0495671_0011460 | Ga0495671_0011460_1132_1947 | 271 |
| 786 | 3300046692 | Ga0495671_0018162 | Ga0495671_0018162_2789_3604 | 271 |
| 787 | 3300046692 | Ga0495671_0020947 | Ga0495671_0020947_769_1584 | 271 |
| 788 | 3300046692 | Ga0495671_0022238 | Ga0495671_0022238_2116_2931 | 271 |
| 789 | 3300046692 | Ga0495671_0044886 | Ga0495671_0044886_64_879 | 271 |
| 790 | 3300046692 | Ga0495671_0111003 | Ga0495671_0111003_221_1036 | 271 |
| 791 | 3300046692 | Ga0495671_0224292 | Ga0495671_0224292_46_861 | 271 |
| 792 | 3300046692 | Ga0495671_0229791 | Ga0495671_0229791_65_880 | 271 |
| 793 | 3300046694 | Ga0495649_0003758 | Ga0495649_0003758_8454_9269 | 271 |
| 794 | 3300046694 | Ga0495649_0007939 | Ga0495649_0007939_1134_1949 | 271 |
| 795 | 3300046694 | Ga0495649_0013301 | Ga0495649_0013301_157_972 | 271 |
| 796 | 3300046694 | Ga0495649_0027148 | Ga0495649_0027148_1087_1902 | 271 |
| 797 | 3300046694 | Ga0495649_0029908 | Ga0495649_0029908_2057_2872 | 271 |
| 798 | 3300046694 | Ga0495649_0049367 | Ga0495649_0049367_680_1495 | 271 |
| 799 | 3300046694 | Ga0495649_0087794 | Ga0495649_0087794_59_874 | 271 |
| 800 | 3300046694 | Ga0495649_0159131 | Ga0495649_0159131_342_1157 | 271 |
| 801 | 3300046694 | Ga0495649_0204193 | Ga0495649_0204193_152_967 | 271 |
| 802 | 3300046794 | Ga0495589_0005797 | Ga0495589_0005797_1755_2570 | 271 |
| 803 | 3300046794 | Ga0495589_0006835 | Ga0495589_0006835_727_1542 | 271 |
| 804 | 3300046794 | Ga0495589_0007574 | Ga0495589_0007574_805_1620 | 271 |
| 805 | 3300046794 | Ga0495589_0009516 | Ga0495589_0009516_139_954 | 271 |
| 806 | 3300046794 | Ga0495589_0012887 | Ga0495589_0012887_939_1754 | 271 |
| 807 | 3300046794 | Ga0495589_0018694 | Ga0495589_0018694_2549_3364 | 271 |
| 808 | 3300046794 | Ga0495589_0021020 | Ga0495589_0021020_154_969 | 271 |
| 809 | 3300046794 | Ga0495589_0035241 | Ga0495589_0035241_618_1433 | 271 |
| 810 | 3300046794 | Ga0495589_0053171 | Ga0495589_0053171_1136_1951 | 271 |
| 811 | 3300046809 | Ga0495600_0275706 | Ga0495600_0275706_24_839 | 271 |
| 812 | 3300046810 | Ga0495660_0001754 | Ga0495660_0001754_13248_14063 | 271 |
| 813 | 3300046810 | Ga0495660_0005255 | Ga0495660_0005255_4795_5613 | 271 |
| 814 | 3300046810 | Ga0495660_0014627 | Ga0495660_0014627_3334_4149 | 271 |
| 815 | 3300046810 | Ga0495660_0034942 | Ga0495660_0034942_1204_2019 | 271 |
| 816 | 3300046810 | Ga0495660_0051904 | Ga0495660_0051904_774_1589 | 271 |
| 817 | 3300046810 | Ga0495660_0082870 | Ga0495660_0082870_62_877 | 271 |
| 818 | 3300046810 | Ga0495660_0126811 | Ga0495660_0126811_393_1208 | 271 |
| 819 | 3300047315 | Ga0495581_0020117 | Ga0495581_0020117_829_1644 | 271 |
| 820 | 3300047317 | Ga0495604_0014492 | Ga0495604_0014492_1030_1845 | 271 |
| 821 | 3300047317 | Ga0495604_0019863 | Ga0495604_0019863_435_1250 | 271 |
