F487076

General Info

Members Datasets Scaffolds Average Seq Length
969 411 755 803

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0012233|Ga0495643_0012233_1098_3638
Length 846
Sequence LPRGWPKKWCSTVVVWLARTSAEVRVFRETLRALVSHWRQHPVQFFSVLTGLWLATSLLTGVQALNSQARESYARASQLIGGEPQASLSAPSGATFSQQVFVDLRRAGWPVSPVLQGRVTLKGHDDQRLQLMGIEPVSLPVGSAVAGQALAIEQVVEFFSPPGSTWTSPQTLQALGLQEGESPLTLSGQALPPLHAQPDMAPGVLLVDIGFAQQILGLPDQLSRLLLPKDFTATLPDQFKGQLQLKTSGEENNLSRLTESFHLNLDALGFLSFVVGLFIVHAAIGLALEQRRGLLRTLRACGVSARMLIACLAVELGGLALIGGLVGVASGYLLASVLLPDVAASLRGLYGAEVAGQLSLSPWWWLSGVGLSLLGALLAGSNSLLRAARLPLLALADPQAWHQAHARWLRRQGWVAVIAAVIAVLALIFGDSLSSGFVLMAALLIGXXXALPVXXNWXXNRVLHRSRSVLGQWFLADCRQQLPALSLALMALLLALAANIGAGSMTAGFRQTFSDWLEQRLTAELYVNPRNPAQARELQTWLKQQPGLTAVLPSWQVSIQLQGWPADVFGVIDHPTYRQHWPLLEALGDNPWDRLAKDDALMLSEQLARRLKVRLGDHLTIPTPNGAWSPRIVGIYADYGNPKGHILVNVNHLLRGWPQLTPSRFNLRIDPTLIPAFLTALQTRFTLEDSRIVDQARLKGWSTQVFERTFAATAALNSLTLCVAGVALFISLLTQSQSRLGQLAPLWALGVTRRQLMLLNLGQTWLLAVLTLVLALPLGIALAWCLDTVINVQAFGWRLPLRVFPLQLLQLMGLALLATLLASAWPLYSLYRTQPADLLRTFAHED

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231021 Pseudomonas sp. GM78 Isolate Nodule
15 2511231022 Pseudomonas sp. GM79 Isolate Nodule
16 2511231023 Pseudomonas sp. GM80 Isolate Nodule
17 2511231031 Pseudomonas sp. GM16 Isolate Nodule
18 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
19 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
20 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
21 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
22 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
23 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
24 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
25 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
26 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
27 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
28 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
29 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
30 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
31 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
32 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
33 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
34 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
35 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
36 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
37 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
38 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
39 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
40 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
41 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
42 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
43 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
44 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
45 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
46 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
47 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
48 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
49 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
50 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
51 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
52 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
53 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
54 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
55 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
56 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
57 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
58 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
59 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
60 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
61 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
62 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
63 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
64 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
65 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
66 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
67 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
68 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
69 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
70 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
71 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
72 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
73 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
74 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
75 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
76 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
77 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
78 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
79 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
80 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
81 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
82 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
83 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
84 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
87 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
90 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
91 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
92 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
93 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
94 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
95 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
96 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
97 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
98 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
99 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
100 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
101 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
102 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
103 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
104 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
105 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
106 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
107 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
108 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
109 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
110 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
111 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
112 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
113 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
114 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
115 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
116 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
117 2773857670 Pseudomonas sp. 478 Isolate Unclassified
118 2773857673 Pseudomonas sp. 443 Isolate Unclassified
119 2784132063 Pseudomonas sp. 424 Isolate Unclassified
120 2784132072 Pseudomonas sp. 460 Isolate Unclassified
121 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
122 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
123 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
124 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
125 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
126 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
127 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
128 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
129 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
130 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
131 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
132 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
133 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
134 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
135 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
136 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
137 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
138 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
139 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
140 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
141 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
142 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
143 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
144 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
145 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
146 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
147 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
148 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
149 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
150 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
151 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
152 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
153 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
154 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
155 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
156 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
157 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
158 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
159 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
160 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
161 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
162 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
163 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
164 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
165 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
166 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
167 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
168 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
169 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
170 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
171 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
172 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
173 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
174 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
175 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
176 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
177 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
178 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
179 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
180 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
181 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
182 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
183 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
184 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
185 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
186 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
187 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
188 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
189 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
190 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
191 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
192 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
193 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
194 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
195 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
196 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
197 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
198 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
199 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
200 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
201 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
202 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
203 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
204 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
205 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
206 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
207 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
208 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
209 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
210 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
211 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
212 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
213 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
214 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
215 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
216 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
217 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
218 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
219 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
220 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
221 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
222 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
223 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
224 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
225 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
226 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
227 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
228 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
229 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
230 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
231 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
232 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
233 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
234 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
235 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
236 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
237 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
238 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
244 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
245 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
247 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
249 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
250 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
269 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
270 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
272 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
275 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
276 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
277 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
280 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
281 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
282 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
283 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
284 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
285 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
286 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
287 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
288 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
289 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
290 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
291 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
292 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
293 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
294 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
295 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
296 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
297 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
301 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
305 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
306 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
307 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
315 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
316 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
317 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
318 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
319 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
320 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
321 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
322 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
323 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
324 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
325 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
326 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
327 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
330 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
331 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
332 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
333 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
334 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
335 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
336 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
337 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
338 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
341 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
353 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
360 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
365 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
368 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
369 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
370 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
386 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
387 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
388 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
389 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
390 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
391 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
392 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
393 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
394 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
395 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
396 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
397 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
398 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
399 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
400 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
401 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
402 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
403 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
404 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
405 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
406 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
407 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
408 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
409 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
410 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
411 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.92
Metatranscriptomes 0
Isolates 22.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.19
Nodule 2.27
Rhizoplane 7.02
Rhizosphere 72.76
Stem 0
Stem Tuber 0
Unclassified 11.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000050 3300002737 Bacteria 157157
2 JGI25162J39368_1000060 3300002737 Bacteria 137745
3 JGI25163J39215_1000017 3300002771 Bacteria 79704
4 JGI25163J39215_1000102 3300002771 Bacteria 35489
5 JGI25164J39214_1000025 3300002772 Bacteria 157157
6 JGI25164J39214_1000037 3300002772 Bacteria 137530
7 JGI25165J46597_1000114 3300003214 Bacteria 144350
8 JGI25165J46597_1000118 3300003214 Bacteria 137530
9 JGI25165J46597_1000176 3300003214 Bacteria 99160
10 Ga0055538_1000066 3300003751 Bacteria 98557
11 Ga0055539_1000102 3300003752 Bacteria 98557