| 822 | 3300047317 | Ga0495604_0080550 | Ga0495604_0080550_1413_2228 | 271 |
| 823 | 3300047317 | Ga0495604_0172488 | Ga0495604_0172488_682_1497 | 271 |
| 824 | 3300047318 | Ga0495636_0023199 | Ga0495636_0023199_1480_2295 | 271 |
| 825 | 3300047319 | Ga0495674_0022886 | Ga0495674_0022886_492_1307 | 271 |
| 826 | 3300047320 | Ga0495672_0004119 | Ga0495672_0004119_432_1247 | 271 |
| 827 | 3300047320 | Ga0495672_0010951 | Ga0495672_0010951_4221_5036 | 271 |
| 828 | 3300047320 | Ga0495672_0010991 | Ga0495672_0010991_1135_1950 | 271 |
| 829 | 3300047320 | Ga0495672_0011802 | Ga0495672_0011802_4192_5007 | 271 |
| 830 | 3300047320 | Ga0495672_0012546 | Ga0495672_0012546_4762_5580 | 271 |
| 831 | 3300047320 | Ga0495672_0012897 | Ga0495672_0012897_3841_4656 | 271 |
| 832 | 3300047320 | Ga0495672_0025964 | Ga0495672_0025964_1489_2304 | 271 |
| 833 | 3300047320 | Ga0495672_0067681 | Ga0495672_0067681_759_1574 | 271 |
| 834 | 3300047320 | Ga0495672_0188097 | Ga0495672_0188097_32_847 | 271 |
| 835 | 3300047321 | Ga0495676_0019306 | Ga0495676_0019306_1928_2743 | 271 |
| 836 | 3300047321 | Ga0495676_0044259 | Ga0495676_0044259_654_1469 | 271 |
| 837 | 3300047321 | Ga0495676_0346046 | Ga0495676_0346046_32_847 | 271 |
| 838 | 3300047322 | Ga0495680_0016282 | Ga0495680_0016282_1133_1948 | 271 |
| 839 | 3300047322 | Ga0495680_0020043 | Ga0495680_0020043_775_1590 | 271 |
| 840 | 3300047322 | Ga0495680_0020798 | Ga0495680_0020798_4462_5277 | 271 |
| 841 | 3300047322 | Ga0495680_0022963 | Ga0495680_0022963_833_1648 | 271 |
| 842 | 3300047322 | Ga0495680_0061528 | Ga0495680_0061528_1992_2807 | 271 |
| 843 | 3300047322 | Ga0495680_0110478 | Ga0495680_0110478_732_1547 | 271 |
| 844 | 3300047323 | Ga0495683_0000053 | Ga0495683_0000053_116174_116989 | 271 |
| 845 | 3300047323 | Ga0495683_0000176 | Ga0495683_0000176_1130_1945 | 271 |
| 846 | 3300047323 | Ga0495683_0006693 | Ga0495683_0006693_4158_4973 | 271 |
| 847 | 3300047323 | Ga0495683_0027993 | Ga0495683_0027993_254_1069 | 271 |
| 848 | 3300047323 | Ga0495683_0032221 | Ga0495683_0032221_1793_2608 | 271 |
| 849 | 3300047323 | Ga0495683_0106796 | Ga0495683_0106796_316_1131 | 271 |
| 850 | 3300047443 | Ga0495687_000676 | Ga0495687_000676_37845_38660 | 271 |
| 851 | 3300047443 | Ga0495687_008412 | Ga0495687_008412_654_1469 | 271 |
| 852 | 3300047443 | Ga0495687_011711 | Ga0495687_011711_2735_3550 | 271 |
| 853 | 3300047443 | Ga0495687_016205 | Ga0495687_016205_2731_3546 | 271 |
| 854 | 3300047444 | Ga0495675_0069826 | Ga0495675_0069826_549_1364 | 271 |
| 855 | 3300047445 | Ga0495677_0004418 | Ga0495677_0004418_4429_5244 | 271 |
| 856 | 3300047446 | Ga0495679_002285 | Ga0495679_002285_4334_5149 | 271 |
| 857 | 3300047446 | Ga0495679_013289 | Ga0495679_013289_504_1319 | 271 |
| 858 | 3300047446 | Ga0495679_015209 | Ga0495679_015209_37_852 | 271 |
| 859 | 3300047446 | Ga0495679_073427 | Ga0495679_073427_37_852 | 271 |
| 860 | 3300047447 | Ga0495685_006994 | Ga0495685_006994_2319_3134 | 271 |
| 861 | 3300047447 | Ga0495685_022697 | Ga0495685_022697_1012_1827 | 271 |
| 862 | 3300047469 | Ga0495673_0000938 | Ga0495673_0000938_1127_1942 | 271 |
| 863 | 3300047469 | Ga0495673_0001495 | Ga0495673_0001495_4843_5661 | 271 |
| 864 | 3300047469 | Ga0495673_0002985 | Ga0495673_0002985_8020_8835 | 271 |
| 865 | 3300047469 | Ga0495673_0007204 | Ga0495673_0007204_4504_5319 | 271 |
| 866 | 3300047469 | Ga0495673_0007237 | Ga0495673_0007237_4478_5293 | 271 |
| 867 | 3300047469 | Ga0495673_0008958 | Ga0495673_0008958_63_878 | 271 |
| 868 | 3300047469 | Ga0495673_0012088 | Ga0495673_0012088_1128_1943 | 271 |
| 869 | 3300047469 | Ga0495673_0015257 | Ga0495673_0015257_492_1307 | 271 |
| 870 | 3300047469 | Ga0495673_0020580 | Ga0495673_0020580_166_981 | 271 |
| 871 | 3300047469 | Ga0495673_0039272 | Ga0495673_0039272_1271_2086 | 271 |
| 872 | 3300047469 | Ga0495673_0064910 | Ga0495673_0064910_147_962 | 271 |
| 873 | 3300047470 | Ga0495681_0000588 | Ga0495681_0000588_25849_26664 | 271 |
| 874 | 3300047470 | Ga0495681_0005805 | Ga0495681_0005805_189_1004 | 271 |
| 875 | 3300047470 | Ga0495681_0009539 | Ga0495681_0009539_602_1420 | 271 |
| 876 | 3300047470 | Ga0495681_0009601 | Ga0495681_0009601_1130_1945 | 271 |
| 877 | 3300047470 | Ga0495681_0010451 | Ga0495681_0010451_692_1507 | 271 |
| 878 | 3300047470 | Ga0495681_0010626 | Ga0495681_0010626_464_1279 | 271 |
| 879 | 3300047470 | Ga0495681_0010743 | Ga0495681_0010743_3844_4659 | 271 |
| 880 | 3300047470 | Ga0495681_0020902 | Ga0495681_0020902_988_1803 | 271 |
| 881 | 3300047470 | Ga0495681_0023530 | Ga0495681_0023530_1088_1903 | 271 |
| 882 | 3300047470 | Ga0495681_0029275 | Ga0495681_0029275_410_1225 | 271 |
| 883 | 3300047470 | Ga0495681_0035413 | Ga0495681_0035413_13_828 | 271 |
| 884 | 3300047470 | Ga0495681_0041589 | Ga0495681_0041589_1262_2077 | 271 |
| 885 | 3300047470 | Ga0495681_0100436 | Ga0495681_0100436_264_1079 | 271 |
| 886 | 3300047470 | Ga0495681_0151076 | Ga0495681_0151076_34_849 | 271 |
| 887 | 3300047471 | Ga0495684_0154978 | Ga0495684_0154978_517_1332 | 271 |
| 888 | 3300047471 | Ga0495684_0365772 | Ga0495684_0365772_195_1010 | 271 |
| 889 | 3300047472 | Ga0495686_0018147 | Ga0495686_0018147_3865_4680 | 271 |
| 890 | 3300047472 | Ga0495686_0021228 | Ga0495686_0021228_2707_3522 | 271 |
| 891 | 3300047472 | Ga0495686_0023740 | Ga0495686_0023740_355_1170 | 271 |
| 892 | 3300047472 | Ga0495686_0039147 | Ga0495686_0039147_347_1162 | 271 |
| 893 | 3300047673 | Ga0495593_0059771 | Ga0495593_0059771_34_849 | 271 |
| 894 | 3300047673 | Ga0495593_0128828 | Ga0495593_0128828_300_1115 | 271 |
| 895 | 3300047673 | Ga0495593_0209231 | Ga0495593_0209231_31_846 | 271 |