12 Ga0055533_1000110 3300003756 Bacteria 98557
13 Ga0055532_1000326 3300003758 Bacteria 26665
14 Ga0055525_1000187 3300003759 Bacteria 75518
15 Ga0055536_1000028 3300003781 Bacteria 162550
16 Ga0055536_1000046 3300003781 Bacteria 118284
17 Ga0055536_1000119 3300003781 Bacteria 68235
18 Ga0055530_10000030 3300003791 Bacteria 125301
19 Ga0055530_10000094 3300003791 Bacteria 76102
20 Ga0055530_10000653 3300003791 Bacteria 29713
21 Ga0055540_1000070 3300003792 Bacteria 118483
22 Ga0055540_1000130 3300003792 Bacteria 76102
23 Ga0055540_1000262 3300003792 Bacteria 47599
24 Ga0055531_10001382 3300003794 Bacteria 18006
25 Ga0055541_1000068 3300003841 Bacteria 98557
26 Ga0065714_10000079 3300005288 Bacteria 12131
27 Ga0065714_10002746 3300005288 Bacteria 12938
28 Ga0065714_10003089 3300005288 Bacteria 13598
29 Ga0065704_10071193 3300005289 Bacteria 12583
30 Ga0065704_10075106 3300005289 Bacteria 5786
31 Ga0070670_100000242 3300005331 Bacteria 49330
32 Ga0070670_100001182 3300005331 Bacteria 20700
33 Ga0070661_100000151 3300005344 Bacteria 56885
34 Ga0070662_100001621 3300005457 Bacteria 13873
35 Ga0070664_100000095 3300005564 Bacteria 56885
36 Ga0068851_10000119 3300005834 Bacteria 42402
37 Ga0079104_1000325 3300006946 Bacteria 58566
38 Ga0079104_1000469 3300006946 Bacteria 45007
39 Ga0105251_10000088 3300009011 Bacteria 88504
40 Ga0105251_10000252 3300009011 Bacteria 53844
41 Ga0105251_10000806 3300009011 Bacteria 28377
42 Ga0105251_10002980 3300009011 Bacteria 12671
43 Ga0105251_10003228 3300009011 Bacteria 12013
44 Ga0105244_10000568 3300009036 Bacteria 33066
45 Ga0105244_10000991 3300009036 Bacteria 23858
46 Ga0105244_10001433 3300009036 Bacteria 19301
47 Ga0105244_10001729 3300009036 Bacteria 17190
48 Ga0105244_10015684 3300009036 Bacteria 4338
49 Ga0105244_10022491 3300009036 Bacteria 3469
50 Ga0105250_10000304 3300009092 Bacteria 38571
51 Ga0105250_10000849 3300009092 Bacteria 18118
52 Ga0105250_10005489 3300009092 Bacteria 5679
53 Ga0105250_10010093 3300009092 Bacteria 3943
54 Ga0105243_10000142 3300009148 Bacteria 82230
55 Ga0105243_10002427 3300009148 Bacteria 15588
56 Ga0105243_10014765 3300009148 Bacteria 5908
57 Ga0105242_10003458 3300009176 Bacteria 12283
58 Ga0105237_10000009 3300009545 Bacteria 337615
59 Ga0105246_10000021 3300011119 Bacteria 59651
60 Ga0105246_10005271 3300011119 Bacteria 7865
61 Ga0105246_10051915 3300011119 Bacteria 2817
62 Ga0157345_1000107 3300012498 Bacteria 15943
63 Ga0157373_10000084 3300013100 Bacteria 81436
64 Ga0157373_10000144 3300013100 Bacteria 56939
65 Ga0157373_10000722 3300013100 Bacteria 25841
66 Ga0157373_10005893 3300013100 Bacteria 9168
67 Ga0157373_10009331 3300013100 Bacteria 7250
68 Ga0157373_10027270 3300013100 Bacteria 4121
69 Ga0157373_10043599 3300013100 Bacteria 3204
70 Ga0157371_10000627 3300013102 Bacteria 41942
71 Ga0157371_10001356 3300013102 Bacteria 25744
72 Ga0157371_10001502 3300013102 Bacteria 24121
73 Ga0157371_10007809 3300013102 Bacteria 8594
74 Ga0157370_10064179 3300013104 Bacteria 3477
75 Ga0157369_10001116 3300013105 Bacteria 33559
76 Ga0157369_10002793 3300013105 Bacteria 20845
77 Ga0157369_10004854 3300013105 Bacteria 15777
78 Ga0157369_10007474 3300013105 Bacteria 12578
79 Ga0157369_10010872 3300013105 Bacteria 10366
80 Ga0163162_10000160 3300013306 Bacteria 62335
81 Ga0157372_10001586 3300013307 Bacteria 24736
82 Ga0157375_10000930 3300013308 Bacteria 25364
83 Ga0157375_10001137 3300013308 Bacteria 23049
84 Ga0157375_10021607 3300013308 Bacteria 5905
85 Ga0182008_10000153 3300014497 Bacteria 54130
86 Ga0182008_10000544 3300014497 Bacteria 28036
87 Ga0182008_10001477 3300014497 Bacteria 15716
88 Ga0182008_10001506 3300014497 Bacteria 15547
89 Ga0182008_10001888 3300014497 Bacteria 13612
90 Ga0182006_1000196 3300015261 Bacteria 62428
91 Ga0182006_1000204 3300015261 Bacteria 59798
92 Ga0182006_1003686 3300015261 Bacteria 7766
93 Ga0182006_1008555 3300015261 Bacteria 4637
94 Ga0182006_1008801 3300015261 Bacteria 4564
95 Ga0182007_10000625 3300015262 Bacteria 20562
96 Ga0182005_1000114 3300015265 Bacteria 57889
97 Ga0163161_10000879 3300017792 Bacteria 23382
98 Ga0163161_10001080 3300017792 Bacteria 20638
99 Ga0163161_10004821 3300017792 Bacteria 9398
100 Ga0163161_10011502 3300017792 Bacteria 6141
101 Ga0163161_10023179 3300017792 Bacteria 4377
102 Ga0209435_100440 3300025206 Bacteria 8429
103 Ga0209760_100023 3300025207 Bacteria 159144
104 Ga0209760_100033 3300025207 Bacteria 136583
105 Ga0209784_100057 3300025224 Bacteria 167476
106 Ga0209566_100073 3300025225 Bacteria 167476
107 Ga0209674_100095 3300025226 Bacteria 167476
108 Ga0209147_100092 3300025229 Bacteria 167476
109 Ga0209563_100093 3300025230 Bacteria 167476
110 Ga0209563_100649 3300025230 Bacteria 11178
111 Ga0207427_100003 3300025231 Bacteria 1035004
112 Ga0207427_100018 3300025231 Bacteria 530735
113 Ga0209437_100002 3300025233 Bacteria 1574801
114 Ga0209437_100031 3300025233 Bacteria 530871
115 Ga0209258_100300 3300025242 Bacteria 80484
116 Ga0209646_1000413 3300025246 Bacteria 24436
117 Ga0209677_100054 3300025253 Bacteria 167476
118 Ga0209759_1001701 3300025256 Bacteria 11410
119 Ga0209233_1000004 3300025261 Bacteria 1574798
120 Ga0209233_1000012 3300025261 Bacteria 1019519
121 Ga0209675_1001274 3300025291 Bacteria 15065
122 Ga0209676_1000055 3300025292 Bacteria 361565
123 Ga0209676_1000062 3300025292 Bacteria 332319
124 Ga0209676_1000407 3300025292 Bacteria 77466
125 Ga0209676_1001180 3300025292 Bacteria 28279
126 Ga0209676_1001565 3300025292 Bacteria 20454
127 Ga0209050_1000079 3300025298 Bacteria 277803
128 Ga0209050_1000150 3300025298 Bacteria 162946
129 Ga0209050_1000231 3300025298 Bacteria 122373
130 Ga0209050_1000920 3300025298 Bacteria 38750
131 Ga0209051_1000054 3300025303 Bacteria 280804
132 Ga0209051_1000162 3300025303 Bacteria 125696
133 Ga0209051_1000165 3300025303 Bacteria 122373
134 Ga0209051_1006812 3300025303 Bacteria 6361
135 Ga0209257_1000483 3300025304 Bacteria 72183
136 Ga0207656_10002363 3300025321 Bacteria 6334
137 Ga0207696_1000002 3300025711 Bacteria 1098043
138 Ga0207696_1000023 3300025711 Bacteria 422195
139 Ga0207696_1000108 3300025711 Bacteria 157445
140 Ga0207696_1000161 3300025711 Bacteria 109070
141 Ga0207696_1000916 3300025711 Bacteria 18208
142 Ga0207696_1003059 3300025711 Bacteria 7801
143 Ga0207655_1000006 3300025728 Bacteria 861092
144 Ga0207655_1000085 3300025728 Bacteria 206425
145 Ga0207655_1000114 3300025728 Bacteria 164098
146 Ga0207655_1002192 3300025728 Bacteria 16211
147 Ga0207655_1004671 3300025728 Bacteria 9604
148 Ga0207655_1014631 3300025728 Bacteria 4418
149 Ga0207713_1000102 3300025735 Bacteria 139512
150 Ga0207713_1000313 3300025735 Bacteria 55095
151 Ga0207713_1000581 3300025735 Bacteria 36390
152 Ga0207713_1001194 3300025735 Bacteria 21812
153 Ga0207713_1001284 3300025735 Bacteria 20704
154 Ga0207713_1002575 3300025735 Bacteria 13100
155 Ga0207713_1009590 3300025735 Bacteria 5441
156 Ga0207671_10000561 3300025914 Bacteria 49927
157 Ga0207649_10000032 3300025920 Bacteria 143552
158 Ga0207681_10000299 3300025923 Bacteria 36494
159 Ga0207650_10000068 3300025925 Bacteria 139947
160 Ga0207650_10000259 3300025925 Bacteria 56695
161 Ga0207706_10004102 3300025933 Bacteria 13761
162 Ga0207686_10010366 3300025934 Bacteria 5074
163 Ga0207709_10000011 3300025935 Bacteria 552881
164 Ga0207709_10001540 3300025935 Bacteria 15831
165 Ga0207679_10000059 3300025945 Bacteria 101268
166 Ga0207639_10022337 3300026041 Bacteria 4557
167 Ga0209281_1000018 3300027111 Bacteria 579091
168 Ga0209281_1000320 3300027111 Bacteria 84410
169 Ga0207428_10008371 3300027907 Bacteria 9344
170 Ga0316178_1045217 3300030735 Bacteria 8711
171 Ga0307408_100000643 3300031548 Bacteria 29323
172 Ga0307408_100014161 3300031548 Bacteria 5298
173 Ga0307405_10000118 3300031731 Bacteria 31782
174 Ga0307405_10002752 3300031731 Bacteria 7876
175 Ga0307405_10005455 3300031731 Bacteria 6134
176 Ga0307413_10004849 3300031824 Bacteria 5911
177 Ga0307406_10036598 3300031901 Bacteria 3025
178 Ga0307412_10000870 3300031911 Bacteria 17357
179 Ga0307412_10001362 3300031911 Bacteria 13586
180 Ga0307412_10004723 3300031911 Bacteria 7600
181 Ga0307412_10010330 3300031911 Bacteria 5376
182 Ga0307409_100054103 3300031995 Bacteria 3089
183 Ga0307411_10014170 3300032005 Bacteria 4427
184 Ga0307510_10000942 3300033180 Bacteria 30746
185 Ga0439438_000293 3300041405 Bacteria 22448
186 Ga0439438_000301 3300041405 Bacteria 22145
187 Ga0439438_000361 3300041405 Bacteria 20332
188 Ga0439438_000422 3300041405 Bacteria 19123
189 Ga0439438_000485 3300041405 Bacteria 17984
190 Ga0439438_000542 3300041405 Bacteria 17184
191 Ga0439438_000684 3300041405 Bacteria 15198
192 Ga0439438_001715 3300041405 Bacteria 9651
193 Ga0439447_000030 3300041407 Bacteria 49948
194 Ga0439447_000150 3300041407 Bacteria 24059
195 Ga0439447_000314 3300041407 Bacteria 17399
196 Ga0439447_000344 3300041407 Bacteria 16773
197 Ga0439466_0000044 3300041411 Bacteria 49151
198 Ga0439466_0000221 3300041411 Bacteria 22462
199 Ga0439466_0000454 3300041411 Bacteria 15620
200 Ga0439466_0001484 3300041411 Bacteria 9159
201 Ga0439466_0004613 3300041411 Bacteria 5294
202 Ga0439432_000084 3300042006 Bacteria 29253
203 Ga0439432_003335 3300042006 Bacteria 5965
204 Ga0439452_000098 3300042010 Bacteria 73779
205 Ga0439452_000221 3300042010 Bacteria 40244
206 Ga0439452_000411 3300042010 Bacteria 25146
207 Ga0439452_000417 3300042010 Bacteria 24852
208 Ga0439452_001041 3300042010 Bacteria 12262
209 Ga0439452_003099 3300042010 Bacteria 5894
210 Ga0439452_006573 3300042010 Bacteria 3633
211 Ga0439456_000067 3300042013 Bacteria 37007
212 Ga0439456_001379 3300042013 Bacteria 4863
213 Ga0439463_000007 3300042016 Bacteria 44178
214 Ga0439463_000123 3300042016 Bacteria 19502
215 Ga0450911_000491 3300042115 Bacteria 12581
216 Ga0450911_000528 3300042115 Bacteria 12058
217 Ga0450911_001293 3300042115 Bacteria 5945
218 Ga0450920_002980 3300042122 Bacteria 2915
219 Ga0450890_000184 3300042127 Bacteria 9474
220 Ga0450903_000914 3300042138 Bacteria 5662
221 Ga0450903_001189 3300042138 Bacteria 4904
222 Ga0450907_000051 3300042146 Bacteria 49159
223 Ga0450907_004285 3300042146 Bacteria 2465
224 Ga0439446_0001954 3300042156 Bacteria 4858
225 Ga0450908_001635 3300042184 Bacteria 4359
226 Ga0439434_0000099 3300042435 Bacteria 22061
227 Ga0450901_000277 3300042533 Bacteria 6248
228 Ga0439440_0002565 3300042993 Bacteria 3440
229 Ga0495617_000680 3300046452 Bacteria 17010
230 Ga0495617_000753 3300046452 Bacteria 15874
231 Ga0495617_003142 3300046452 Bacteria 6286
232 Ga0495617_004223 3300046452 Bacteria 5251
233 Ga0495617_006186 3300046452 Bacteria 4212
234 Ga0495627_000040 3300046453 Bacteria 195248
235 Ga0495627_000137 3300046453 Bacteria 87495
236 Ga0495627_000717 3300046453 Bacteria 25223
237 Ga0495627_000779 3300046453 Bacteria 23541
238 Ga0495627_001112 3300046453 Bacteria 17471
239 Ga0495627_008328 3300046453 Bacteria 3899
240 Ga0495627_010140 3300046453 Bacteria 3439
241 Ga0495592_0002034 3300046454 Bacteria 14238
242 Ga0495603_0005081 3300046455 Bacteria 7860
243 Ga0495603_0007162 3300046455 Bacteria 6698
244 Ga0495603_0011746 3300046455 Bacteria 5299
245 Ga0495590_0000617 3300046457 Bacteria 16575
246 Ga0495590_0000828 3300046457 Bacteria 14007
247 Ga0495590_0011298 3300046457 Bacteria 3341
248 Ga0495591_000023 3300046458 Bacteria 191598
249 Ga0495591_000121 3300046458 Bacteria 84919
250 Ga0495591_000374 3300046458 Bacteria 37971
251 Ga0495591_000602 3300046458 Bacteria 27259
252 Ga0495591_000680 3300046458 Bacteria 24850
253 Ga0495591_000883 3300046458 Bacteria 21048
254 Ga0495591_001537 3300046458 Bacteria 14147
255 Ga0495591_001611 3300046458 Bacteria 13651
256 Ga0495591_001776 3300046458 Bacteria 12780
257 Ga0495591_002577 3300046458 Bacteria 9968
258 Ga0495591_003036 3300046458 Bacteria 8933
259 Ga0495591_004449 3300046458 Bacteria 6869
260 Ga0495591_009603 3300046458 Bacteria 3827
261 Ga0495591_012387 3300046458 Bacteria 3179
262 Ga0495638_0000863 3300046460 Bacteria 31475
263 Ga0495638_0000866 3300046460 Bacteria 31458
264 Ga0495638_0001203 3300046460 Bacteria 24737
265 Ga0495638_0002533 3300046460 Bacteria 14858
266 Ga0495638_0006333 3300046460 Bacteria 8625
267 Ga0495638_0016361 3300046460 Bacteria 4969
268 Ga0495638_0019834 3300046460 Bacteria 4445
269 Ga0495638_0042032 3300046460 Bacteria 2889
270 Ga0495653_0001725 3300046463 Bacteria 17228
271 Ga0495653_0004101 3300046463 Bacteria 11780
272 Ga0495653_0004352 3300046463 Bacteria 11455
273 Ga0495653_0038108 3300046463 Bacteria 3773
274 Ga0495653_0088730 3300046463 Bacteria 2267
275 Ga0495650_0001031 3300046471 Bacteria 31301
276 Ga0495650_0001290 3300046471 Bacteria 25556
277 Ga0495650_0003268 3300046471 Bacteria 12012
278 Ga0495650_0003921 3300046471 Bacteria 10490
279 Ga0495650_0011448 3300046471 Bacteria 4857
280 Ga0495650_0021035 3300046471 Bacteria 3163
281 Ga0495650_0021550 3300046471 Bacteria 3110
282 Ga0495605_0000048 3300046474 Bacteria 170182
283 Ga0495605_0000094 3300046474 Bacteria 112717
284 Ga0495605_0000245 3300046474 Bacteria 64374
285 Ga0495605_0000291 3300046474 Bacteria 55348
286 Ga0495605_0000540 3300046474 Bacteria 31251
287 Ga0495605_0000819 3300046474 Bacteria 22153
288 Ga0495605_0001092 3300046474 Bacteria 18070
289 Ga0495605_0002324 3300046474 Bacteria 11849
290 Ga0495605_0003619 3300046474 Bacteria 9169
291 Ga0495605_0007563 3300046474 Bacteria 6161
292 Ga0495605_0008610 3300046474 Bacteria 5763
293 Ga0495605_0010265 3300046474 Bacteria 5244
294 Ga0495605_0021314 3300046474 Bacteria 3434
295 Ga0495605_0022598 3300046474 Bacteria 3319
296 Ga0495584_0000399 3300046491 Bacteria 29968
297 Ga0495584_0000404 3300046491 Bacteria 29798
298 Ga0495584_0000586 3300046491 Bacteria 24569
299 Ga0495584_0001339 3300046491 Bacteria 14915
300 Ga0495584_0002533 3300046491 Bacteria 10335
301 Ga0495584_0003400 3300046491 Bacteria 8777
302 Ga0495584_0006532 3300046491 Bacteria 6095
303 Ga0495584_0014937 3300046491 Bacteria 3956
304 Ga0495584_0020350 3300046491 Bacteria 3372
305 Ga0495585_0000016 3300046492 Bacteria 175433
306 Ga0495585_0000573 3300046492 Bacteria 34626
307 Ga0495585_0000728 3300046492 Bacteria 29361
308 Ga0495585_0001186 3300046492 Bacteria 21163
309 Ga0495585_0001801 3300046492 Bacteria 16286
310 Ga0495585_0002780 3300046492 Bacteria 12198
311 Ga0495585_0005166 3300046492 Bacteria 8289
312 Ga0495585_0005839 3300046492 Bacteria 7717
313 Ga0495585_0006587 3300046492 Bacteria 7180
314 Ga0495585_0006653 3300046492 Bacteria 7141
315 Ga0495585_0011754 3300046492 Bacteria 5174
316 Ga0495585_0019894 3300046492 Bacteria 3864
317 Ga0495594_0001163 3300046499 Bacteria 13760
318 Ga0495594_0002271 3300046499 Bacteria 10017
319 Ga0495594_0003085 3300046499 Bacteria 8624
320 Ga0495596_0000056 3300046500 Bacteria 81755
321 Ga0495607_0000185 3300046501 Bacteria 66759
322 Ga0495607_0000234 3300046501 Bacteria 59488
323 Ga0495607_0000384 3300046501 Bacteria 45360
324 Ga0495607_0000476 3300046501 Bacteria 40088
325 Ga0495607_0000986 3300046501 Bacteria 26290
326 Ga0495607_0001382 3300046501 Bacteria 21588
327 Ga0495607_0001919 3300046501 Bacteria 17576
328 Ga0495607_0002375 3300046501 Bacteria 15369
329 Ga0495607_0002946 3300046501 Bacteria 13373
330 Ga0495607_0003070 3300046501 Bacteria 12982
331 Ga0495607_0003722 3300046501 Bacteria 11553
332 Ga0495607_0006942 3300046501 Bacteria 7894
333 Ga0495607_0007472 3300046501 Bacteria 7559
334 Ga0495607_0007717 3300046501 Bacteria 7408
335 Ga0495607_0015411 3300046501 Bacteria 4955
336 Ga0495607_0019575 3300046501 Bacteria 4297
337 Ga0495607_0021166 3300046501 Bacteria 4095
338 Ga0495583_0000096 3300046506 Bacteria 151090
339 Ga0495583_0000387 3300046506 Bacteria 67820
340 Ga0495583_0000540 3300046506 Bacteria 53188
341 Ga0495583_0001059 3300046506 Bacteria 30793
342 Ga0495583_0002874 3300046506 Bacteria 13969
343 Ga0495583_0002888 3300046506 Bacteria 13904
344 Ga0495583_0004286 3300046506 Bacteria 10327
345 Ga0495583_0007621 3300046506 Bacteria 6757
346 Ga0495583_0009297 3300046506 Bacteria 5887
347 Ga0495583_0012328 3300046506 Bacteria 4846
348 Ga0495606_0000167 3300046507 Bacteria 115739
349 Ga0495606_0001446 3300046507 Bacteria 31847
350 Ga0495606_0001484 3300046507 Bacteria 31212
351 Ga0495606_0002351 3300046507 Bacteria 22217
352 Ga0495606_0002412 3300046507 Bacteria 21830
353 Ga0495606_0002769 3300046507 Bacteria 19628
354 Ga0495606_0002977 3300046507 Bacteria 18626
355 Ga0495606_0004429 3300046507 Bacteria 14042
356 Ga0495606_0007966 3300046507 Bacteria 9325
357 Ga0495606_0008379 3300046507 Bacteria 8997
358 Ga0495606_0010712 3300046507 Bacteria 7564
359 Ga0495610_0000653 3300046512 Bacteria 33834
360 Ga0495610_0000661 3300046512 Bacteria 33537
361 Ga0495610_0002742 3300046512 Bacteria 14481
362 Ga0495610_0003790 3300046512 Bacteria 11531
363 Ga0495610_0003827 3300046512 Bacteria 11464
364 Ga0495610_0011390 3300046512 Bacteria 5441
365 Ga0495610_0012866 3300046512 Bacteria 5004
366 Ga0495610_0013096 3300046512 Bacteria 4945
367 Ga0495610_0018470 3300046512 Bacteria 3936
368 Ga0495610_0019340 3300046512 Bacteria 3815
369 Ga0495610_0024372 3300046512 Bacteria 3266
370 Ga0495616_0000608 3300046513 Bacteria 26998
371 Ga0495616_0000766 3300046513 Bacteria 23496
372 Ga0495616_0000828 3300046513 Bacteria 22582
373 Ga0495616_0001062 3300046513 Bacteria 19627
374 Ga0495616_0001072 3300046513 Bacteria 19416
375 Ga0495616_0001572 3300046513 Bacteria 15709
376 Ga0495620_0000001 3300046515 Bacteria 386508
377 Ga0495620_0000346 3300046515 Bacteria 32234
378 Ga0495620_0000578 3300046515 Bacteria 23002
379 Ga0495620_0000622 3300046515 Bacteria 22053
380 Ga0495620_0001067 3300046515 Bacteria 16797
381 Ga0495620_0001186 3300046515 Bacteria 15953
382 Ga0495620_0001539 3300046515 Bacteria 13713
383 Ga0495620_0002478 3300046515 Bacteria 10699
384 Ga0495620_0003199 3300046515 Bacteria 9400
385 Ga0495620_0003624 3300046515 Bacteria 8813
386 Ga0495620_0007173 3300046515 Bacteria 6073
387 Ga0495620_0010605 3300046515 Bacteria 4853
388 Ga0495620_0015139 3300046515 Bacteria 3901
389 Ga0495620_0017045 3300046515 Bacteria 3631
390 Ga0495628_0012033 3300046516 Bacteria 7297
391 Ga0495630_0010976 3300046517 Bacteria 6549
392 Ga0495631_0000412 3300046518 Bacteria 29545
393 Ga0495631_0001024 3300046518 Bacteria 17367
394 Ga0495631_0001633 3300046518 Bacteria 13379
395 Ga0495631_0003157 3300046518 Bacteria 9065
396 Ga0495631_0008356 3300046518 Bacteria 5217
397 Ga0495631_0028509 3300046518 Bacteria 2546
398 Ga0495632_0000676 3300046519 Bacteria 31107
399 Ga0495632_0000933 3300046519 Bacteria 25639
400 Ga0495632_0001632 3300046519 Bacteria 18392
401 Ga0495632_0002645 3300046519 Bacteria 13462