| 896 | 3300048088 | Ga0495602_0133851 | Ga0495602_0133851_1110_1925 | 271 |
| 897 | 3300048088 | Ga0495602_0232462 | Ga0495602_0232462_151_966 | 271 |
| 898 | 3300048091 | Ga0495626_0000721 | Ga0495626_0000721_28971_29786 | 271 |
| 899 | 3300048091 | Ga0495626_0002158 | Ga0495626_0002158_1127_1942 | 271 |
| 900 | 3300048091 | Ga0495626_0007151 | Ga0495626_0007151_923_1738 | 271 |
| 901 | 3300048091 | Ga0495626_0007269 | Ga0495626_0007269_1136_1951 | 271 |
| 902 | 3300048091 | Ga0495626_0008235 | Ga0495626_0008235_4107_4922 | 271 |
| 903 | 3300048091 | Ga0495626_0009970 | Ga0495626_0009970_3845_4660 | 271 |
| 904 | 3300048091 | Ga0495626_0010027 | Ga0495626_0010027_62_877 | 271 |
| 905 | 3300048091 | Ga0495626_0036297 | Ga0495626_0036297_693_1508 | 271 |
| 906 | 3300048905 | Ga0496102_0017499 | Ga0496102_0017499_1015_1830 | 271 |
| 907 | 3300048906 | Ga0496103_0008923 | Ga0496103_0008923_4108_4923 | 271 |
| 908 | 3300048908 | Ga0496105_0379909 | Ga0496105_0379909_201_1016 | 271 |
| 909 | 3300048913 | Ga0496110_0178192 | Ga0496110_0178192_583_1398 | 271 |
| 910 | 3300048914 | Ga0496111_0094149 | Ga0496111_0094149_1309_2124 | 271 |
| 911 | 3300048918 | Ga0496115_0432897 | Ga0496115_0432897_127_942 | 271 |
| 912 | 3300048919 | Ga0496116_0001102 | Ga0496116_0001102_682_1497 | 271 |
| 913 | 3300048919 | Ga0496116_0001892 | Ga0496116_0001892_20259_21074 | 271 |
| 914 | 3300048919 | Ga0496116_0013194 | Ga0496116_0013194_4465_5280 | 271 |
| 915 | 3300048919 | Ga0496116_0028107 | Ga0496116_0028107_2807_3622 | 271 |
| 916 | 3300048919 | Ga0496116_0036122 | Ga0496116_0036122_1545_2360 | 271 |
| 917 | 3300048919 | Ga0496116_0063853 | Ga0496116_0063853_536_1351 | 271 |
| 918 | 3300048920 | Ga0496117_0002125 | Ga0496117_0002125_896_1711 | 271 |
| 919 | 3300048920 | Ga0496117_0003138 | Ga0496117_0003138_17781_18596 | 271 |
| 920 | 3300048920 | Ga0496117_0021272 | Ga0496117_0021272_56_871 | 271 |
| 921 | 3300048920 | Ga0496117_0049167 | Ga0496117_0049167_480_1295 | 271 |
| 922 | 3300048920 | Ga0496117_0106235 | Ga0496117_0106235_937_1752 | 271 |
| 923 | 3300048920 | Ga0496117_0120247 | Ga0496117_0120247_790_1605 | 271 |
| 924 | 3300048920 | Ga0496117_0229352 | Ga0496117_0229352_202_1017 | 271 |
| 925 | 3300048921 | Ga0496118_0025614 | Ga0496118_0025614_3976_4791 | 271 |
| 926 | 3300048921 | Ga0496118_0032940 | Ga0496118_0032940_621_1436 | 271 |
| 927 | 3300048921 | Ga0496118_0041866 | Ga0496118_0041866_685_1500 | 271 |
| 928 | 3300048921 | Ga0496118_0157774 | Ga0496118_0157774_11_826 | 271 |
| 929 | 3300048921 | Ga0496118_0191515 | Ga0496118_0191515_250_1065 | 271 |
| 930 | 3300048921 | Ga0496118_0227488 | Ga0496118_0227488_254_1069 | 271 |
| 931 | 3300048922 | Ga0496119_0025020 | Ga0496119_0025020_2957_3772 | 271 |