402 Ga0495632_0003477 3300046519 Bacteria 11140
403 Ga0495632_0003748 3300046519 Bacteria 10633
404 Ga0495632_0004501 3300046519 Bacteria 9447
405 Ga0495632_0005142 3300046519 Bacteria 8732
406 Ga0495632_0006133 3300046519 Bacteria 7790
407 Ga0495632_0008892 3300046519 Bacteria 6103
408 Ga0495632_0008950 3300046519 Bacteria 6074
409 Ga0495632_0009751 3300046519 Bacteria 5757
410 Ga0495632_0018218 3300046519 Bacteria 3858
411 Ga0495632_0019041 3300046519 Bacteria 3748
412 Ga0495632_0021350 3300046519 Bacteria 3490
413 Ga0495637_0000115 3300046520 Bacteria 58484
414 Ga0495637_0000134 3300046520 Bacteria 55462
415 Ga0495637_0000437 3300046520 Bacteria 30389
416 Ga0495637_0000671 3300046520 Bacteria 23799
417 Ga0495637_0000957 3300046520 Bacteria 18433
418 Ga0495637_0001931 3300046520 Bacteria 11762
419 Ga0495637_0002379 3300046520 Bacteria 10426
420 Ga0495637_0004345 3300046520 Bacteria 7354
421 Ga0495637_0004730 3300046520 Bacteria 7026
422 Ga0495637_0006284 3300046520 Bacteria 5977
423 Ga0495637_0006313 3300046520 Bacteria 5963
424 Ga0495637_0018177 3300046520 Bacteria 3265
425 Ga0495643_0001468 3300046522 Bacteria 21558
426 Ga0495643_0002308 3300046522 Bacteria 15389
427 Ga0495643_0004573 3300046522 Bacteria 9631
428 Ga0495643_0009900 3300046522 Bacteria 5894
429 Ga0495643_0012233 3300046522 Bacteria 5182
430 Ga0495644_0000240 3300046523 Bacteria 25809
431 Ga0495644_0000254 3300046523 Bacteria 24599
432 Ga0495644_0011678 3300046523 Bacteria 3381
433 Ga0495648_0000585 3300046524 Bacteria 39042
434 Ga0495648_0001289 3300046524 Bacteria 24984
435 Ga0495648_0001791 3300046524 Bacteria 20663
436 Ga0495648_0001832 3300046524 Bacteria 20450
437 Ga0495648_0002294 3300046524 Bacteria 17847
438 Ga0495648_0002558 3300046524 Bacteria 16666
439 Ga0495648_0005559 3300046524 Bacteria 10454
440 Ga0495648_0007982 3300046524 Bacteria 8397
441 Ga0495648_0010168 3300046524 Bacteria 7195
442 Ga0495648_0015825 3300046524 Bacteria 5452
443 Ga0495648_0025846 3300046524 Bacteria 3965
444 Ga0495648_0030467 3300046524 Bacteria 3566
445 Ga0495666_0000146 3300046526 Bacteria 29741
446 Ga0495642_0000030 3300046528 Bacteria 89032
447 Ga0495642_0000419 3300046528 Bacteria 22623
448 Ga0495642_0001771 3300046528 Bacteria 9310
449 Ga0495652_0071822 3300046529 Bacteria 2887
450 Ga0495654_0000166 3300046530 Bacteria 64935
451 Ga0495654_0000545 3300046530 Bacteria 30346
452 Ga0495654_0001158 3300046530 Bacteria 18860
453 Ga0495654_0001616 3300046530 Bacteria 15253
454 Ga0495654_0002063 3300046530 Bacteria 13187
455 Ga0495654_0002136 3300046530 Bacteria 12904
456 Ga0495654_0003356 3300046530 Bacteria 9863
457 Ga0495654_0004479 3300046530 Bacteria 8279
458 Ga0495654_0011954 3300046530 Bacteria 4679
459 Ga0495654_0016664 3300046530 Bacteria 3875
460 Ga0495587_0001087 3300046536 Bacteria 17851
461 Ga0495587_0009839 3300046536 Bacteria 6107
462 Ga0495609_0000012 3300046538 Bacteria 333994
463 Ga0495609_0000167 3300046538 Bacteria 68911
464 Ga0495609_0000259 3300046538 Bacteria 49945
465 Ga0495609_0000516 3300046538 Bacteria 31142
466 Ga0495609_0001015 3300046538 Bacteria 19951
467 Ga0495609_0002648 3300046538 Bacteria 10853
468 Ga0495609_0016766 3300046538 Bacteria 3411
469 Ga0495597_0000016 3300046542 Bacteria 167456
470 Ga0495597_0000935 3300046542 Bacteria 22608
471 Ga0495597_0001278 3300046542 Bacteria 18547
472 Ga0495597_0001752 3300046542 Bacteria 14937
473 Ga0495645_0011624 3300046543 Bacteria 6201
474 Ga0495622_0000442 3300046557 Bacteria 26797
475 Ga0495622_0001398 3300046557 Bacteria 12252
476 Ga0495622_0001451 3300046557 Bacteria 11939
477 Ga0495622_0004053 3300046557 Bacteria 6837
478 Ga0495622_0006931 3300046557 Bacteria 5261
479 Ga0495633_0000034 3300046558 Bacteria 185552
480 Ga0495633_0001148 3300046558 Bacteria 21253
481 Ga0495633_0001544 3300046558 Bacteria 17674
482 Ga0495656_0005899 3300046615 Bacteria 4260
483 Ga0495668_0001309 3300046616 Bacteria 24541
484 Ga0495668_0001799 3300046616 Bacteria 19553
485 Ga0495668_0004994 3300046616 Bacteria 9166
486 Ga0495668_0008942 3300046616 Bacteria 6190
487 Ga0495668_0010523 3300046616 Bacteria 5594
488 Ga0495634_0000895 3300046642 Bacteria 28607
489 Ga0495611_0000520 3300046648 Bacteria 22902
490 Ga0495611_0000948 3300046648 Bacteria 15535
491 Ga0495611_0001788 3300046648 Bacteria 10349
492 Ga0495611_0004324 3300046648 Bacteria 6164
493 Ga0495611_0004820 3300046648 Bacteria 5799
494 Ga0495625_0000134 3300046660 Bacteria 115073
495 Ga0495625_0001917 3300046660 Bacteria 23514
496 Ga0495625_0002078 3300046660 Bacteria 22425
497 Ga0495625_0002135 3300046660 Bacteria 22023
498 Ga0495625_0018969 3300046660 Bacteria 5352
499 Ga0495625_0021557 3300046660 Bacteria 4958
500 Ga0495625_0038111 3300046660 Bacteria 3520
501 Ga0495625_0044933 3300046660 Bacteria 3196
502 Ga0495635_0001544 3300046663 Bacteria 15435
503 Ga0495635_0001565 3300046663 Bacteria 15358
504 Ga0495659_0000081 3300046664 Bacteria 41113
505 Ga0495661_0000004 3300046665 Bacteria 555340
506 Ga0495661_0000030 3300046665 Bacteria 171980
507 Ga0495661_0000088 3300046665 Bacteria 111782
508 Ga0495661_0000692 3300046665 Bacteria 33517
509 Ga0495661_0000896 3300046665 Bacteria 27460
510 Ga0495661_0001895 3300046665 Bacteria 16690
511 Ga0495661_0003936 3300046665 Bacteria 10849
512 Ga0495661_0005454 3300046665 Bacteria 9025
513 Ga0495661_0011952 3300046665 Bacteria 5876
514 Ga0495661_0013930 3300046665 Bacteria 5392
515 Ga0495661_0014090 3300046665 Bacteria 5357
516 Ga0495588_0002797 3300046674 Bacteria 7498
517 Ga0495623_0001124 3300046679 Bacteria 18068
518 Ga0495623_0002784 3300046679 Bacteria 11539
519 Ga0495646_0003001 3300046680 Bacteria 10468
520 Ga0495646_0005182 3300046680 Bacteria 8221
521 Ga0495646_0006595 3300046680 Bacteria 7364
522 Ga0495669_0000311 3300046684 Bacteria 26905
523 Ga0495624_0000246 3300046690 Bacteria 42607
524 Ga0495670_0000240 3300046691 Bacteria 25262
525 Ga0495670_0000578 3300046691 Bacteria 17520
526 Ga0495670_0001618 3300046691 Bacteria 11037
527 Ga0495670_0004434 3300046691 Bacteria 6885
528 Ga0495670_0004494 3300046691 Bacteria 6835
529 Ga0495670_0005903 3300046691 Bacteria 5994
530 Ga0495670_0009221 3300046691 Bacteria 4853
531 Ga0495670_0009626 3300046691 Bacteria 4747
532 Ga0495670_0013493 3300046691 Bacteria 4019
533 Ga0495670_0017620 3300046691 Bacteria 3517
534 Ga0495671_0000289 3300046692 Bacteria 42005
535 Ga0495671_0000399 3300046692 Bacteria 35329
536 Ga0495671_0000852 3300046692 Bacteria 21808
537 Ga0495671_0000981 3300046692 Bacteria 19921
538 Ga0495671_0003292 3300046692 Bacteria 9992
539 Ga0495671_0007768 3300046692 Bacteria 6077
540 Ga0495671_0008182 3300046692 Bacteria 5901
541 Ga0495671_0008861 3300046692 Bacteria 5650
542 Ga0495671_0012279 3300046692 Bacteria 4681
543 Ga0495671_0015271 3300046692 Bacteria 4119
544 Ga0495671_0017467 3300046692 Bacteria 3819
545 Ga0495671_0017702 3300046692 Bacteria 3790
546 Ga0495671_0036457 3300046692 Bacteria 2490
547 Ga0495671_0037045 3300046692 Bacteria 2468
548 Ga0495649_0000719 3300046694 Bacteria 26925
549 Ga0495649_0000852 3300046694 Bacteria 24527
550 Ga0495649_0000876 3300046694 Bacteria 24155
551 Ga0495649_0001220 3300046694 Bacteria 19804
552 Ga0495649_0004127 3300046694 Bacteria 9538
553 Ga0495649_0012248 3300046694 Bacteria 4999
554 Ga0495649_0012561 3300046694 Bacteria 4919
555 Ga0495649_0014236 3300046694 Bacteria 4566
556 Ga0495649_0016899 3300046694 Bacteria 4129
557 Ga0495649_0018590 3300046694 Bacteria 3908
558 Ga0495649_0031319 3300046694 Bacteria 2933
559 Ga0495589_0000482 3300046794 Bacteria 28591
560 Ga0495589_0001445 3300046794 Bacteria 13698
561 Ga0495589_0001685 3300046794 Bacteria 12641
562 Ga0495589_0002256 3300046794 Bacteria 10833
563 Ga0495589_0002303 3300046794 Bacteria 10737
564 Ga0495589_0004256 3300046794 Bacteria 7657
565 Ga0495589_0009061 3300046794 Bacteria 5173
566 Ga0495589_0012465 3300046794 Bacteria 4401
567 Ga0495600_0034312 3300046809 Bacteria 3293
568 Ga0495660_0000807 3300046810 Bacteria 23454
569 Ga0495660_0000814 3300046810 Bacteria 23293
570 Ga0495660_0000815 3300046810 Bacteria 23286
571 Ga0495660_0001803 3300046810 Bacteria 14101
572 Ga0495660_0002903 3300046810 Bacteria 10748
573 Ga0495660_0004211 3300046810 Bacteria 8739
574 Ga0495660_0005098 3300046810 Bacteria 7892
575 Ga0495660_0008917 3300046810 Bacteria 5860
576 Ga0495660_0014479 3300046810 Bacteria 4561
577 Ga0495660_0017891 3300046810 Bacteria 4076
578 Ga0495660_0027758 3300046810 Bacteria 3200
579 Ga0495660_0029467 3300046810 Bacteria 3096
580 Ga0495660_0039506 3300046810 Bacteria 2620
581 Ga0495581_0001429 3300047315 Bacteria 13252
582 Ga0495604_0002090 3300047317 Bacteria 16070
583 Ga0495604_0002459 3300047317 Bacteria 14813
584 Ga0495674_0006644 3300047319 Bacteria 11081
585 Ga0495672_0000548 3300047320 Bacteria 42693
586 Ga0495672_0000946 3300047320 Bacteria 30288
587 Ga0495672_0001020 3300047320 Bacteria 28796
588 Ga0495672_0001030 3300047320 Bacteria 28638
589 Ga0495672_0002300 3300047320 Bacteria 17724
590 Ga0495672_0003248 3300047320 Bacteria 14107
591 Ga0495672_0004110 3300047320 Bacteria 12116
592 Ga0495672_0004808 3300047320 Bacteria 10895
593 Ga0495672_0008632 3300047320 Bacteria 7495
594 Ga0495672_0008637 3300047320 Bacteria 7492
595 Ga0495672_0011641 3300047320 Bacteria 6194
596 Ga0495672_0016270 3300047320 Bacteria 5019
597 Ga0495672_0021768 3300047320 Bacteria 4176
598 Ga0495672_0032895 3300047320 Bacteria 3218
599 Ga0495676_0000018 3300047321 Bacteria 178380
600 Ga0495676_0002166 3300047321 Bacteria 17389
601 Ga0495676_0003503 3300047321 Bacteria 14212
602 Ga0495680_0001365 3300047322 Bacteria 26492
603 Ga0495680_0002276 3300047322 Bacteria 19767
604 Ga0495680_0022614 3300047322 Bacteria 5237
605 Ga0495680_0041726 3300047322 Bacteria 3646
606 Ga0495683_0000018 3300047323 Bacteria 185871
607 Ga0495683_0000034 3300047323 Bacteria 148959
608 Ga0495683_0000118 3300047323 Bacteria 79578
609 Ga0495683_0000640 3300047323 Bacteria 26040
610 Ga0495683_0001726 3300047323 Bacteria 13845
611 Ga0495683_0002143 3300047323 Bacteria 12161
612 Ga0495683_0004680 3300047323 Bacteria 7708
613 Ga0495683_0005370 3300047323 Bacteria 7114
614 Ga0495683_0005758 3300047323 Bacteria 6827
615 Ga0495683_0007386 3300047323 Bacteria 5952
616 Ga0495687_002214 3300047443 Bacteria 16072
617 Ga0495687_005600 3300047443 Bacteria 7951
618 Ga0495687_013475 3300047443 Bacteria 4264
619 Ga0495687_015096 3300047443 Bacteria 3941
620 Ga0495675_0001178 3300047444 Bacteria 15848
621 Ga0495677_0000389 3300047445 Bacteria 18832
622 Ga0495679_000039 3300047446 Bacteria 149640
623 Ga0495679_000497 3300047446 Bacteria 27852
624 Ga0495679_000571 3300047446 Bacteria 25561
625 Ga0495679_000659 3300047446 Bacteria 22925
626 Ga0495679_000717 3300047446 Bacteria 21400
627 Ga0495679_000811 3300047446 Bacteria 19848
628 Ga0495679_001183 3300047446 Bacteria 15508
629 Ga0495679_004918 3300047446 Bacteria 6028
630 Ga0495673_0000254 3300047469 Bacteria 74340
631 Ga0495673_0001002 3300047469 Bacteria 24995
632 Ga0495673_0001352 3300047469 Bacteria 19875
633 Ga0495673_0002013 3300047469 Bacteria 14940
634 Ga0495673_0002769 3300047469 Bacteria 11992
635 Ga0495673_0002900 3300047469 Bacteria 11635
636 Ga0495673_0003509 3300047469 Bacteria 10317
637 Ga0495673_0004057 3300047469 Bacteria 9327
638 Ga0495673_0004412 3300047469 Bacteria 8806
639 Ga0495673_0004990 3300047469 Bacteria 8155
640 Ga0495673_0008006 3300047469 Bacteria 5988
641 Ga0495673_0009119 3300047469 Bacteria 5508
642 Ga0495673_0011409 3300047469 Bacteria 4777
643 Ga0495673_0012398 3300047469 Bacteria 4524
644 Ga0495673_0013641 3300047469 Bacteria 4255
645 Ga0495673_0015327 3300047469 Bacteria 3952
646 Ga0495681_0000475 3300047470 Bacteria 30752
647 Ga0495681_0000576 3300047470 Bacteria 28018
648 Ga0495681_0000811 3300047470 Bacteria 24117
649 Ga0495681_0000916 3300047470 Bacteria 22785
650 Ga0495681_0000987 3300047470 Bacteria 21798
651 Ga0495681_0001530 3300047470 Bacteria 17258
652 Ga0495681_0001839 3300047470 Bacteria 15591
653 Ga0495681_0002615 3300047470 Bacteria 12791
654 Ga0495681_0003442 3300047470 Bacteria 11011
655 Ga0495681_0003855 3300047470 Bacteria 10369
656 Ga0495681_0004360 3300047470 Bacteria 9674
657 Ga0495681_0004725 3300047470 Bacteria 9231
658 Ga0495681_0004899 3300047470 Bacteria 9047
659 Ga0495681_0005432 3300047470 Bacteria 8532
660 Ga0495681_0009722 3300047470 Bacteria 5894
661 Ga0495681_0009773 3300047470 Bacteria 5872
662 Ga0495681_0015872 3300047470 Bacteria 4250
663 Ga0495681_0021303 3300047470 Bacteria 3496
664 Ga0495684_0021727 3300047471 Bacteria 4941
665 Ga0495686_0000919 3300047472 Bacteria 36947
666 Ga0495686_0004717 3300047472 Bacteria 11039
667 Ga0495686_0007273 3300047472 Bacteria 8326
668 Ga0495593_0000675 3300047673 Bacteria 19661
669 Ga0495593_0025237 3300047673 Bacteria 3290
670 Ga0495602_0001096 3300048088 Bacteria 26568
671 Ga0495626_0000216 3300048091 Bacteria 68946
672 Ga0495626_0000236 3300048091 Bacteria 64189
673 Ga0495626_0000467 3300048091 Bacteria 41237
674 Ga0495626_0000491 3300048091 Bacteria 39819
675 Ga0495626_0000606 3300048091 Bacteria 35033
676 Ga0495626_0001472 3300048091 Bacteria 18594
677 Ga0495626_0002336 3300048091 Bacteria 13375
678 Ga0495626_0004812 3300048091 Bacteria 8141
679 Ga0495626_0012142 3300048091 Bacteria 4528
680 Ga0496102_0000496 3300048905 Bacteria 43468
681 Ga0496103_0002367 3300048906 Bacteria 11887
682 Ga0496110_0056473 3300048913 Bacteria 3455
683 Ga0496116_0000046 3300048919 Bacteria 323643
684 Ga0496116_0000650 3300048919 Bacteria 45445
685 Ga0496116_0001028 3300048919 Bacteria 34090
686 Ga0496116_0002222 3300048919 Bacteria 20652
687 Ga0496116_0002592 3300048919 Bacteria 18820
688 Ga0496117_0000621 3300048920 Bacteria 57424
689 Ga0496117_0001466 3300048920 Bacteria 33965
690 Ga0496117_0002827 3300048920 Bacteria 21120
691 Ga0496117_0004579 3300048920 Bacteria 15125
692 Ga0496117_0006300 3300048920 Bacteria 12070
693 Ga0496118_0003256 3300048921 Bacteria 20695
694 Ga0496118_0025087 3300048921 Bacteria 5124
695 Ga0496118_0039289 3300048921 Bacteria 3778
696 Ga0496118_0042119 3300048921 Bacteria 3606
697 Ga0496118_0045106 3300048921 Bacteria 3445
698 Ga0496119_0005391 3300048922 Bacteria 12283
699 Ga0496119_0012038 3300048922 Bacteria 7073
700 Ga0496120_0002592 3300048923 Bacteria 17976
701 Ga0496120_0003163 3300048923 Bacteria 15352
702 Ga0496121_0000284 3300048924 Bacteria 105597
703 Ga0496121_0005555 3300048924 Bacteria 16105
704 Ga0496121_0006810 3300048924 Bacteria 13997
705 Ga0496121_0008407 3300048924 Bacteria 12156
706 Ga0496121_0019936 3300048924 Bacteria 6673
707 Ga0496122_0001312 3300048925 Bacteria 40795
708 Ga0496122_0004810 3300048925 Bacteria 16495
709 Ga0496122_0005852 3300048925 Bacteria 14422
710 Ga0496122_0006687 3300048925 Bacteria 13128
711 Ga0496122_0022983 3300048925 Bacteria 5518
712 Ga0496122_0061700 3300048925 Bacteria 2749
713 Ga0496123_0002229 3300048926 Bacteria 24578
714 Ga0496123_0002638 3300048926 Bacteria 21727
715 Ga0496123_0004572 3300048926 Bacteria 14424
716 Ga0496123_0005771 3300048926 Bacteria 12304
717 Ga0496123_0034060 3300048926 Bacteria 3655
718 Ga0496123_0057804 3300048926 Bacteria 2521
719 Ga0496124_0000718 3300048927 Bacteria 54253
720 Ga0496124_0001537 3300048927 Bacteria 33519
721 Ga0496124_0003911 3300048927 Bacteria 17803
722 Ga0496124_0004132 3300048927 Bacteria 17149
723 Ga0496124_0004687 3300048927 Bacteria 15804
724 Ga0496124_0006277 3300048927 Bacteria 12997
725 Ga0496124_0016348 3300048927 Bacteria 7059
726 Ga0496124_0018426 3300048927 Bacteria 6538
727 Ga0496124_0034700 3300048927 Bacteria 4422
728 Ga0496124_0066746 3300048927 Bacteria 2995
729 Ga0496125_0000511 3300048928 Bacteria 67384
730 Ga0496125_0000842 3300048928 Bacteria 49253
731 Ga0496125_0002577 3300048928 Bacteria 23320
732 Ga0496125_0014620 3300048928 Bacteria 7632
733 Ga0496125_0019465 3300048928 Bacteria 6401
734 Ga0496125_0026940 3300048928 Bacteria 5220
735 Ga0496125_0051526 3300048928 Bacteria 3394
736 Ga0496126_0001228 3300048929 Bacteria 41648
737 Ga0496126_0012627 3300048929 Bacteria 8642
738 Ga0495678_000049 3300049459 Bacteria 163929
739 Ga0495678_000686 3300049459 Bacteria 31100
740 Ga0495678_001210 3300049459 Bacteria 21165
741 Ga0495678_001756 3300049459 Bacteria 16080
742 Ga0495678_002099 3300049459 Bacteria 14132
743 Ga0495678_004483 3300049459 Bacteria 8067
744 Ga0495678_004580 3300049459 Bacteria 7955
745 Ga0495678_005460 3300049459 Bacteria 7010
746 Ga0495678_011772 3300049459 Bacteria 4173
747 Ga0495678_028461 3300049459 Bacteria 2358
748 Ga0495682_0000050 3300049460 Bacteria 110280
749 Ga0495682_0001153 3300049460 Bacteria 15197
750 Ga0495682_0003306 3300049460 Bacteria 7206
751 Ga0501222_000227 3300049662 Bacteria 9738
752 Ga0500572_000228 3300053111 Bacteria 19876
753 Ga0500618_002134 3300053125 Bacteria 7803
754 Ga0500634_0000141 3300053161 Bacteria 26079
755 Ga0500634_0004166 3300053161 Bacteria 6623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0088730 Ga0495653_0088730_37_2130 675
2 3300049459 Ga0495678_028461 Ga0495678_028461_239_2347 678
3 iso_pu_bacteria 2808606385 2808977057 679
4 iso_pu_bacteria 2808606388 2808992212 679
5 iso_pu_bacteria 2512047018 2512329191 689
6 3300042122 Ga0450920_002980 Ga0450920_002980_660_2870 692
7 3300046692 Ga0495671_0036457 Ga0495671_0036457_14_2161 702
8 3300046692 Ga0495671_0037045 Ga0495671_0037045_40_2283 702
9 3300046471 Ga0495650_0021035 Ga0495650_0021035_21_2231 709
10 3300046518 Ga0495631_0028509 Ga0495631_0028509_81_2282 711
11 3300047469 Ga0495673_0004057 Ga0495673_0004057_4656_6989 729
12 3300025292 Ga0209676_1001180 Ga0209676_100118022 745
13 3300048927 Ga0496124_0034700 Ga0496124_0034700_22_2382 748
14 3300048921 Ga0496118_0042119 Ga0496118_0042119_1157_3580 751
15 3300048926 Ga0496123_0057804 Ga0496123_0057804_11_2413 751
16 3300046529 Ga0495652_0071822 Ga0495652_0071822_345_2789 753
17 3300047323 Ga0495683_0007386 Ga0495683_0007386_3496_5925 753
18 3300042006 Ga0439432_003335 Ga0439432_003335_3619_5934 757
19 3300046809 Ga0495600_0034312 Ga0495600_0034312_19_2325 757
20 3300046557 Ga0495622_0004053 Ga0495622_0004053_4394_6808 759
21 3300042146 Ga0450907_004285 Ga0450907_004285_21_2435 760
22 3300046530 Ga0495654_0001158 Ga0495654_0001158_5678_8083 760
23 3300005289 Ga0065704_10075106 Ga0065704_100751063 763
24 3300009148 Ga0105243_10014765 Ga0105243_100147654 763
25 3300046692 Ga0495671_0007768 Ga0495671_0007768_710_3181 763
26 3300048091 Ga0495626_0000467 Ga0495626_0000467_25751_28222 763
27 3300025711 Ga0207696_1000023 Ga0207696_100002333 764
28 3300009036 Ga0105244_10022491 Ga0105244_100224913 766
29 3300048924 Ga0496121_0006810 Ga0496121_0006810_9789_12260 766
30 3300009011 Ga0105251_10000806 Ga0105251_1000080622 767