| 932 | 3300048922 | Ga0496119_0089649 | Ga0496119_0089649_648_1463 | 271 |
| 933 | 3300048922 | Ga0496119_0110366 | Ga0496119_0110366_633_1448 | 271 |
| 934 | 3300048923 | Ga0496120_0032235 | Ga0496120_0032235_1078_1893 | 271 |
| 935 | 3300048923 | Ga0496120_0202094 | Ga0496120_0202094_129_944 | 271 |
| 936 | 3300048924 | Ga0496121_0000781 | Ga0496121_0000781_56032_56847 | 271 |
| 937 | 3300048924 | Ga0496121_0046437 | Ga0496121_0046437_2239_3054 | 271 |
| 938 | 3300048924 | Ga0496121_0075467 | Ga0496121_0075467_1449_2264 | 271 |
| 939 | 3300048924 | Ga0496121_0193598 | Ga0496121_0193598_613_1428 | 271 |
| 940 | 3300048925 | Ga0496122_0001762 | Ga0496122_0001762_3448_4263 | 271 |
| 941 | 3300048925 | Ga0496122_0018352 | Ga0496122_0018352_1067_1882 | 271 |
| 942 | 3300048925 | Ga0496122_0018887 | Ga0496122_0018887_1081_1896 | 271 |
| 943 | 3300048926 | Ga0496123_0001295 | Ga0496123_0001295_3828_4643 | 271 |
| 944 | 3300048926 | Ga0496123_0014533 | Ga0496123_0014533_4591_5406 | 271 |
| 945 | 3300048927 | Ga0496124_0002323 | Ga0496124_0002323_23929_24744 | 271 |
| 946 | 3300048927 | Ga0496124_0026032 | Ga0496124_0026032_4213_5028 | 271 |
| 947 | 3300048927 | Ga0496124_0154606 | Ga0496124_0154606_434_1249 | 271 |
| 948 | 3300048927 | Ga0496124_0162748 | Ga0496124_0162748_763_1578 | 271 |
| 949 | 3300048927 | Ga0496124_0173757 | Ga0496124_0173757_300_1115 | 271 |
| 950 | 3300048928 | Ga0496125_0002291 | Ga0496125_0002291_911_1726 | 271 |
| 951 | 3300048928 | Ga0496125_0019099 | Ga0496125_0019099_1427_2242 | 271 |
| 952 | 3300048928 | Ga0496125_0054616 | Ga0496125_0054616_220_1035 | 271 |
| 953 | 3300048928 | Ga0496125_0149095 | Ga0496125_0149095_493_1308 | 271 |
| 954 | 3300048929 | Ga0496126_0146537 | Ga0496126_0146537_536_1351 | 271 |
| 955 | 3300048929 | Ga0496126_0166247 | Ga0496126_0166247_235_1050 | 271 |
| 956 | 3300048929 | Ga0496126_0582464 | Ga0496126_0582464_58_873 | 271 |
| 957 | 3300049459 | Ga0495678_000362 | Ga0495678_000362_4775_5590 | 271 |
| 958 | 3300049459 | Ga0495678_007338 | Ga0495678_007338_4208_5023 | 271 |
| 959 | 3300049459 | Ga0495678_007420 | Ga0495678_007420_4484_5299 | 271 |
| 960 | 3300049459 | Ga0495678_010370 | Ga0495678_010370_2857_3672 | 271 |
| 961 | 3300049459 | Ga0495678_017505 | Ga0495678_017505_2337_3152 | 271 |
| 962 | 3300049459 | Ga0495678_020346 | Ga0495678_020346_76_891 | 271 |
| 963 | 3300049459 | Ga0495678_030754 | Ga0495678_030754_740_1555 | 271 |
| 964 | 3300049459 | Ga0495678_038732 | Ga0495678_038732_124_939 | 271 |
| 965 | 3300049459 | Ga0495678_050308 | Ga0495678_050308_32_847 | 271 |
| 966 | 3300049459 | Ga0495678_057954 | Ga0495678_057954_117_932 | 271 |
| 967 | 3300049459 | Ga0495678_058781 | Ga0495678_058781_554_1369 | 271 |
| 968 | 3300049459 | Ga0495678_068185 | Ga0495678_068185_121_936 | 271 |