31 3300025735 Ga0207713_1000102 Ga0207713_100010258 767
32 3300048925 Ga0496122_0004810 Ga0496122_0004810_4941_7421 767
33 3300048926 Ga0496123_0005771 Ga0496123_0005771_4852_7332 767
34 3300053125 Ga0500618_002134 Ga0500618_002134_2573_5047 767
35 3300053161 Ga0500634_0004166 Ga0500634_0004166_1924_4401 768
36 3300013307 Ga0157372_10001586 Ga0157372_100015867 770
37 3300046471 Ga0495650_0011448 Ga0495650_0011448_200_2659 770
38 3300046474 Ga0495605_0000048 Ga0495605_0000048_116895_119354 770
39 3300046499 Ga0495594_0002271 Ga0495594_0002271_6925_9384 770
40 3300046506 Ga0495583_0000096 Ga0495583_0000096_102992_105451 770
41 3300046512 Ga0495610_0012866 Ga0495610_0012866_203_2662 770
42 3300046538 Ga0495609_0000012 Ga0495609_0000012_105680_108139 770
43 3300046542 Ga0495597_0001752 Ga0495597_0001752_1898_4357 770
44 3300046558 Ga0495633_0000034 Ga0495633_0000034_72352_74811 770
45 3300046648 Ga0495611_0004820 Ga0495611_0004820_905_3364 770
46 3300046665 Ga0495661_0000004 Ga0495661_0000004_442550_445009 770
47 3300046691 Ga0495670_0009221 Ga0495670_0009221_1857_4316 770
48 3300046794 Ga0495589_0001685 Ga0495589_0001685_2670_5129 770
49 3300047323 Ga0495683_0000034 Ga0495683_0000034_43698_46157 770
50 3300047446 Ga0495679_000497 Ga0495679_000497_13276_15735 770
51 3300047469 Ga0495673_0002900 Ga0495673_0002900_5667_8126 770
52 3300047470 Ga0495681_0015872 Ga0495681_0015872_1407_3866 770
53 3300048919 Ga0496116_0001028 Ga0496116_0001028_17774_20245 770
54 3300048924 Ga0496121_0008407 Ga0496121_0008407_4851_7331 770
55 3300048927 Ga0496124_0004132 Ga0496124_0004132_14357_16828 770
56 3300025728 Ga0207655_1002192 Ga0207655_100219210 771
57 3300046471 Ga0495650_0003268 Ga0495650_0003268_8352_10856 771
58 3300046501 Ga0495607_0019575 Ga0495607_0019575_475_2955 771
59 3300046506 Ga0495583_0012328 Ga0495583_0012328_888_3368 771
60 3300046512 Ga0495610_0018470 Ga0495610_0018470_124_2604 771
61 3300046519 Ga0495632_0002645 Ga0495632_0002645_9229_11709 771
62 3300046665 Ga0495661_0014090 Ga0495661_0014090_1058_3538 771
63 3300046794 Ga0495589_0000482 Ga0495589_0000482_22473_24977 771
64 3300047320 Ga0495672_0004110 Ga0495672_0004110_6050_8554 771
65 3300047469 Ga0495673_0013641 Ga0495673_0013641_691_3195 771
66 3300048928 Ga0496125_0014620 Ga0496125_0014620_3987_6458 771
67 3300015261 Ga0182006_1003686 Ga0182006_10036867 772
68 3300025292 Ga0209676_1001565 Ga0209676_100156515 772
69 3300025298 Ga0209050_1000920 Ga0209050_100092036 772
70 3300025303 Ga0209051_1006812 Ga0209051_10068123 772
71 3300025711 Ga0207696_1000002 Ga0207696_100000296 772
72 3300042010 Ga0439452_001041 Ga0439452_001041_1677_4148 772
73 3300048920 Ga0496117_0006300 Ga0496117_0006300_1329_3791 772
74 3300048921 Ga0496118_0025087 Ga0496118_0025087_1432_3894 772
75 3300048927 Ga0496124_0066746 Ga0496124_0066746_53_2524 772
76 3300017792 Ga0163161_10004821 Ga0163161_100048213 773
77 3300027907 Ga0207428_10008371 Ga0207428_100083715 773
78 3300042138 Ga0450903_001189 Ga0450903_001189_2389_4860 773
79 3300046501 Ga0495607_0015411 Ga0495607_0015411_1457_3937 773
80 3300046455 Ga0495603_0011746 Ga0495603_0011746_1392_3878 774
81 3300046520 Ga0495637_0006313 Ga0495637_0006313_1722_4193 774
82 3300048921 Ga0496118_0039289 Ga0496118_0039289_1043_3523 774
83 3300048924 Ga0496121_0005555 Ga0496121_0005555_10168_12648 774
84 3300048925 Ga0496122_0022983 Ga0496122_0022983_1264_3744 774
85 3300048927 Ga0496124_0003911 Ga0496124_0003911_4882_7362 774
86 3300014497 Ga0182008_10001506 Ga0182008_100015064 775
87 3300046458 Ga0495591_000374 Ga0495591_000374_32232_34712 775
88 3300046515 Ga0495620_0000578 Ga0495620_0000578_19364_21844 775
89 3300046538 Ga0495609_0000259 Ga0495609_0000259_42087_44567 775
90 3300047469 Ga0495673_0002769 Ga0495673_0002769_7564_10044 775
91 3300048927 Ga0496124_0006277 Ga0496124_0006277_8263_10743 775
92 3300048927 Ga0496124_0016348 Ga0496124_0016348_210_2672 775
93 3300048928 Ga0496125_0000511 Ga0496125_0000511_56592_59054 775
94 3300046665 Ga0495661_0000692 Ga0495661_0000692_7674_10115 776
95 3300053161 Ga0500634_0000141 Ga0500634_0000141_16435_18876 776
96 3300013306 Ga0163162_10000160 Ga0163162_1000016037 777
97 3300046458 Ga0495591_001611 Ga0495591_001611_9649_12129 777
98 3300046458 Ga0495591_009603 Ga0495591_009603_737_3208 777
99 3300046474 Ga0495605_0000094 Ga0495605_0000094_109190_111670 777
100 3300046492 Ga0495585_0005166 Ga0495585_0005166_653_3124 777
101 3300046522 Ga0495643_0001468 Ga0495643_0001468_15387_17858 777
102 3300046694 Ga0495649_0000719 Ga0495649_0000719_21464_23944 777
103 3300047469 Ga0495673_0011409 Ga0495673_0011409_1638_4109 777
104 3300046453 Ga0495627_000040 Ga0495627_000040_53929_56409 778
105 3300046455 Ga0495603_0007162 Ga0495603_0007162_563_3067 778
106 3300046474 Ga0495605_0000540 Ga0495605_0000540_16647_19118 778
107 3300046501 Ga0495607_0000234 Ga0495607_0000234_29838_32318 778
108 3300046501 Ga0495607_0003070 Ga0495607_0003070_2278_4752 778
109 3300046506 Ga0495583_0002874 Ga0495583_0002874_6124_8604 778
110 3300046512 Ga0495610_0013096 Ga0495610_0013096_203_2662 778
111 3300046515 Ga0495620_0000001 Ga0495620_0000001_67981_70440 778
112 3300046515 Ga0495620_0000346 Ga0495620_0000346_17219_19699 778
113 3300046528 Ga0495642_0000030 Ga0495642_0000030_71346_73817 778
114 3300046691 Ga0495670_0001618 Ga0495670_0001618_5729_8233 778
115 3300046810 Ga0495660_0005098 Ga0495660_0005098_2689_5193 778
116 3300048925 Ga0496122_0005852 Ga0496122_0005852_8632_11094 778
117 3300048926 Ga0496123_0004572 Ga0496123_0004572_3497_5959 778
118 3300048928 Ga0496125_0000842 Ga0496125_0000842_7285_9747 778
119 3300049459 Ga0495678_000049 Ga0495678_000049_50864_53323 778
120 3300009092 Ga0105250_10000849 Ga0105250_100008498 779
121 3300025230 Ga0209563_100649 Ga0209563_10064911 779
122 3300041407 Ga0439447_000344 Ga0439447_000344_695_3166 779
123 3300046474 Ga0495605_0008610 Ga0495605_0008610_3269_5749 779
124 3300046491 Ga0495584_0000404 Ga0495584_0000404_7221_9728 779
125 3300046506 Ga0495583_0007621 Ga0495583_0007621_1423_3930 779
126 3300047470 Ga0495681_0000916 Ga0495681_0000916_15357_17828 779
127 3300006946 Ga0079104_1000469 Ga0079104_100046935 780
128 3300009092 Ga0105250_10005489 Ga0105250_100054893 780
129 3300014497 Ga0182008_10001888 Ga0182008_100018884 780
130 3300025711 Ga0207696_1003059 Ga0207696_10030598 780
131 3300027111 Ga0209281_1000320 Ga0209281_100032028 780
132 3300042010 Ga0439452_000411 Ga0439452_000411_20451_22955 780
133 3300046458 Ga0495591_000602 Ga0495591_000602_21004_23475 780
134 3300046458 Ga0495591_003036 Ga0495591_003036_6056_8527 780
135 3300046491 Ga0495584_0006532 Ga0495584_0006532_1325_3796 780
136 3300046515 Ga0495620_0002478 Ga0495620_0002478_794_3265 780
137 3300046520 Ga0495637_0018177 Ga0495637_0018177_550_3021 780
138 3300046522 Ga0495643_0004573 Ga0495643_0004573_5547_8018 780
139 3300046538 Ga0495609_0016766 Ga0495609_0016766_508_2979 780
140 3300046542 Ga0495597_0000935 Ga0495597_0000935_1581_4052 780
141 3300046557 Ga0495622_0001398 Ga0495622_0001398_4395_6866 780
142 3300046558 Ga0495633_0001148 Ga0495633_0001148_1556_4027 780
143 3300046660 Ga0495625_0044933 Ga0495625_0044933_438_2909 780
144 3300046810 Ga0495660_0002903 Ga0495660_0002903_3591_6062 780
145 3300047320 Ga0495672_0021768 Ga0495672_0021768_1577_4048 780
146 3300047469 Ga0495673_0003509 Ga0495673_0003509_6277_8748 780
147 3300047470 Ga0495681_0005432 Ga0495681_0005432_4773_7244 780
148 3300047472 Ga0495686_0004717 Ga0495686_0004717_3714_6185 780
149 3300048919 Ga0496116_0002592 Ga0496116_0002592_9344_11815 780
150 3300048921 Ga0496118_0045106 Ga0496118_0045106_417_2888 780
151 3300049459 Ga0495678_002099 Ga0495678_002099_1342_3813 780
152 3300049459 Ga0495678_005460 Ga0495678_005460_3881_6352 780
153 3300012498 Ga0157345_1000107 Ga0157345_10001076 781
154 3300013100 Ga0157373_10005893 Ga0157373_100058937 781
155 3300013105 Ga0157369_10002793 Ga0157369_100027934 781
156 3300046471 Ga0495650_0003921 Ga0495650_0003921_5783_8287 781
157 3300046474 Ga0495605_0002324 Ga0495605_0002324_3594_6098 781
158 3300046501 Ga0495607_0000986 Ga0495607_0000986_5762_8266 781
159 3300046513 Ga0495616_0001072 Ga0495616_0001072_1605_4076 781
160 3300046515 Ga0495620_0001186 Ga0495620_0001186_5137_7641 781
161 3300046519 Ga0495632_0021350 Ga0495632_0021350_703_3174 781
162 3300046524 Ga0495648_0002294 Ga0495648_0002294_1563_4034 781
163 3300046524 Ga0495648_0015825 Ga0495648_0015825_431_2935 781
164 3300046558 Ga0495633_0001544 Ga0495633_0001544_9864_12368 781
165 3300046660 Ga0495625_0001917 Ga0495625_0001917_4639_7143 781
166 3300046694 Ga0495649_0012561 Ga0495649_0012561_2479_4893 781
167 3300046794 Ga0495589_0009061 Ga0495589_0009061_1886_4390 781
168 3300046810 Ga0495660_0000814 Ga0495660_0000814_5917_8388 781
169 3300047323 Ga0495683_0000118 Ga0495683_0000118_55924_58428 781
170 3300047470 Ga0495681_0004725 Ga0495681_0004725_6263_8767 781
171 3300048928 Ga0496125_0051526 Ga0496125_0051526_296_2800 781
172 3300049459 Ga0495678_004580 Ga0495678_004580_4235_6706 781
173 3300005288 Ga0065714_10003089 Ga0065714_100030892 782
174 3300005289 Ga0065704_10071193 Ga0065704_1007119310 782
175 3300025711 Ga0207696_1000161 Ga0207696_100016155 782
176 3300041405 Ga0439438_000293 Ga0439438_000293_17769_20273 782
177 3300041407 Ga0439447_000314 Ga0439447_000314_983_3487 782
178 3300041411 Ga0439466_0000221 Ga0439466_0000221_12085_14589 782
179 3300046452 Ga0495617_006186 Ga0495617_006186_976_3456 782
180 3300046458 Ga0495591_004449 Ga0495591_004449_1354_3834 782
181 3300046471 Ga0495650_0001031 Ga0495650_0001031_11954_14434 782
182 3300046492 Ga0495585_0006587 Ga0495585_0006587_1097_3577 782
183 3300046501 Ga0495607_0007472 Ga0495607_0007472_1265_3745 782
184 3300046506 Ga0495583_0001059 Ga0495583_0001059_21692_24172 782
185 3300046507 Ga0495606_0002977 Ga0495606_0002977_784_3288 782
186 3300046512 Ga0495610_0011390 Ga0495610_0011390_742_3222 782
187 3300046515 Ga0495620_0007173 Ga0495620_0007173_1309_3789 782
188 3300046523 Ga0495644_0000254 Ga0495644_0000254_11714_14185 782
189 3300046538 Ga0495609_0000167 Ga0495609_0000167_23541_26021 782
190 3300046642 Ga0495634_0000895 Ga0495634_0000895_13837_16341 782
191 3300046648 Ga0495611_0000948 Ga0495611_0000948_9782_12262 782
192 3300046665 Ga0495661_0000088 Ga0495661_0000088_32343_34823 782
193 3300046680 Ga0495646_0003001 Ga0495646_0003001_1614_4118 782
194 3300046680 Ga0495646_0005182 Ga0495646_0005182_4799_7303 782
195 3300046691 Ga0495670_0013493 Ga0495670_0013493_1493_3964 782
196 3300046691 Ga0495670_0017620 Ga0495670_0017620_737_3241 782
197 3300046810 Ga0495660_0014479 Ga0495660_0014479_1551_4022 782
198 3300047446 Ga0495679_000039 Ga0495679_000039_19556_22036 782
199 3300047469 Ga0495673_0001352 Ga0495673_0001352_5714_8218 782
200 3300047470 Ga0495681_0001530 Ga0495681_0001530_285_2756 782
201 3300047470 Ga0495681_0003855 Ga0495681_0003855_5496_7976 782
202 3300048091 Ga0495626_0000216 Ga0495626_0000216_43663_46143 782
203 3300041405 Ga0439438_000485 Ga0439438_000485_14455_16926 783
204 3300046474 Ga0495605_0000245 Ga0495605_0000245_35920_38400 783
205 3300046506 Ga0495583_0004286 Ga0495583_0004286_2835_5315 783
206 3300046507 Ga0495606_0000167 Ga0495606_0000167_60524_63004 783
207 3300046536 Ga0495587_0009839 Ga0495587_0009839_1033_3537 783
208 3300046663 Ga0495635_0001565 Ga0495635_0001565_327_2831 783
209 3300046665 Ga0495661_0003936 Ga0495661_0003936_1757_4237 783
210 3300047469 Ga0495673_0015327 Ga0495673_0015327_268_2748 783
211 3300047673 Ga0495593_0025237 Ga0495593_0025237_38_2452 783
212 3300048905 Ga0496102_0000496 Ga0496102_0000496_13034_15538 783
213 3300048906 Ga0496103_0002367 Ga0496103_0002367_6764_9268 783
214 3300013105 Ga0157369_10010872 Ga0157369_1001087210 784
215 3300042013 Ga0439456_000067 Ga0439456_000067_1094_3547 784
216 3300046452 Ga0495617_004223 Ga0495617_004223_679_3150 784
217 3300046501 Ga0495607_0006942 Ga0495607_0006942_4190_6670 784
218 3300046520 Ga0495637_0000115 Ga0495637_0000115_33251_35731 784
219 3300046616 Ga0495668_0010523 Ga0495668_0010523_1485_3965 784
220 3300046660 Ga0495625_0000134 Ga0495625_0000134_73750_76230 784
221 3300046691 Ga0495670_0004494 Ga0495670_0004494_3412_5883 784
222 3300046810 Ga0495660_0001803 Ga0495660_0001803_10213_12693 784
223 3300047321 Ga0495676_0000018 Ga0495676_0000018_39634_42114 784
224 3300047322 Ga0495680_0022614 Ga0495680_0022614_1449_3953 784
225 3300047443 Ga0495687_015096 Ga0495687_015096_762_3233 784
226 3300047469 Ga0495673_0009119 Ga0495673_0009119_468_2939 784
227 3300047470 Ga0495681_0000475 Ga0495681_0000475_10336_12840 784
228 3300047470 Ga0495681_0009722 Ga0495681_0009722_886_3357 784
229 3300015261 Ga0182006_1000196 Ga0182006_100019653 785
230 3300042006 Ga0439432_000084 Ga0439432_000084_16947_19409 785
231 3300042016 Ga0439463_000123 Ga0439463_000123_5275_7755 785
232 3300046452 Ga0495617_000753 Ga0495617_000753_9653_12124 785
233 3300046501 Ga0495607_0002946 Ga0495607_0002946_9787_12267 785
234 3300046513 Ga0495616_0000766 Ga0495616_0000766_5871_8342 785
235 3300046520 Ga0495637_0000671 Ga0495637_0000671_15315_17786 785
236 3300046530 Ga0495654_0000545 Ga0495654_0000545_21501_24005 785
237 3300046557 Ga0495622_0006931 Ga0495622_0006931_1243_3714 785
238 3300046616 Ga0495668_0004994 Ga0495668_0004994_6011_8482 785
239 3300046616 Ga0495668_0008942 Ga0495668_0008942_469_2949 785
240 3300046648 Ga0495611_0000520 Ga0495611_0000520_6016_8487 785
241 3300046691 Ga0495670_0000240 Ga0495670_0000240_6003_8474 785
242 3300046810 Ga0495660_0039506 Ga0495660_0039506_33_2504 785
243 3300047320 Ga0495672_0001030 Ga0495672_0001030_22661_25165 785
244 3300047469 Ga0495673_0004990 Ga0495673_0004990_199_2679 785
245 3300047470 Ga0495681_0004360 Ga0495681_0004360_5839_8310 785
246 3300047472 Ga0495686_0007273 Ga0495686_0007273_1796_4267 785
247 3300049460 Ga0495682_0001153 Ga0495682_0001153_1039_3519 785
248 3300005457 Ga0070662_100001621 Ga0070662_1000016214 786
249 3300005834 Ga0068851_10000119 Ga0068851_100001196 786
250 3300009011 Ga0105251_10000088 Ga0105251_1000008817 786
251 3300013105 Ga0157369_10004854 Ga0157369_1000485412 786
252 3300017792 Ga0163161_10011502 Ga0163161_100115023 786
253 3300025321 Ga0207656_10002363 Ga0207656_100023634 786
254 3300025735 Ga0207713_1001194 Ga0207713_10011944 786
255 3300025923 Ga0207681_10000299 Ga0207681_1000029920 786
256 3300025933 Ga0207706_10004102 Ga0207706_100041028 786
257 3300026041 Ga0207639_10022337 Ga0207639_100223372 786
258 3300046522 Ga0495643_0002308 Ga0495643_0002308_4963_7434 786
259 3300047446 Ga0495679_000571 Ga0495679_000571_15561_18023 786
260 3300048920 Ga0496117_0004579 Ga0496117_0004579_4257_6719 786
261 3300048922 Ga0496119_0012038 Ga0496119_0012038_616_3078 786
262 3300048923 Ga0496120_0003163 Ga0496120_0003163_8463_10925 786
263 3300048927 Ga0496124_0000718 Ga0496124_0000718_41246_43726 786
264 3300048927 Ga0496124_0018426 Ga0496124_0018426_58_2520 786
265 3300048928 Ga0496125_0026940 Ga0496125_0026940_1278_3740 786
266 3300014497 Ga0182008_10000153 Ga0182008_1000015339 787
267 3300046501 Ga0495607_0000384 Ga0495607_0000384_32053_34533 787
268 3300046515 Ga0495620_0001067 Ga0495620_0001067_4301_6772 787
269 3300046518 Ga0495631_0000412 Ga0495631_0000412_5842_8346 787
270 3300013100 Ga0157373_10043599 Ga0157373_100435992 788
271 3300046474 Ga0495605_0003619 Ga0495605_0003619_262_2742 788
272 3300046474 Ga0495605_0007563 Ga0495605_0007563_2079_4559 788
273 3300046501 Ga0495607_0002375 Ga0495607_0002375_8197_10677 788
274 3300046506 Ga0495583_0009297 Ga0495583_0009297_1615_4095 788
275 3300046507 Ga0495606_0007966 Ga0495606_0007966_2044_4524 788
276 3300046519 Ga0495632_0019041 Ga0495632_0019041_500_2980 788
277 3300046530 Ga0495654_0011954 Ga0495654_0011954_1777_4248 788
278 3300046665 Ga0495661_0011952 Ga0495661_0011952_2232_4712 788
279 3300046692 Ga0495671_0012279 Ga0495671_0012279_769_3249 788
280 3300047320 Ga0495672_0016270 Ga0495672_0016270_2139_4610 788
281 3300047320 Ga0495672_0032895 Ga0495672_0032895_490_2970 788
282 3300047443 Ga0495687_013475 Ga0495687_013475_1041_3512 788
283 3300047469 Ga0495673_0002013 Ga0495673_0002013_3313_5793 788
284 3300009011 Ga0105251_10000252 Ga0105251_1000025216 789
285 3300042533 Ga0450901_000277 Ga0450901_000277_2736_5207 789
286 3300046512 Ga0495610_0000653 Ga0495610_0000653_9516_11990 789
287 3300046512 Ga0495610_0003790 Ga0495610_0003790_2311_4785 789
288 3300046520 Ga0495637_0000437 Ga0495637_0000437_26512_28992 789
289 3300046524 Ga0495648_0001832 Ga0495648_0001832_711_3182 789
290 3300046530 Ga0495654_0004479 Ga0495654_0004479_1207_3681 789
291 3300046810 Ga0495660_0008917 Ga0495660_0008917_2315_4795 789
292 3300049459 Ga0495678_001756 Ga0495678_001756_1398_3878 789
293 3300005331 Ga0070670_100000242 Ga0070670_10000024239 790
294 3300009036 Ga0105244_10000568 Ga0105244_1000056828 790
295 3300009036 Ga0105244_10001729 Ga0105244_100017297 790
296 3300009148 Ga0105243_10000142 Ga0105243_1000014216 790
297 3300013100 Ga0157373_10000084 Ga0157373_1000008411 790
298 3300013100 Ga0157373_10000144 Ga0157373_1000014441 790
299 3300025728 Ga0207655_1000085 Ga0207655_1000085146 790
300 3300025925 Ga0207650_10000259 Ga0207650_1000025912 790
301 3300025935 Ga0207709_10000011 Ga0207709_10000011253 790
302 3300046517 Ga0495630_0010976 Ga0495630_0010976_490_2994 790
303 3300047320 Ga0495672_0008632 Ga0495672_0008632_661_3132 790
304 3300047469 Ga0495673_0000254 Ga0495673_0000254_40251_42755 790
305 3300011119 Ga0105246_10000021 Ga0105246_1000002122 791
306 3300046463 Ga0495653_0004352 Ga0495653_0004352_2581_5067 791
307 3300046507 Ga0495606_0004429 Ga0495606_0004429_2442_4928 791
308 3300049460 Ga0495682_0003306 Ga0495682_0003306_3132_5603 791
309 3300013105 Ga0157369_10001116 Ga0157369_1000111617 792
310 3300025735 Ga0207713_1000313 Ga0207713_100031316 792
311 3300041407 Ga0439447_000030 Ga0439447_000030_16964_19468 792
312 3300041411 Ga0439466_0000044 Ga0439466_0000044_3086_5590 792
313 3300042010 Ga0439452_000417 Ga0439452_000417_3072_5576 792
314 3300042138 Ga0450903_000914 Ga0450903_000914_2490_4994 792
315 3300042146 Ga0450907_000051 Ga0450907_000051_3073_5577 792
316 3300042435 Ga0439434_0000099 Ga0439434_0000099_2935_5439 792
317 3300042993 Ga0439440_0002565 Ga0439440_0002565_504_3008 792
318 3300046499 Ga0495594_0001163 Ga0495594_0001163_1607_4111 792
319 3300046515 Ga0495620_0010605 Ga0495620_0010605_1564_4032 792
320 3300046557 Ga0495622_0000442 Ga0495622_0000442_8714_11218 792
321 3300046524 Ga0495648_0002558 Ga0495648_0002558_2148_4628 793
322 3300046692 Ga0495671_0008861 Ga0495671_0008861_178_2649 793
323 3300047469 Ga0495673_0001002 Ga0495673_0001002_3048_5525 793
324 3300048919 Ga0496116_0000650 Ga0496116_0000650_28988_31492 793
325 3300013308 Ga0157375_10001137 Ga0157375_100011375 794
326 3300046453 Ga0495627_001112 Ga0495627_001112_1733_4201 794
327 3300046471 Ga0495650_0021550 Ga0495650_0021550_364_2832 794
328 3300046474 Ga0495605_0000819 Ga0495605_0000819_3677_6145 794
329 3300046492 Ga0495585_0002780 Ga0495585_0002780_7139_9625 794
330 3300046492 Ga0495585_0011754 Ga0495585_0011754_1570_4038 794
331 3300046513 Ga0495616_0000608 Ga0495616_0000608_18532_21000 794
332 3300046519 Ga0495632_0003748 Ga0495632_0003748_1597_4065 794
333 3300046530 Ga0495654_0002063 Ga0495654_0002063_6064_8532 794
334 3300046660 Ga0495625_0002135 Ga0495625_0002135_16608_19076 794
335 3300046665 Ga0495661_0000030 Ga0495661_0000030_101320_103806 794
336 3300046692 Ga0495671_0000981 Ga0495671_0000981_15806_18274 794
337 3300048091 Ga0495626_0001472 Ga0495626_0001472_1623_4091 794
338 3300049459 Ga0495678_001210 Ga0495678_001210_1940_4408 794
339 3300003751 Ga0055538_1000066 Ga0055538_100006615 795
340 3300003752 Ga0055539_1000102 Ga0055539_100010215 795
341 3300003756 Ga0055533_1000110 Ga0055533_100011015 795
342 3300003758 Ga0055532_1000326 Ga0055532_100032612 795
343 3300003759 Ga0055525_1000187 Ga0055525_100018762 795
344 3300003841 Ga0055541_1000068 Ga0055541_100006892 795
345 3300025206 Ga0209435_100440 Ga0209435_1004406 795
346 3300025224 Ga0209784_100057 Ga0209784_10005777 795
347 3300025225 Ga0209566_100073 Ga0209566_10007377 795
348 3300025226 Ga0209674_100095 Ga0209674_10009577 795
349 3300025229 Ga0209147_100092 Ga0209147_10009277 795
350 3300025230 Ga0209563_100093 Ga0209563_10009393 795
351 3300025242 Ga0209258_100300 Ga0209258_10030075 795
352 3300025246 Ga0209646_1000413 Ga0209646_10004138 795
353 3300025253 Ga0209677_100054 Ga0209677_10005477 795
354 3300025735 Ga0207713_1002575 Ga0207713_10025758 795
355 3300031731 Ga0307405_10000118 Ga0307405_1000011810 795
356 3300031901 Ga0307406_10036598 Ga0307406_100365982 795
357 3300041411 Ga0439466_0000454 Ga0439466_0000454_7786_10281 795
358 3300046507 Ga0495606_0002351 Ga0495606_0002351_6036_8498 795
359 3300046515 Ga0495620_0003624 Ga0495620_0003624_2885_5356 795
360 3300046694 Ga0495649_0000852 Ga0495649_0000852_3714_6182 795
361 3300047446 Ga0495679_000717 Ga0495679_000717_2119_4587 795
362 3300048919 Ga0496116_0000046 Ga0496116_0000046_313027_315507 795
363 3300048928 Ga0496125_0019465 Ga0496125_0019465_2994_5456 795
364 3300005288 Ga0065714_10002746 Ga0065714_1000274610 796
365 3300015261 Ga0182006_1008555 Ga0182006_10085553 796
366 3300046457 Ga0495590_0000617 Ga0495590_0000617_12826_15297 796
367 3300046501 Ga0495607_0021166 Ga0495607_0021166_693_3164 796
368 3300046519 Ga0495632_0008892 Ga0495632_0008892_2008_4497 796
369 3300046660 Ga0495625_0021557 Ga0495625_0021557_2367_4856 796
370 3300046665 Ga0495661_0005454 Ga0495661_0005454_4714_7218 796
371 3300047319 Ga0495674_0006644 Ga0495674_0006644_5995_8499 796
372 3300047320 Ga0495672_0003248 Ga0495672_0003248_8242_10713 796
373 3300048091 Ga0495626_0000236 Ga0495626_0000236_25887_28358 796
374 3300003791 Ga0055530_10000094 Ga0055530_1000009446 797
375 3300003792 Ga0055540_1000130 Ga0055540_100013046 797
376 3300009036 Ga0105244_10000991 Ga0105244_1000099113 797
377 3300011119 Ga0105246_10051915 Ga0105246_100519152 797
378 3300025298 Ga0209050_1000079 Ga0209050_100007944 797
379 3300025303 Ga0209051_1000054 Ga0209051_100005447 797
380 3300025728 Ga0207655_1014631 Ga0207655_10146312 797
381 3300046457 Ga0495590_0000828 Ga0495590_0000828_116_2620 797
382 3300046492 Ga0495585_0006653 Ga0495585_0006653_3861_6332 797
383 3300046507 Ga0495606_0001446 Ga0495606_0001446_3616_6087 797
384 3300046513 Ga0495616_0000828 Ga0495616_0000828_15222_17726 797
385 3300046515 Ga0495620_0003199 Ga0495620_0003199_6441_8903 797
386 3300003781 Ga0055536_1000046 Ga0055536_100004613 798
387 3300003792 Ga0055540_1000070 Ga0055540_100007013 798
388 3300041405 Ga0439438_000542 Ga0439438_000542_152_2620 798
389 3300046453 Ga0495627_000779 Ga0495627_000779_13680_16154 798
390 3300046453 Ga0495627_010140 Ga0495627_010140_547_3018 798
391 3300046458 Ga0495591_001537 Ga0495591_001537_7969_10443 798
392 3300046460 Ga0495638_0002533 Ga0495638_0002533_9626_12097 798
393 3300046506 Ga0495583_0002888 Ga0495583_0002888_8580_11051 798
394 3300046512 Ga0495610_0000661 Ga0495610_0000661_15117_17588 798
395 3300046519 Ga0495632_0001632 Ga0495632_0001632_6391_8865 798
396 3300046530 Ga0495654_0003356 Ga0495654_0003356_3212_5683 798
397 3300046665 Ga0495661_0000896 Ga0495661_0000896_8022_10496 798
398 3300046694 Ga0495649_0004127 Ga0495649_0004127_2910_5381 798
399 3300047469 Ga0495673_0008006 Ga0495673_0008006_3215_5704 798
400 3300047470 Ga0495681_0021303 Ga0495681_0021303_95_2569 798
401 3300048091 Ga0495626_0002336 Ga0495626_0002336_2805_5348 798
402 3300025291 Ga0209675_1001274 Ga0209675_100127412 799
403 3300031731 Ga0307405_10002752 Ga0307405_100027526 799
404 3300031824 Ga0307413_10004849 Ga0307413_100048492 799
405 3300031911 Ga0307412_10000870 Ga0307412_100008706 799
406 3300046474 Ga0495605_0000291 Ga0495605_0000291_9916_12396 799
407 3300049662 Ga0501222_000227 Ga0501222_000227_3097_5565 799
408 3300046458 Ga0495591_000121 Ga0495591_000121_24225_26696 800
409 3300046458 Ga0495591_000883 Ga0495591_000883_14738_17206 800
410 3300046474 Ga0495605_0022598 Ga0495605_0022598_751_3222 800
411 3300046500 Ga0495596_0000056 Ga0495596_0000056_56394_58865 800
412 3300046512 Ga0495610_0024372 Ga0495610_0024372_498_2969 800
413 3300046515 Ga0495620_0017045 Ga0495620_0017045_582_3050 800
414 3300046519 Ga0495632_0006133 Ga0495632_0006133_1107_3578 800
415 3300046520 Ga0495637_0000134 Ga0495637_0000134_38900_41371 800
416 3300046523 Ga0495644_0011678 Ga0495644_0011678_526_2997 800
417 3300046524 Ga0495648_0005559 Ga0495648_0005559_1230_3701 800
418 3300046616 Ga0495668_0001799 Ga0495668_0001799_16115_18586 800
419 3300046665 Ga0495661_0001895 Ga0495661_0001895_8057_10528 800
420 3300046692 Ga0495671_0015271 Ga0495671_0015271_1279_3750 800
421 3300047320 Ga0495672_0011641 Ga0495672_0011641_129_2600 800
422 3300047323 Ga0495683_0000640 Ga0495683_0000640_4046_6517 800
423 3300047469 Ga0495673_0012398 Ga0495673_0012398_1034_3505 800
424 3300047470 Ga0495681_0000576 Ga0495681_0000576_17460_19931 800
425 3300048091 Ga0495626_0000606 Ga0495626_0000606_19821_22292 800
426 3300048924 Ga0496121_0019936 Ga0496121_0019936_3308_5728 800
427 3300015261 Ga0182006_1000204 Ga0182006_100020451 801
428 3300015262 Ga0182007_10000625 Ga0182007_1000062513 801
429 3300015265 Ga0182005_1000114 Ga0182005_100011455 801
430 3300025256 Ga0209759_1001701 Ga0209759_100170110 801
431 3300025728 Ga0207655_1000006 Ga0207655_1000006134 801
432 3300046463 Ga0495653_0004101 Ga0495653_0004101_5424_7928 801
433 3300046463 Ga0495653_0038108 Ga0495653_0038108_1078_3549 801
434 3300046499 Ga0495594_0003085 Ga0495594_0003085_5122_7626 801
435 3300046516 Ga0495628_0012033 Ga0495628_0012033_3705_6209 801
436 3300046522 Ga0495643_0009900 Ga0495643_0009900_2343_4832 801
437 3300046526 Ga0495666_0000146 Ga0495666_0000146_24830_27301 801
438 3300046536 Ga0495587_0001087 Ga0495587_0001087_4186_6690 801
439 3300046538 Ga0495609_0002648 Ga0495609_0002648_3592_6063 801
440 3300046663 Ga0495635_0001544 Ga0495635_0001544_6169_8673 801
441 3300046664 Ga0495659_0000081 Ga0495659_0000081_22964_25468 801
442 3300046679 Ga0495623_0001124 Ga0495623_0001124_8486_10957 801
443 3300046679 Ga0495623_0002784 Ga0495623_0002784_2300_4804 801
444 3300046680 Ga0495646_0006595 Ga0495646_0006595_1024_3528 801
445 3300046694 Ga0495649_0016899 Ga0495649_0016899_1410_3881 801
446 3300046810 Ga0495660_0029467 Ga0495660_0029467_267_2771 801
447 3300047315 Ga0495581_0001429 Ga0495581_0001429_5716_8220 801
448 3300047317 Ga0495604_0002459 Ga0495604_0002459_6902_9406 801
449 3300047322 Ga0495680_0001365 Ga0495680_0001365_6975_9479 801
450 3300047322 Ga0495680_0002276 Ga0495680_0002276_6846_9350 801
451 3300047443 Ga0495687_002214 Ga0495687_002214_8876_11380 801
452 3300047444 Ga0495675_0001178 Ga0495675_0001178_6383_8887 801
453 3300047446 Ga0495679_000811 Ga0495679_000811_2009_4480 801
454 3300047673 Ga0495593_0000675 Ga0495593_0000675_9788_12259 801
455 3300048091 Ga0495626_0000491 Ga0495626_0000491_22793_25297 801
456 3300048925 Ga0496122_0001312 Ga0496122_0001312_22668_25172 801
457 3300009092 Ga0105250_10010093 Ga0105250_100100932 802
458 3300013102 Ga0157371_10000627 Ga0157371_1000062726 802
459 3300013104 Ga0157370_10064179 Ga0157370_100641792 802
460 3300025711 Ga0207696_1000916 Ga0207696_10009164 802
461 3300025735 Ga0207713_1001284 Ga0207713_10012842 802
462 3300031548 Ga0307408_100014161 Ga0307408_1000141613 802
463 3300041405 Ga0439438_001715 Ga0439438_001715_3525_5993 802
464 3300046460 Ga0495638_0000866 Ga0495638_0000866_14105_16573 802
465 3300046491 Ga0495584_0001339 Ga0495584_0001339_4701_7205 802
466 3300046515 Ga0495620_0001539 Ga0495620_0001539_6254_8728 802
467 3300046515 Ga0495620_0015139 Ga0495620_0015139_118_2580 802
468 3300046520 Ga0495637_0002379 Ga0495637_0002379_3258_5762 802
469 3300046530 Ga0495654_0016664 Ga0495654_0016664_457_2931 802
470 3300046692 Ga0495671_0017467 Ga0495671_0017467_402_2906 802
471 3300046794 Ga0495589_0001445 Ga0495589_0001445_8406_10880 802
472 3300047446 Ga0495679_001183 Ga0495679_001183_2819_5293 802
473 3300047470 Ga0495681_0001839 Ga0495681_0001839_8547_11051 802
474 3300047470 Ga0495681_0003442 Ga0495681_0003442_767_3241 802
475 3300048920 Ga0496117_0001466 Ga0496117_0001466_6074_8560 802
476 3300048922 Ga0496119_0005391 Ga0496119_0005391_1911_4397 802
477 3300048923 Ga0496120_0002592 Ga0496120_0002592_527_3013 802
478 3300048926 Ga0496123_0034060 Ga0496123_0034060_363_2849 802
479 3300009036 Ga0105244_10015684 Ga0105244_100156842 803
480 3300031731 Ga0307405_10005455 Ga0307405_100054553 803
481 3300047320 Ga0495672_0000548 Ga0495672_0000548_7152_9623 803
482 3300047323 Ga0495683_0000018 Ga0495683_0000018_154364_156865 803
483 3300005344 Ga0070661_100000151 Ga0070661_10000015113 804
484 3300005564 Ga0070664_100000095 Ga0070664_10000009513 804
485 3300009036 Ga0105244_10001433 Ga0105244_1000143312 804
486 3300025728 Ga0207655_1000114 Ga0207655_100011474 804
487 3300025920 Ga0207649_10000032 Ga0207649_1000003252 804
488 3300025945 Ga0207679_10000059 Ga0207679_1000005979 804
489 3300046506 Ga0495583_0000387 Ga0495583_0000387_57364_59820 804
490 3300046530 Ga0495654_0000166 Ga0495654_0000166_52975_55431 804
491 3300003781 Ga0055536_1000028 Ga0055536_100002899 805
492 3300003791 Ga0055530_10000030 Ga0055530_1000003062 805
493 3300003792 Ga0055540_1000262 Ga0055540_100026227 805
494 3300013100 Ga0157373_10000722 Ga0157373_100007226 805
495 3300017792 Ga0163161_10001080 Ga0163161_1000108010 805
496 3300025292 Ga0209676_1000062 Ga0209676_1000062255 805
497 3300025298 Ga0209050_1000150 Ga0209050_100015095 805
498 3300025303 Ga0209051_1000162 Ga0209051_100016263 805
499 3300042016 Ga0439463_000007 Ga0439463_000007_27016_29532 805
500 3300042115 Ga0450911_001293 Ga0450911_001293_1865_4336 805
501 3300046452 Ga0495617_003142 Ga0495617_003142_2647_5118 805
502 3300046458 Ga0495591_002577 Ga0495591_002577_7091_9562 805
503 3300046460 Ga0495638_0042032 Ga0495638_0042032_166_2637 805
504 3300046492 Ga0495585_0001801 Ga0495585_0001801_12355_14826 805
505 3300046501 Ga0495607_0001382 Ga0495607_0001382_17601_20072 805
506 3300046524 Ga0495648_0001289 Ga0495648_0001289_11349_13817 805
507 3300046665 Ga0495661_0013930 Ga0495661_0013930_2076_4547 805
508 3300046810 Ga0495660_0000815 Ga0495660_0000815_17226_19697 805
509 3300047320 Ga0495672_0004808 Ga0495672_0004808_6166_8637 805
510 3300047321 Ga0495676_0002166 Ga0495676_0002166_3742_6213 805
511 3300047323 Ga0495683_0005370 Ga0495683_0005370_377_2848 805
512 3300048091 Ga0495626_0012142 Ga0495626_0012142_517_2988 805
513 3300003791 Ga0055530_10000653 Ga0055530_1000065318 806
514 3300003794 Ga0055531_10001382 Ga0055531_1000138210 806
515 3300013100 Ga0157373_10009331 Ga0157373_100093313 806
516 3300025292 Ga0209676_1000055 Ga0209676_1000055293 806
517 3300025298 Ga0209050_1000231 Ga0209050_1000231101 806
518 3300025303 Ga0209051_1000165 Ga0209051_1000165101 806
519 3300025304 Ga0209257_1000483 Ga0209257_10004839 806
520 3300025735 Ga0207713_1000581 Ga0207713_10005818 806
521 3300041405 Ga0439438_000422 Ga0439438_000422_773_3277 806
522 3300041407 Ga0439447_000150 Ga0439447_000150_13805_16288 806
523 3300041411 Ga0439466_0001484 Ga0439466_0001484_5702_8173 806
524 3300041411 Ga0439466_0004613 Ga0439466_0004613_1434_3917 806
525 3300042115 Ga0450911_000528 Ga0450911_000528_5920_8424 806
526 3300042156 Ga0439446_0001954 Ga0439446_0001954_2266_4770 806
527 3300042184 Ga0450908_001635 Ga0450908_001635_1472_3976 806
528 3300046458 Ga0495591_000023 Ga0495591_000023_55017_57497 806
529 3300046458 Ga0495591_000680 Ga0495591_000680_1776_4247 806
530 3300046492 Ga0495585_0001186 Ga0495585_0001186_15070_17541 806
531 3300046507 Ga0495606_0002412 Ga0495606_0002412_5943_8414 806
532 3300046507 Ga0495606_0002769 Ga0495606_0002769_5962_8433 806
533 3300046512 Ga0495610_0002742 Ga0495610_0002742_6071_8542 806
534 3300046520 Ga0495637_0004730 Ga0495637_0004730_1020_3500 806
535 3300046524 Ga0495648_0025846 Ga0495648_0025846_162_2666 806
536 3300046542 Ga0495597_0000016 Ga0495597_0000016_49075_51555 806
537 3300046616 Ga0495668_0001309 Ga0495668_0001309_3597_6068 806
538 3300046694 Ga0495649_0018590 Ga0495649_0018590_887_3358 806
539 3300046810 Ga0495660_0000807 Ga0495660_0000807_1142_3622 806
540 3300049460 Ga0495682_0000050 Ga0495682_0000050_67029_69491 806
541 3300053111 Ga0500572_000228 Ga0500572_000228_15756_18227 806
542 iso_pu_bacteria 2600255318 2601795958 806
543 iso_pu_bacteria 2603880185 2606075194 806
544 iso_pu_bacteria 2603880199 2606128057 806
545 iso_pu_bacteria 2713897149 2715756190 806
546 iso_pu_bacteria 2808606382 2808960543 806
547 3300005331 Ga0070670_100001182 Ga0070670_1000011824 807
548 3300011119 Ga0105246_10005271 Ga0105246_100052713 807
549 3300013102 Ga0157371_10001356 Ga0157371_1000135615 807
550 3300017792 Ga0163161_10023179 Ga0163161_100231792 807
551 3300025925 Ga0207650_10000068 Ga0207650_1000006850 807
552 3300046492 Ga0495585_0000728 Ga0495585_0000728_14124_16592 807
553 3300046512 Ga0495610_0019340 Ga0495610_0019340_827_3298 807
554 3300046519 Ga0495632_0005142 Ga0495632_0005142_2553_5045 807
555 3300046519 Ga0495632_0018218 Ga0495632_0018218_914_3385 807
556 3300046648 Ga0495611_0001788 Ga0495611_0001788_7632_10100 807
557 3300046810 Ga0495660_0017891 Ga0495660_0017891_332_2800 807
558 3300003781 Ga0055536_1000119 Ga0055536_10001198 808
559 3300013100 Ga0157373_10027270 Ga0157373_100272702 808
560 3300013102 Ga0157371_10007809 Ga0157371_100078095 808
561 3300015261 Ga0182006_1008801 Ga0182006_10088012 808
562 3300025292 Ga0209676_1000407 Ga0209676_100040757 808
563 3300030735 Ga0316178_1045217 Ga0316178_10452173 808
564 3300031911 Ga0307412_10010330 Ga0307412_100103304 808
565 3300031995 Ga0307409_100054103 Ga0307409_1000541032 808
566 3300032005 Ga0307411_10014170 Ga0307411_100141702 808
567 3300041405 Ga0439438_000301 Ga0439438_000301_8847_11315 808
568 3300041405 Ga0439438_000684 Ga0439438_000684_5205_7673 808
569 3300042010 Ga0439452_000221 Ga0439452_000221_11288_13756 808
570 3300042013 Ga0439456_001379 Ga0439456_001379_144_2612 808
571 3300042115 Ga0450911_000491 Ga0450911_000491_1335_3803 808
572 3300046452 Ga0495617_000680 Ga0495617_000680_1731_4235 808
573 3300046474 Ga0495605_0001092 Ga0495605_0001092_2869_5373 808
574 3300046491 Ga0495584_0000586 Ga0495584_0000586_16768_19272 808
575 3300046492 Ga0495585_0005839 Ga0495585_0005839_1963_4467 808
576 3300046501 Ga0495607_0000476 Ga0495607_0000476_14106_16610 808
577 3300046507 Ga0495606_0008379 Ga0495606_0008379_1754_4225 808
578 3300046515 Ga0495620_0000622 Ga0495620_0000622_6037_8508 808
579 3300046519 Ga0495632_0000676 Ga0495632_0000676_23308_25812 808
580 3300046524 Ga0495648_0030467 Ga0495648_0030467_546_3050 808
581 3300046528 Ga0495642_0001771 Ga0495642_0001771_5289_7793 808
582 3300046538 Ga0495609_0000516 Ga0495609_0000516_23342_25846 808
583 3300046648 Ga0495611_0004324 Ga0495611_0004324_2012_4516 808
584 3300046660 Ga0495625_0038111 Ga0495625_0038111_523_3027 808
585 3300046691 Ga0495670_0005903 Ga0495670_0005903_1783_4287 808
586 3300046694 Ga0495649_0001220 Ga0495649_0001220_5297_7801 808
587 3300046794 Ga0495589_0002256 Ga0495589_0002256_3617_6088 808
588 3300047443 Ga0495687_005600 Ga0495687_005600_3953_6457 808
589 3300048088 Ga0495602_0001096 Ga0495602_0001096_12723_15197 808
590 3300048091 Ga0495626_0004812 Ga0495626_0004812_1621_4125 808
591 3300049459 Ga0495678_000686 Ga0495678_000686_23300_25804 808
592 iso_pu_bacteria 8055878733 8055883294 808
593 3300002737 JGI25162J39368_1000060 JGI25162J39368_100006078 809
594 3300002771 JGI25163J39215_1000017 JGI25163J39215_100001767 809
595 3300002772 JGI25164J39214_1000037 JGI25164J39214_100003750 809
596 3300003214 JGI25165J46597_1000118 JGI25165J46597_100011851 809
597 3300025207 Ga0209760_100023 Ga0209760_100023107 809
598 3300025231 Ga0207427_100018 Ga0207427_100018106 809
599 3300025233 Ga0209437_100031 Ga0209437_100031106 809
600 3300025261 Ga0209233_1000012 Ga0209233_1000012105 809
601 3300046460 Ga0495638_0016361 Ga0495638_0016361_2321_4792 809
602 3300046474 Ga0495605_0010265 Ga0495605_0010265_1502_4006 809
603 3300046501 Ga0495607_0000185 Ga0495607_0000185_5018_7489 809
604 3300046513 Ga0495616_0001572 Ga0495616_0001572_4613_7084 809
605 3300046692 Ga0495671_0003292 Ga0495671_0003292_2649_5153 809
606 3300046692 Ga0495671_0008182 Ga0495671_0008182_1764_4235 809
607 3300048929 Ga0496126_0001228 Ga0496126_0001228_33879_36341 809
608 3300013102 Ga0157371_10001502 Ga0157371_100015029 810
609 3300013308 Ga0157375_10021607 Ga0157375_100216073 810
610 3300017792 Ga0163161_10000879 Ga0163161_1000087916 810
611 3300025728 Ga0207655_1004671 Ga0207655_10046712 810
612 3300033180 Ga0307510_10000942 Ga0307510_1000094225 810
613 3300046453 Ga0495627_000717 Ga0495627_000717_6021_8492 810
614 3300046458 Ga0495591_012387 Ga0495591_012387_258_2729 810
615 3300046460 Ga0495638_0019834 Ga0495638_0019834_479_2950 810
616 3300046491 Ga0495584_0002533 Ga0495584_0002533_2005_4476 810
617 3300046491 Ga0495584_0020350 Ga0495584_0020350_481_2952 810
618 3300046492 Ga0495585_0000573 Ga0495585_0000573_18166_20670 810
619 3300046501 Ga0495607_0003722 Ga0495607_0003722_6037_8508 810
620 3300046512 Ga0495610_0003827 Ga0495610_0003827_4512_6983 810
621 3300046519 Ga0495632_0000933 Ga0495632_0000933_6009_8480 810
622 3300046520 Ga0495637_0004345 Ga0495637_0004345_1281_3752 810
623 3300046524 Ga0495648_0001791 Ga0495648_0001791_15212_17683 810
624 3300046524 Ga0495648_0010168 Ga0495648_0010168_409_2880 810
625 3300046660 Ga0495625_0002078 Ga0495625_0002078_10407_12878 810
626 3300046691 Ga0495670_0004434 Ga0495670_0004434_2159_4630 810
627 3300046692 Ga0495671_0000852 Ga0495671_0000852_16797_19268 810
628 3300046692 Ga0495671_0017702 Ga0495671_0017702_225_2696 810
629 3300046694 Ga0495649_0014236 Ga0495649_0014236_1081_3552 810
630 3300046794 Ga0495589_0012465 Ga0495589_0012465_1510_3981 810
631 3300047323 Ga0495683_0001726 Ga0495683_0001726_8317_10788 810
632 3300047470 Ga0495681_0000811 Ga0495681_0000811_6015_8486 810
633 3300048924 Ga0496121_0000284 Ga0496121_0000284_6151_8631 810
634 iso_pu_bacteria 2597489888 2597864740 810
635 iso_pu_bacteria 2597489889 2597870593 810
636 iso_pu_bacteria 2599185167 2599397922 810
637 iso_pu_bacteria 2599185179 2599452368 810
638 iso_pu_bacteria 2599185189 2599506932 810
639 iso_pu_bacteria 2599185190 2599513253 810
640 iso_pu_bacteria 2599185191 2599518247 810
641 iso_pu_bacteria 2599185288 2599878041 810
642 iso_pu_bacteria 2599185290 2599891929 810
643 iso_pu_bacteria 2599185303 2599947253 810
644 iso_pu_bacteria 2600255296 2601689976 810
645 iso_pu_bacteria 2619619299 2621298737 810
646 iso_pu_bacteria 2643221713 2644622435 810
647 iso_pu_bacteria 2675903420 2677900774 810
648 iso_pu_bacteria 2721755607 2723249515 810
649 iso_pu_bacteria 2738541265 2738671986 810
650 iso_pu_bacteria 2738541282 2738750380 810
651 iso_pu_bacteria 2738541294 2738809976 810
652 iso_pu_bacteria 2738541303 2738859420 810
653 iso_pu_bacteria 2738541309 2738897336 810
654 iso_pu_bacteria 2816332298 2817492106 810
655 iso_pu_bacteria 2834028612 2834032924 810
656 iso_pu_bacteria 2842826826 2842828135 810
657 iso_pu_bacteria 2842837860 2842842801 810
658 iso_pu_bacteria 2852612431 2852613608 810
659 iso_pu_bacteria 2852667396 2852668656 810
660 iso_pu_bacteria 2860867994 2860871222 810
661 iso_pu_bacteria 2908446538 2908450576 810
662 iso_pu_bacteria 2929189879 2929193282 810
663 iso_pu_bacteria 2931390751 2931394598 810
664 iso_pu_bacteria 2946027586 2946031578 810
665 iso_pu_bacteria 2947233263 2947238550 810
666 iso_pu_bacteria 8054347763 8054348570 810
667 iso_pu_bacteria 8054503363 8054507101 810
668 iso_pu_bacteria 8055817908 8055822051 810
669 iso_pu_bacteria 8056161164 8056161707 810
670 3300009011 Ga0105251_10003228 Ga0105251_100032289 811
671 3300009148 Ga0105243_10002427 Ga0105243_100024279 811
672 3300014497 Ga0182008_10000544 Ga0182008_100005446 811
673 3300025735 Ga0207713_1009590 Ga0207713_10095902 811
674 3300025935 Ga0207709_10001540 Ga0207709_1000154010 811
675 3300046457 Ga0495590_0011298 Ga0495590_0011298_577_3048 811
676 3300046460 Ga0495638_0001203 Ga0495638_0001203_15423_17894 811
677 3300046530 Ga0495654_0002136 Ga0495654_0002136_6775_9246 811
678 3300046694 Ga0495649_0000876 Ga0495649_0000876_11865_14372 811
679 3300046810 Ga0495660_0027758 Ga0495660_0027758_441_2948 811
680 3300047320 Ga0495672_0000946 Ga0495672_0000946_18420_20891 811
681 3300047323 Ga0495683_0005758 Ga0495683_0005758_1993_4500 811
682 3300047446 Ga0495679_000659 Ga0495679_000659_19322_21793 811
683 3300047469 Ga0495673_0004412 Ga0495673_0004412_5845_8316 811
684 3300048913 Ga0496110_0056473 Ga0496110_0056473_523_2994 811
685 3300048920 Ga0496117_0000621 Ga0496117_0000621_2516_4996 811
686 3300048925 Ga0496122_0006687 Ga0496122_0006687_7125_9605 811
687 3300048926 Ga0496123_0002638 Ga0496123_0002638_15594_18074 811
688 3300048927 Ga0496124_0004687 Ga0496124_0004687_9851_12322 811
689 3300049459 Ga0495678_011772 Ga0495678_011772_187_2658 811
690 iso_pu_bacteria 2808606361 2808857548 811
691 iso_pu_bacteria 2808606376 2808925252 811
692 iso_pu_bacteria 2808606378 2808937718 811
693 iso_pu_bacteria 2808606380 2808947400 811
694 iso_pu_bacteria 2808606383 2808966032 811
695 iso_pu_bacteria 2808606389 2809000924 811
696 3300009545 Ga0105237_10000009 Ga0105237_10000009305 812
697 3300013105 Ga0157369_10007474 Ga0157369_100074744 812
698 3300013308 Ga0157375_10000930 Ga0157375_100009305 812
699 3300014497 Ga0182008_10001477 Ga0182008_100014774 812
700 3300025914 Ga0207671_10000561 Ga0207671_1000056135 812
701 3300042010 Ga0439452_003099 Ga0439452_003099_2285_4765 812
702 3300046454 Ga0495592_0002034 Ga0495592_0002034_560_3031 812
703 3300046460 Ga0495638_0006333 Ga0495638_0006333_5703_8207 812
704 3300046463 Ga0495653_0001725 Ga0495653_0001725_3790_6261 812
705 3300046471 Ga0495650_0001290 Ga0495650_0001290_5940_8411 812
706 3300046491 Ga0495584_0003400 Ga0495584_0003400_37_2541 812
707 3300046519 Ga0495632_0004501 Ga0495632_0004501_5612_8152 812
708 3300046520 Ga0495637_0001931 Ga0495637_0001931_6079_8583 812
709 3300046542 Ga0495597_0001278 Ga0495597_0001278_15745_18285 812
710 3300046543 Ga0495645_0011624 Ga0495645_0011624_184_2655 812
711 3300046690 Ga0495624_0000246 Ga0495624_0000246_10958_13429 812
712 3300047317 Ga0495604_0002090 Ga0495604_0002090_12691_15162 812
713 3300047320 Ga0495672_0002300 Ga0495672_0002300_3803_6274 812
714 3300047321 Ga0495676_0003503 Ga0495676_0003503_660_3131 812
715 3300047322 Ga0495680_0041726 Ga0495680_0041726_841_3312 812
716 3300047470 Ga0495681_0000987 Ga0495681_0000987_5084_7555 812
717 3300047470 Ga0495681_0009773 Ga0495681_0009773_2495_4999 812
718 3300047471 Ga0495684_0021727 Ga0495684_0021727_1178_3649 812
719 3300047472 Ga0495686_0000919 Ga0495686_0000919_16004_18544 812
720 3300048925 Ga0496122_0061700 Ga0496122_0061700_215_2671 812
721 3300048929 Ga0496126_0012627 Ga0496126_0012627_5180_7636 812
722 iso_pu_bacteria 2511231156 2511823964 812
723 iso_pu_bacteria 2599185188 2599503214 812
724 iso_pu_bacteria 2599185212 2599612270 812
725 iso_pu_bacteria 2599185248 2599769775 812
726 iso_pu_bacteria 2599185289 2599887097 812
727 iso_pu_bacteria 2599185291 2599898738 812
728 iso_pu_bacteria 2599185300 2599933727 812
729 iso_pu_bacteria 2599185302 2599942780 812
730 iso_pu_bacteria 2599185304 2599953529 812
731 iso_pu_bacteria 2599185305 2599959196 812
732 iso_pu_bacteria 2599185306 2599964465 812
733 iso_pu_bacteria 2599185308 2599975662 812
734 iso_pu_bacteria 2599185309 2599982210 812
735 iso_pu_bacteria 2599185310 2599989014 812
736 iso_pu_bacteria 2599185311 2599993167 812
737 iso_pu_bacteria 2599185312 2599999522 812
738 iso_pu_bacteria 2599185313 2600007768 812
739 iso_pu_bacteria 2599185314 2600009701 812
740 iso_pu_bacteria 2599185315 2600016959 812
741 iso_pu_bacteria 2599185316 2600022827 812
742 iso_pu_bacteria 2599185317 2600030259 812
743 iso_pu_bacteria 2599185318 2600036660 812
744 iso_pu_bacteria 2599185319 2600039479 812
745 iso_pu_bacteria 2599185320 2600046968 812
746 iso_pu_bacteria 2599185321 2600051782 812
747 iso_pu_bacteria 2599185322 2600057920 812
748 iso_pu_bacteria 2599185323 2600068675 812
749 iso_pu_bacteria 2599185324 2600070014 812
750 iso_pu_bacteria 2599185325 2600076195 812
751 iso_pu_bacteria 2600254930 2600359836 812
752 iso_pu_bacteria 2643221650 2644282229 812
753 iso_pu_bacteria 2651869719 2652545395 812
754 iso_pu_bacteria 2667528170 2671091230 812
755 iso_pu_bacteria 2667528176 2671128459 812
756 iso_pu_bacteria 2675903515 2678262956 812
757 iso_pu_bacteria 2713897148 2715753100 812
758 iso_pu_bacteria 2744054620 2745009293 812
759 iso_pu_bacteria 2791355520 2794596708 812
760 iso_pu_bacteria 2826581358 2826584532 812
761 iso_pu_bacteria 2842815866 2842818087 812
762 iso_pu_bacteria 2842832357 2842835384 812
763 iso_pu_bacteria 2842843487 2842847157 812
764 iso_pu_bacteria 2842849001 2842849278 812
765 iso_pu_bacteria 2842854478 2842854930 812
766 iso_pu_bacteria 2844665904 2844669667 812
767 iso_pu_bacteria 2919385768 2919386851 812
768 iso_pu_bacteria 2919487758 2919492368 812
769 iso_pu_bacteria 2931369376 2931374418 812
770 iso_pu_bacteria 2974289157 2974291649 812
771 iso_pu_bacteria 2988728565 2988729806 812
772 iso_pu_bacteria 2998139840 2998142132 812
773 iso_pu_bacteria 3007866637 3007868382 812
774 iso_pu_bacteria 8029995093 8029998559 812
775 iso_pu_bacteria 8056143049 8056147055 812
776 iso_pu_bacteria 8056166840 8056168942 812
777 3300046524 Ga0495648_0000585 Ga0495648_0000585_27569_30046 813
778 iso_pu_bacteria 2511231004 2511255363 813
779 iso_pu_bacteria 2511231007 2511271239 813
780 iso_pu_bacteria 2511231008 2511279941 813
781 iso_pu_bacteria 2511231010 2511290861 813
782 iso_pu_bacteria 2511231011 2511293622 813
783 iso_pu_bacteria 2511231012 2511304956 813
784 iso_pu_bacteria 2511231014 2511316416 813
785 iso_pu_bacteria 2511231016 2511328363 813
786 iso_pu_bacteria 2511231017 2511332893 813
787 iso_pu_bacteria 2511231018 2511340964 813
788 iso_pu_bacteria 2511231019 2511346777 813
789 iso_pu_bacteria 2511231020 2511351733 813
790 iso_pu_bacteria 2511231021 2511358187 813
791 iso_pu_bacteria 2511231022 2511364152 813
792 iso_pu_bacteria 2511231023 2511370571 813
793 iso_pu_bacteria 2511231031 2511416063 813
794 iso_pu_bacteria 2623620443 2624480003 813
795 iso_pu_bacteria 2643221565 2643843542 813
796 iso_pu_bacteria 2643221589 2643953718 813
797 iso_pu_bacteria 2643221602 2644021651 813
798 iso_pu_bacteria 2643221633 2644190293 813
799 iso_pu_bacteria 2738543004 2739201990 813
800 iso_pu_bacteria 2738543015 2739260054 813
801 iso_pu_bacteria 2738543025 2739316761 813
802 iso_pu_bacteria 2773857670 2774123060 813
803 iso_pu_bacteria 2773857673 2774137448 813
804 iso_pu_bacteria 2784132063 2784263770 813
805 iso_pu_bacteria 2784132072 2784315534 813
806 iso_pu_bacteria 2808606377 2808930072 813
807 iso_pu_bacteria 2808606381 2808952363 813
808 iso_pu_bacteria 2808606445 2809214208 813
809 iso_pu_bacteria 2818991456 2819656563 813
810 iso_pu_bacteria 2825651385 2825656881 813
811 iso_pu_bacteria 2852657418 2852658138 813
812 iso_pu_bacteria 2878029506 2878031911 813
813 iso_pu_bacteria 2880230671 2880234173 813
814 iso_pu_bacteria 2904518522 2904522675 813
815 iso_pu_bacteria 2904550169 2904551966 813
816 iso_pu_bacteria 2913036834 2913040671 813
817 iso_pu_bacteria 2919063839 2919068389 813
818 iso_pu_bacteria 2919456309 2919456484 813
819 iso_pu_bacteria 2919481497 2919482220 813
820 iso_pu_bacteria 2923586266 2923587791 813
821 iso_pu_bacteria 2929144301 2929148021 813
822 iso_pu_bacteria 2939636861 2939640116 813
823 iso_pu_bacteria 2969304461 2969306718 813
824 iso_pu_bacteria 3007511990 3007513595 813
825 iso_pu_bacteria 3007614139 3007618259 813
826 iso_pu_bacteria 3007619802 3007620015 813
827 iso_pu_bacteria 3007718800 3007723987 813
828 iso_pu_bacteria 3007855910 3007860566 813
829 iso_pu_bacteria 3007861166 3007862656 813
830 iso_pu_bacteria 8056125926 8056128158 813
831 iso_pu_bacteria 8056155041 8056157060 813
832 iso_pu_bacteria 8056172158 8056175009 813
833 iso_pu_bacteria 8056569372 8056572896 813
834 3300009092 Ga0105250_10000304 Ga0105250_1000030412 814
835 3300009176 Ga0105242_10003458 Ga0105242_1000345812 814
836 3300025711 Ga0207696_1000108 Ga0207696_100010841 814
837 3300025934 Ga0207686_10010366 Ga0207686_100103666 814
838 iso_pu_bacteria 2599185257 2599801962 814
839 iso_pu_bacteria 2643221571 2643871438 814
840 iso_pu_bacteria 2671180172 2671768910 814
841 iso_pu_bacteria 2945928738 2945932724 814
842 iso_pu_bacteria 2945961074 2945962711 814
843 iso_pu_bacteria 2946006987 2946008930 814
844 iso_pu_bacteria 8054285046 8054285357 814
845 iso_pu_bacteria 8056131705 8056135543 814
846 iso_pu_bacteria 8056148874 8056151994 814
847 iso_pu_bacteria 8057798959 8057799670 814
848 iso_pu_bacteria 3007419365 3007422579 815
849 3300006946 Ga0079104_1000325 Ga0079104_100032513 816
850 3300027111 Ga0209281_1000018 Ga0209281_100001840 816
851 3300031548 Ga0307408_100000643 Ga0307408_10000064311 816
852 3300031911 Ga0307412_10001362 Ga0307412_100013626 816
853 3300031911 Ga0307412_10004723 Ga0307412_100047233 816
854 3300041405 Ga0439438_000361 Ga0439438_000361_8210_10678 816
855 3300042010 Ga0439452_006573 Ga0439452_006573_1047_3515 816
856 3300046453 Ga0495627_000137 Ga0495627_000137_64506_66998 816
857 3300046501 Ga0495607_0007717 Ga0495607_0007717_1875_4346 816
858 3300046518 Ga0495631_0003157 Ga0495631_0003157_2532_5024 816
859 3300046519 Ga0495632_0009751 Ga0495632_0009751_2024_4516 816
860 3300046530 Ga0495654_0001616 Ga0495654_0001616_2567_5059 816
861 3300046694 Ga0495649_0031319 Ga0495649_0031319_224_2695 816
862 3300046794 Ga0495589_0002303 Ga0495589_0002303_7562_10033 816
863 3300047320 Ga0495672_0008637 Ga0495672_0008637_2638_5130 816
864 iso_pu_bacteria 2554235341 2555669233 816
865 iso_pu_bacteria 2599185155 2599330308 816
866 iso_pu_bacteria 2599185160 2599357870 816
867 iso_pu_bacteria 2599185161 2599361623 816
868 iso_pu_bacteria 2599185162 2599367945 816
869 iso_pu_bacteria 2599185163 2599374734 816
870 iso_pu_bacteria 2599185164 2599383035 816
871 iso_pu_bacteria 2599185165 2599389582 816
872 iso_pu_bacteria 2599185166 2599393592 816
873 iso_pu_bacteria 2599185168 2599405359 816
874 iso_pu_bacteria 2599185181 2599464686 816
875 iso_pu_bacteria 2599185182 2599468236 816
876 iso_pu_bacteria 2599185186 2599493709 816
877 iso_pu_bacteria 2599185307 2599975317 816
878 iso_pu_bacteria 2599185356 2600217407 816
879 iso_pu_bacteria 2600255283 2601626620 816
880 iso_pu_bacteria 2600255313 2601777577 816
881 iso_pu_bacteria 2667528171 2671098265 816
882 iso_pu_bacteria 2738541271 2738691344 816
883 iso_pu_bacteria 2738543016 2739267119 816
884 iso_pu_bacteria 2818991464 2819703336 816
885 iso_pu_bacteria 2917070673 2917073035 816
886 iso_pu_bacteria 2935353572 2935359451 816
887 iso_pu_bacteria 3007395558 3007401291 816
888 iso_pu_bacteria 637000220 637319568 816
889 3300005288 Ga0065714_10000079 Ga0065714_100000795 817
890 3300042010 Ga0439452_000098 Ga0439452_000098_36615_39119 817
891 3300042127 Ga0450890_000184 Ga0450890_000184_1680_4184 817
892 3300046453 Ga0495627_008328 Ga0495627_008328_514_2985 817
893 3300046455 Ga0495603_0005081 Ga0495603_0005081_3944_6448 817
894 3300046458 Ga0495591_001776 Ga0495591_001776_5035_7539 817
895 3300046460 Ga0495638_0000863 Ga0495638_0000863_14415_16886 817
896 3300046474 Ga0495605_0021314 Ga0495605_0021314_546_3050 817
897 3300046491 Ga0495584_0000399 Ga0495584_0000399_12479_14983 817
898 3300046491 Ga0495584_0014937 Ga0495584_0014937_1158_3662 817
899 3300046492 Ga0495585_0000016 Ga0495585_0000016_88085_90589 817
900 3300046492 Ga0495585_0019894 Ga0495585_0019894_719_3223 817
901 3300046501 Ga0495607_0001919 Ga0495607_0001919_1592_4132 817
902 3300046506 Ga0495583_0000540 Ga0495583_0000540_19488_21992 817
903 3300046507 Ga0495606_0010712 Ga0495606_0010712_1510_3981 817
904 3300046513 Ga0495616_0001062 Ga0495616_0001062_7098_9602 817
905 3300046518 Ga0495631_0001024 Ga0495631_0001024_1770_4274 817
906 3300046518 Ga0495631_0001633 Ga0495631_0001633_3792_6263 817
907 3300046518 Ga0495631_0008356 Ga0495631_0008356_1526_4030 817
908 3300046519 Ga0495632_0003477 Ga0495632_0003477_7496_10000 817
909 3300046519 Ga0495632_0008950 Ga0495632_0008950_2574_5081 817
910 3300046520 Ga0495637_0000957 Ga0495637_0000957_1046_3550 817
911 3300046520 Ga0495637_0006284 Ga0495637_0006284_2739_5243 817
912 3300046522 Ga0495643_0012233 Ga0495643_0012233_1098_3638 817
913 3300046523 Ga0495644_0000240 Ga0495644_0000240_19812_22283 817
914 3300046524 Ga0495648_0007982 Ga0495648_0007982_227_2731 817
915 3300046528 Ga0495642_0000419 Ga0495642_0000419_12633_15137 817
916 3300046538 Ga0495609_0001015 Ga0495609_0001015_10171_12675 817
917 3300046557 Ga0495622_0001451 Ga0495622_0001451_1536_4076 817
918 3300046615 Ga0495656_0005899 Ga0495656_0005899_1038_3542 817
919 3300046660 Ga0495625_0018969 Ga0495625_0018969_2066_4570 817
920 3300046674 Ga0495588_0002797 Ga0495588_0002797_4828_7368 817
921 3300046684 Ga0495669_0000311 Ga0495669_0000311_14562_17066 817
922 3300046691 Ga0495670_0000578 Ga0495670_0000578_1565_4105 817
923 3300046691 Ga0495670_0009626 Ga0495670_0009626_1902_4406 817
924 3300046692 Ga0495671_0000289 Ga0495671_0000289_24471_26975 817
925 3300046692 Ga0495671_0000399 Ga0495671_0000399_18157_20697 817
926 3300046694 Ga0495649_0012248 Ga0495649_0012248_567_3038 817
927 3300046794 Ga0495589_0004256 Ga0495589_0004256_4921_7425 817
928 3300046810 Ga0495660_0004211 Ga0495660_0004211_2189_4660 817
929 3300047320 Ga0495672_0001020 Ga0495672_0001020_14792_17263 817
930 3300047323 Ga0495683_0002143 Ga0495683_0002143_1771_4275 817
931 3300047323 Ga0495683_0004680 Ga0495683_0004680_3733_6237 817
932 3300047445 Ga0495677_0000389 Ga0495677_0000389_9740_12244 817
933 3300047446 Ga0495679_004918 Ga0495679_004918_2443_4947 817
934 3300047470 Ga0495681_0002615 Ga0495681_0002615_8143_10614 817
935 3300048919 Ga0496116_0002222 Ga0496116_0002222_2947_5418 817
936 3300048920 Ga0496117_0002827 Ga0496117_0002827_3644_6115 817
937 3300048921 Ga0496118_0003256 Ga0496118_0003256_15143_17614 817
938 3300048926 Ga0496123_0002229 Ga0496123_0002229_18464_20935 817
939 3300049459 Ga0495678_004483 Ga0495678_004483_4591_7095 817
940 iso_pu_bacteria 2623620446 2624492970 817
941 iso_pu_bacteria 2860339153 2860342058 817
942 iso_pu_bacteria 2919697872 2919699754 817
943 iso_pu_bacteria 2931396565 2931400970 817
944 iso_pu_bacteria 8019775933 8019775975 817
945 iso_pu_bacteria 8056177738 8056178935 817
946 3300009011 Ga0105251_10002980 Ga0105251_1000298011 818
947 3300046507 Ga0495606_0001484 Ga0495606_0001484_13773_16247 818
948 3300048927 Ga0496124_0001537 Ga0496124_0001537_5152_7638 818
949 3300048928 Ga0496125_0002577 Ga0496125_0002577_14954_17440 818
950 3300047470 Ga0495681_0004899 Ga0495681_0004899_3547_6024 819
951 iso_pu_bacteria 2600254931 2600367501 819
952 3300002737 JGI25162J39368_1000050 JGI25162J39368_100005066 820
953 3300002771 JGI25163J39215_1000102 JGI25163J39215_100010224 820
954 3300002772 JGI25164J39214_1000025 JGI25164J39214_100002595 820
955 3300003214 JGI25165J46597_1000114 JGI25165J46597_100011495 820
956 3300003214 JGI25165J46597_1000176 JGI25165J46597_100017636 820
957 3300025207 Ga0209760_100033 Ga0209760_10003324 820
958 3300025231 Ga0207427_100003 Ga0207427_100003887 820
959 3300025233 Ga0209437_100002 Ga0209437_100002127 820
960 3300025261 Ga0209233_1000004 Ga0209233_10000041299 820
961 iso_pu_bacteria 2511231006 2511264325 820
962 iso_pu_bacteria 2582580891 2583793320 820
963 iso_pu_bacteria 2597489887 2597857291 820
964 iso_pu_bacteria 2599185185 2599484774 820
965 iso_pu_bacteria 2740892503 2743736715 820
966 iso_pu_bacteria 2923153595 2923155733 820
967 iso_pu_bacteria 2984286254 2984290293 820
968 iso_pu_bacteria 8015687852 8015689984 820
969 iso_pu_bacteria 8055770955 8055773088 820

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

714

835

0.97

PF02687

FtsX

FtsX-like permease family

267

392

0.91

PF12704

MacB_PCD

MacB-like periplasmic core domain

485

681

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ir5-assembly1.cif.gz_A crystal structure of narghi mutant narg-h49c 0.7541 141 185
8tzj-assembly1.cif.gz_D cryo-em structure of vibrio cholerae ftse/ftsx complex 0.6637 230 366
5f9q-assembly1.cif.gz_A crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria 0.662 497 668
3ftj-assembly1.cif.gz_A crystal structure of the periplasmic region of macb from actinobacillus actinomycetemcomitans 0.6447 496 674
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.6321 489 668
ID Description Score Start End Superfamily
af_Q5BL07_3_99_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5626 555 645 2.40.40.20
2iv2X04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5489 129 205 2.40.40.20
1kqgA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5233 534 623 2.40.40.20
af_P33602_811_906_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.5223 121 205 2.40.40.20
af_Q5BL07_3_99_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.4996 555 645 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A0R2TH66-F1-model_v4 Uncharacterized protein 0.8171 350 820 GO:0005886
AF-A0A0R2TH66-F1-model_v4 Uncharacterized protein 0.814 350 820 GO:0005886
AF-A0A1V3A126-F1-model_v4 ABC transporter permease 0.8096 9 815 GO:0005886
AF-A0A1S9CVS1-F1-model_v4 Macrolide export ATP-binding/permease protein MacB 0.8087 4 819 GO:0005886
AF-A0A1S9CVS1-F1-model_v4 Macrolide export ATP-binding/permease protein MacB 0.8045 4 819 GO:0005886

Feature Viewer

pLDDT pTM Quality
78.07 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map