| 969 | 3300049459 | Ga0495678_122652 | Ga0495678_122652_11_826 | 271 |
| 970 | 3300049460 | Ga0495682_0000344 | Ga0495682_0000344_28776_29591 | 271 |
| 971 | 3300049460 | Ga0495682_0016549 | Ga0495682_0016549_609_1424 | 271 |
| 972 | 3300049460 | Ga0495682_0124754 | Ga0495682_0124754_61_876 | 271 |
| 973 | 3300049665 | Ga0501227_065892 | Ga0501227_065892_75_890 | 271 |
| 974 | 3300049758 | Ga0501241_015355 | Ga0501241_015355_277_1092 | 271 |
| 975 | 3300049853 | Ga0501226_000022 | Ga0501226_000022_89510_90325 | 271 |
| 976 | 3300050490 | nmdc:mga03n38_176280_c1 | nmdc:mga03n38_176280_c1_204_1019 | 271 |
| 977 | 3300050491 | nmdc:mga00v17_267365_c1 | nmdc:mga00v17_267365_c1_137_952 | 271 |
| 978 | 3300050491 | nmdc:mga00v17_73054_c1 | nmdc:mga00v17_73054_c1_1264_2079 | 271 |
| 979 | 3300050514 | nmdc:mga08x19_267819_c1 | nmdc:mga08x19_267819_c1_292_1107 | 271 |
| 980 | 3300050516 | nmdc:mga0sz30_22593_c1 | nmdc:mga0sz30_22593_c1_223_1038 | 271 |
| 981 | 3300053140 | Ga0500573_0031135 | Ga0500573_0031135_1700_2518 | 271 |
| 982 | 3300053161 | Ga0500634_0011370 | Ga0500634_0011370_2983_3798 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2y4r-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa | 0.9756 | 3 | 271 |
| 2y4r-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa | 0.9685 | 3 | 271 |
| 1et0-assembly1.cif.gz_A | crystal structure of aminodeoxychorismate lyase from escherichia coli | 0.9536 | 3 | 265 |
| 6bb9-assembly1.cif.gz_B | the crystal structure of 4-amino-4-deoxychorismate lyase from salmonella typhimurium lt2 | 0.9452 | 3 | 266 |
| 1et0-assembly1.cif.gz_A | crystal structure of aminodeoxychorismate lyase from escherichia coli | 0.9428 | 3 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xpfB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.978 | 112 | 271 | 3.20.10.10 |
| 2xpfB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.972 | 112 | 271 | 3.20.10.10 |
| 1i2lA02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9542 | 121 | 264 | 3.20.10.10 |
| 2xpfA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9459 | 3 | 111 | 3.30.470.10 |
| 1i2lA02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9416 | 121 | 264 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7QY79-F1-model_v4 | deleted | 0.9828 | 18 | 174 |
|
| AF-A0A3D0JQH8-F1-model_v4 | Aminodeoxychorismate lyase (EC 4.1.3.38) | 0.9791 | 1 | 226 |
GO:0005829
GO:0008153 GO:0008696 GO:0030170 GO:0046656 |
| AF-A0A8B5BEA2-F1-model_v4 | deleted | 0.9775 | 1 | 271 |
|
| AF-A0A0B8PEA7-F1-model_v4 | Aminodeoxychorismate lyase | 0.975 | 164 | 267 |
GO:0005829
GO:0008153 GO:0008696 |
| AF-A0A250KY99-F1-model_v4 | Aminodeoxychorismate lyase (EC 4.1.3.38) | 0.9727 | 69 | 267 |
GO:0005829
GO:0008153 GO:0008696 GO:0030170 GO:0046656 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar