F485844

General Info

Members Datasets Scaffolds Average Seq Length
924 385 745 394

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000401|JGI25162J39368_100040131
Length 401
Sequence MSGAIDTCVSNRRSLVFLAITLLSFLAASSVPTPLYHLYQETLHFSPAVLTLIFGVYAISLLAALLTVGSLSDHLGRRPVIFVALLLNILAMLLFINESGVQWLIAARVMQGFATGMATSVLGAALLDTDRQQGPLVNSVAPLLGMACGAMGASLLVEFAPLPLQLSYWLLLGVFVLQAGYVWRLPETVSPQPGAWASLKPTLHVPVQARRALWLALPVDVAVWAVGGFYLSLAPSLVRAATGSTSNLIGGGLVAVLTLSGAVMIFSLRHRPADKVLRLGAGMLATGVMLILAAVHSASLPLFFFGTLVLGSGFGAGFLGALRSVVPLALPHERAGLMSAFYVLSYLAFCLPALLAGNLTRSFGLIATTDGYGAVLVLLSLGALLALMRQRPVAACGAAGL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231010 Pseudomonas sp. GM25 Isolate Nodule
5 2511231011 Pseudomonas sp. GM30 Isolate Nodule
6 2511231015 Pseudomonas sp. GM49 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231021 Pseudomonas sp. GM78 Isolate Nodule
12 2511231023 Pseudomonas sp. GM80 Isolate Nodule
13 2511231031 Pseudomonas sp. GM16 Isolate Nodule
14 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
15 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
16 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
17 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
18 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
19 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
20 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
21 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
22 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
23 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
24 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
25 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
26 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
27 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
28 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
29 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
30 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
31 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
32 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
33 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
34 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
35 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
36 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
37 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
38 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
39 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
40 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
41 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
42 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
43 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
44 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
45 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
46 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
47 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
48 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
49 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
50 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
51 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
52 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
53 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
54 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
55 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
56 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
57 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
58 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
59 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
60 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
61 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
62 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
63 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
64 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
65 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
66 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
67 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
68 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
69 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
70 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
71 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
72 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
73 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
74 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
75 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
76 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
77 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
78 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
79 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
80 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
81 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
82 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
83 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
84 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
85 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
86 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
87 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
88 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
89 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
90 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
91 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
92 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
93 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
94 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
95 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
96 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
97 2773857670 Pseudomonas sp. 478 Isolate Unclassified
98 2773857673 Pseudomonas sp. 443 Isolate Unclassified
99 2784132063 Pseudomonas sp. 424 Isolate Unclassified
100 2784132072 Pseudomonas sp. 460 Isolate Unclassified
101 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
102 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
103 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
104 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
105 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
106 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
107 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
108 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
109 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
110 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
111 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
112 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
113 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
114 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
115 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
116 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
117 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
118 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
119 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
120 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
121 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
122 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
123 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
124 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
125 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
126 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
127 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
128 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
129 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
130 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
131 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
132 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
133 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
134 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
135 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
136 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
137 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
138 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
139 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
140 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
141 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
142 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
143 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
144 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
145 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
146 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
147 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
148 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
149 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
150 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
151 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
152 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
153 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
154 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
155 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
156 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
157 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
158 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
159 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
160 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
161 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
162 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
163 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
164 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
165 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
166 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
167 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
168 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
169 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
170 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
171 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
172 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
173 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
174 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
175 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
176 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
177 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
178 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
179 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
180 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
181 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
182 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
183 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
184 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
185 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
186 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
187 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
188 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
189 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
190 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
191 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
192 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
193 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
194 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
195 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
196 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
197 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
198 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
199 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
200 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
201 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
202 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
203 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
204 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
205 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
211 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
212 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
234 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
235 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
236 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
246 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
247 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
248 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
251 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
252 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
253 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
254 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
255 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
256 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
257 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
258 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
259 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
260 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
261 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
262 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
263 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
264 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
265 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
266 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
267 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
268 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
269 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
270 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
281 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
332 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
365 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
368 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
369 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
370 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
371 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
372 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
373 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
374 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
375 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
376 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
377 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
378 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
379 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
380 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
381 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
382 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
383 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
384 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
385 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.63
Metatranscriptomes 0
Isolates 19.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 1.73
Rhizoplane 6.93
Rhizosphere 76.84
Stem 0
Stem Tuber 0
Unclassified 9.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_121 2124908027 Bacteria 23366
2 MRS2a_Contig_928 2124908027 Bacteria 8221
3 JGI25162J39368_1000401 3300002737 Bacteria 36292
4 JGI25162J39368_1000412 3300002737 Bacteria 34976
5 JGI25163J39215_1000722 3300002771 Bacteria 8568
6 JGI25163J39215_1000731 3300002771 Bacteria 8449
7 JGI25164J39214_1000282 3300002772 Bacteria 36292
8 JGI25164J39214_1000291 3300002772 Bacteria 34976
9 JGI25165J46597_1000520 3300003214 Bacteria 36292
10 JGI25165J46597_1000538 3300003214 Bacteria 34976
11 rootH1_10232297 3300003323 Bacteria 4097
12 Ga0055536_1000111 3300003781 Bacteria 71634
13 Ga0055536_1000727 3300003781 Bacteria 22112
14 Ga0055530_10000146 3300003791 Bacteria 63397
15 Ga0055530_10000299 3300003791 Bacteria 45066
16 Ga0055530_10000634 3300003791 Bacteria 30257
17 Ga0055540_1000289 3300003792 Bacteria 45066
18 Ga0055540_1000390 3300003792 Bacteria 36134
19 Ga0055540_1001454 3300003792 Bacteria 14118
20 Ga0055531_10000546 3300003794 Bacteria 33355
21 Ga0065714_10000086 3300005288 Bacteria 12145
22 Ga0065714_10010899 3300005288 Bacteria 2784
23 Ga0065714_10011589 3300005288 Bacteria 3920
24 Ga0065714_10064686 3300005288 Bacteria 23557
25 Ga0065714_10066647 3300005288 Bacteria 6512
26 Ga0065714_10066807 3300005288 Bacteria 6272
27 Ga0065714_10066954 3300005288 Bacteria 6057
28 Ga0065712_10000074 3300005290 Bacteria 3591
29 Ga0070670_100013921 3300005331 Bacteria 6898
30 Ga0070661_100000583 3300005344 Bacteria 27739
31 Ga0070669_100002265 3300005353 Bacteria 13964
32 Ga0070714_100073970 3300005435 Bacteria 2953
33 Ga0070662_100005483 3300005457 Bacteria 8110
34 Ga0068853_100004607 3300005539 Bacteria 10702
35 Ga0070665_100017490 3300005548 Bacteria 7199
36 Ga0070664_100006005 3300005564 Bacteria 9818
37 Ga0068851_10001533 3300005834 Bacteria 10123
38 Ga0075364_10038173 3300006051 Bacteria 3111
39 Ga0075364_10117186 3300006051 Bacteria 1781
40 Ga0075432_10024228 3300006058 Bacteria 2079
41 Ga0075436_100130792 3300006914 Bacteria 1760
42 Ga0079104_1000433 3300006946 Bacteria 47726
43 Ga0105251_10003278 3300009011 Bacteria 11866
44 Ga0105251_10004533 3300009011 Bacteria 9418
45 Ga0105251_10005623 3300009011 Bacteria 8148
46 Ga0105251_10009193 3300009011 Bacteria 5865
47 Ga0105251_10012782 3300009011 Bacteria 4731
48 Ga0105244_10001357 3300009036 Bacteria 19937
49 Ga0105244_10002261 3300009036 Bacteria 14653
50 Ga0105244_10010446 3300009036 Bacteria 5630
51 Ga0105244_10011409 3300009036 Bacteria 5332
52 Ga0105250_10000232 3300009092 Bacteria 46504
53 Ga0105250_10006210 3300009092 Bacteria 5245
54 Ga0105250_10007279 3300009092 Bacteria 4764
55 Ga0105243_10000582 3300009148 Bacteria 36687
56 Ga0105243_10001065 3300009148 Bacteria 25112
57 Ga0105243_10073455 3300009148 Bacteria 2771
58 Ga0105243_10330894 3300009148 Bacteria 1391
59 Ga0105242_10005806 3300009176 Bacteria 9506
60 Ga0105237_10001739 3300009545 Bacteria 28110
61 Ga0105246_10000325 3300011119 Bacteria 25253
62 Ga0105246_10002743 3300011119 Bacteria 10653
63 Ga0105246_10126886 3300011119 Bacteria 1900
64 Ga0157345_1000125 3300012498 Bacteria 15102
65 Ga0157373_10007713 3300013100 Bacteria 7998
66 Ga0157373_10014693 3300013100 Bacteria 5735
67 Ga0157373_10014828 3300013100 Bacteria 5709
68 Ga0157373_10015976 3300013100 Bacteria 5481
69 Ga0157373_10016383 3300013100 Bacteria 5408
70 Ga0157373_10025076 3300013100 Bacteria 4316
71 Ga0157373_10027008 3300013100 Bacteria 4143
72 Ga0157373_10049609 3300013100 Bacteria 2990
73 Ga0157373_10163779 3300013100 Bacteria 1565
74 Ga0157371_10000923 3300013102 Bacteria 32990
75 Ga0157371_10001987 3300013102 Bacteria 20249
76 Ga0157371_10007299 3300013102 Bacteria 8978
77 Ga0157370_10009927 3300013104 Bacteria 10083
78 Ga0157370_10052640 3300013104 Bacteria 3886
79 Ga0157370_10060812 3300013104 Bacteria 3585
80 Ga0157370_10187879 3300013104 Bacteria 1918
81 Ga0157369_10005784 3300013105 Bacteria 14375
82 Ga0157369_10007408 3300013105 Bacteria 12635
83 Ga0157369_10021535 3300013105 Bacteria 7211
84 Ga0157369_10079052 3300013105 Bacteria 3523
85 Ga0157369_10160673 3300013105 Bacteria 2372
86 Ga0163162_10003705 3300013306 Bacteria 14643
87 Ga0163162_10084771 3300013306 Bacteria 3245
88 Ga0157372_10007707 3300013307 Bacteria 11448
89 Ga0157375_10010903 3300013308 Bacteria 8014
90 Ga0157375_10074194 3300013308 Bacteria 3423
91 Ga0157375_10171442 3300013308 Bacteria 2318
92 Ga0182008_10000586 3300014497 Bacteria 26857
93 Ga0182008_10003003 3300014497 Bacteria 10377
94 Ga0182008_10006743 3300014497 Bacteria 6390
95 Ga0182008_10007964 3300014497 Bacteria 5812
96 Ga0182008_10010003 3300014497 Bacteria 5093
97 Ga0182008_10010392 3300014497 Bacteria 4981
98 Ga0182006_1001437 3300015261 Bacteria 14410
99 Ga0182006_1003132 3300015261 Bacteria 8656
100 Ga0182006_1007212 3300015261 Bacteria 5106
101 Ga0182007_10001683 3300015262 Bacteria 11711
102 Ga0182007_10010428 3300015262 Bacteria 3671
103 Ga0182007_10018839 3300015262 Bacteria 2494
104 Ga0182005_1000824 3300015265 Bacteria 13951
105 Ga0182005_1013542 3300015265 Bacteria 2293
106 Ga0182005_1018297 3300015265 Bacteria 1935
107 Ga0182005_1022668 3300015265 Bacteria 1720
108 Ga0163161_10001215 3300017792 Bacteria 19407
109 Ga0163161_10005635 3300017792 Bacteria 8684
110 Ga0163161_10035426 3300017792 Bacteria 3572
111 Ga0163161_10038720 3300017792 Bacteria 3421
112 Ga0163161_10047768 3300017792 Bacteria 3090
113 Ga0163161_10071395 3300017792 Bacteria 2540
114 Ga0163161_10148504 3300017792 Bacteria 1780
115 Ga0209760_100028 3300025207 Bacteria 153020
116 Ga0209760_100163 3300025207 Bacteria 39216
117 Ga0209563_110457 3300025230 Bacteria 1352
118 Ga0207427_100007 3300025231 Bacteria 746220
119 Ga0207427_100008 3300025231 Bacteria 740731
120 Ga0209437_100006 3300025233 Bacteria 1042724
121 Ga0209437_100014 3300025233 Bacteria 740714
122 Ga0209233_1000008 3300025261 Bacteria 1356712
123 Ga0209233_1000086 3300025261 Bacteria 331687
124 Ga0209675_1002342 3300025291 Bacteria 9782
125 Ga0209676_1000006 3300025292 Bacteria 1039588
126 Ga0209676_1000016 3300025292 Bacteria 655561
127 Ga0209676_1000033 3300025292 Bacteria 463236
128 Ga0209050_1000070 3300025298 Bacteria 296366
129 Ga0209050_1000399 3300025298 Bacteria 81236
130 Ga0209050_1000477 3300025298 Bacteria 70798
131 Ga0209051_1000043 3300025303 Bacteria 305473
132 Ga0209051_1000086 3300025303 Bacteria 183550
133 Ga0209051_1000106 3300025303 Bacteria 159222
134 Ga0209257_1000604 3300025304 Bacteria 59301
135 Ga0209257_1007864 3300025304 Bacteria 6283
136 Ga0207656_10000182 3300025321 Bacteria 22596
137 Ga0207696_1000025 3300025711 Bacteria 418650
138 Ga0207696_1000708 3300025711 Bacteria 22680
139 Ga0207696_1001107 3300025711 Bacteria 15720
140 Ga0207696_1003011 3300025711 Bacteria 7870
141 Ga0207655_1000113 3300025728 Bacteria 167376
142 Ga0207655_1000269 3300025728 Bacteria 81483
143 Ga0207655_1000448 3300025728 Bacteria 54335
144 Ga0207655_1000863 3300025728 Bacteria 32224
145 Ga0207655_1004360 3300025728 Bacteria 10064
146 Ga0207655_1005839 3300025728 Bacteria 8260
147 Ga0207655_1006095 3300025728 Bacteria 8046
148 Ga0207655_1007048 3300025728 Bacteria 7359
149 Ga0207655_1042673 3300025728 Bacteria 1928
150 Ga0207713_1002442 3300025735 Bacteria 13530
151 Ga0207713_1003318 3300025735 Bacteria 11056
152 Ga0207713_1003877 3300025735 Bacteria 9968
153 Ga0207713_1003884 3300025735 Bacteria 9958
154 Ga0207713_1009955 3300025735 Bacteria 5310
155 Ga0207713_1019988 3300025735 Bacteria 3260
156 Ga0207713_1045270 3300025735 Bacteria 1799
157 Ga0207713_1045917 3300025735 Bacteria 1780
158 Ga0207671_10001830 3300025914 Bacteria 23722
159 Ga0207649_10000061 3300025920 Bacteria 98067
160 Ga0207681_10002526 3300025923 Bacteria 11630
161 Ga0207650_10001064 3300025925 Bacteria 20420
162 Ga0207706_10070083 3300025933 Bacteria 3083
163 Ga0207686_10052003 3300025934 Bacteria 2555
164 Ga0207709_10000053 3300025935 Bacteria 225514
165 Ga0207709_10014724 3300025935 Bacteria 4323
166 Ga0207679_10000018 3300025945 Bacteria 238375
167 Ga0207712_10036241 3300025961 Bacteria 3358
168 Ga0207639_10006923 3300026041 Bacteria 7724
169 Ga0209281_1000331 3300027111 Bacteria 81645
170 Ga0209281_1006777 3300027111 Bacteria 2943
171 Ga0207428_10063484 3300027907 Bacteria 2918
172 Ga0207428_10076825 3300027907 Bacteria 2615
173 Ga0207428_10098898 3300027907 Bacteria 2257
174 Ga0207428_10190164 3300027907 Bacteria 1548
175 Ga0207428_10223057 3300027907 Bacteria 1412
176 Ga0307517_10152992 3300028786 Bacteria 1576
177 Ga0316179_1078203 3300030734 Bacteria 2917
178 Ga0316178_1011502 3300030735 Bacteria 8467
179 Ga0316183_1154384 3300030742 Bacteria 2223
180 Ga0307509_10102173 3300031507 Bacteria 2899
181 Ga0307408_100002794 3300031548 Bacteria 12117
182 Ga0307408_100007990 3300031548 Bacteria 6994
183 Ga0307408_100182624 3300031548 Bacteria 1683
184 Ga0307408_100250211 3300031548 Bacteria 1461
185 Ga0307405_10012041 3300031731 Bacteria 4561
186 Ga0307405_10015369 3300031731 Bacteria 4145
187 Ga0307405_10109643 3300031731 Bacteria 1867
188 Ga0307406_10010034 3300031901 Bacteria 5330
189 Ga0307412_10004703 3300031911 Bacteria 7615
190 Ga0307412_10048714 3300031911 Bacteria 2788
191 Ga0307412_10081867 3300031911 Bacteria 2233
192 Ga0307412_10231337 3300031911 Bacteria 1423
193 Ga0307416_100359111 3300032002 Bacteria 1478
194 Ga0307416_100387978 3300032002 Bacteria 1429
195 Ga0307411_10001157 3300032005 Bacteria 10353
196 Ga0307411_10105255 3300032005 Bacteria 2005
197 Ga0307510_10004948 3300033180 Bacteria 15767
198 Ga0439438_000514 3300041405 Bacteria 17558
199 Ga0439438_002940 3300041405 Bacteria 7070
200 Ga0439438_005280 3300041405 Bacteria 4784
201 Ga0439438_006114 3300041405 Bacteria 4303
202 Ga0439438_007014 3300041405 Bacteria 3897
203 Ga0439438_007150 3300041405 Bacteria 3848
204 Ga0439438_007958 3300041405 Bacteria 3570
205 Ga0439438_008756 3300041405 Bacteria 3327
206 Ga0439447_002277 3300041407 Bacteria 7048
207 Ga0439447_002583 3300041407 Bacteria 6576
208 Ga0439447_014090 3300041407 Bacteria 2249
209 Ga0439447_015386 3300041407 Bacteria 2123
210 Ga0439447_019208 3300041407 Bacteria 1825
211 Ga0439447_030151 3300041407 Bacteria 1368
212 Ga0439466_0001387 3300041411 Bacteria 9441
213 Ga0439466_0003479 3300041411 Bacteria 6103
214 Ga0439466_0007378 3300041411 Bacteria 4164
215 Ga0439466_0053530 3300041411 Bacteria 1316
216 Ga0439465_0008609 3300041413 Bacteria 3219
217 Ga0439445_0022641 3300042004 Bacteria 1586
218 Ga0439432_001278 3300042006 Bacteria 9512
219 Ga0439432_004912 3300042006 Bacteria 4846
220 Ga0439432_013081 3300042006 Bacteria 2826
221 Ga0439451_001959 3300042009 Bacteria 4120
222 Ga0439451_003079 3300042009 Bacteria 3389
223 Ga0439452_000244 3300042010 Bacteria 37543
224 Ga0439452_000266 3300042010 Bacteria 34754
225 Ga0439452_001477 3300042010 Bacteria 9576
226 Ga0439452_012047 3300042010 Bacteria 2469
227 Ga0439452_016806 3300042010 Bacteria 1979
228 Ga0439456_003748 3300042013 Bacteria 3092
229 Ga0439456_008233 3300042013 Bacteria 2152
230 Ga0439463_001643 3300042016 Bacteria 5893
231 Ga0439463_005773 3300042016 Bacteria 3071
232 Ga0450911_000347 3300042115 Bacteria 15955
233 Ga0450911_001754 3300042115 Bacteria 4690
234 Ga0450911_004571 3300042115 Bacteria 2252
235 Ga0450911_005737 3300042115 Bacteria 1899
236 Ga0450919_000576 3300042121 Bacteria 4623
237 Ga0450919_006964 3300042121 Bacteria 1328
238 Ga0450923_002468 3300042125 Bacteria 2659
239 Ga0450890_000704 3300042127 Bacteria 4886
240 Ga0450900_002605 3300042136 Bacteria 1928
241 Ga0450902_001089 3300042137 Bacteria 3606
242 Ga0450902_018181 3300042137 Bacteria 1151
243 Ga0450903_002363 3300042138 Bacteria 3366
244 Ga0450903_015338 3300042138 Bacteria 1207
245 Ga0450905_007785 3300042142 Bacteria 1462
246 Ga0450907_000076 3300042146 Bacteria 37520
247 Ga0450910_001205 3300042147 Bacteria 3217
248 Ga0450909_003127 3300042185 Bacteria 2354
249 Ga0439434_0000359 3300042435 Bacteria 13091
250 Ga0439460_0013324 3300042461 Bacteria 2149
251 Ga0439460_0021264 3300042461 Bacteria 1771
252 Ga0450901_001134 3300042533 Bacteria 3091
253 Ga0439440_0001586 3300042993 Bacteria 4173
254 Ga0495617_000141 3300046452 Bacteria 47430
255 Ga0495617_005122 3300046452 Bacteria 4681
256 Ga0495617_005677 3300046452 Bacteria 4412
257 Ga0495617_009557 3300046452 Bacteria 3327
258 Ga0495617_009729 3300046452 Bacteria 3298
259 Ga0495617_014581 3300046452 Bacteria 2671
260 Ga0495617_017070 3300046452 Bacteria 2451
261 Ga0495617_020304 3300046452 Bacteria 2245
262 Ga0495617_028198 3300046452 Bacteria 1887
263 Ga0495617_030317 3300046452 Bacteria 1818
264 Ga0495627_000985 3300046453 Bacteria 19345
265 Ga0495627_001679 3300046453 Bacteria 12183
266 Ga0495627_007765 3300046453 Bacteria 4087
267 Ga0495627_010066 3300046453 Bacteria 3455
268 Ga0495627_012841 3300046453 Bacteria 2959
269 Ga0495603_0002181 3300046455 Bacteria 11514
270 Ga0495603_0019472 3300046455 Bacteria 4106
271 Ga0495590_0000476 3300046457 Bacteria 19879
272 Ga0495590_0001301 3300046457 Bacteria 10850
273 Ga0495590_0013089 3300046457 Bacteria 3059
274 Ga0495590_0019034 3300046457 Bacteria 2450
275 Ga0495590_0022053 3300046457 Bacteria 2254
276 Ga0495590_0047497 3300046457 Bacteria 1497
277 Ga0495590_0050897 3300046457 Bacteria 1446
278 Ga0495591_000968 3300046458 Bacteria 19624
279 Ga0495591_001024 3300046458 Bacteria 18903
280 Ga0495591_001335 3300046458 Bacteria 15499
281 Ga0495591_002084 3300046458 Bacteria 11522
282 Ga0495591_003568 3300046458 Bacteria 7946
283 Ga0495591_005551 3300046458 Bacteria 5804
284 Ga0495591_010097 3300046458 Bacteria 3691
285 Ga0495591_010997 3300046458 Bacteria 3456
286 Ga0495591_013402 3300046458 Bacteria 3001
287 Ga0495591_015525 3300046458 Bacteria 2686
288 Ga0495591_019672 3300046458 Bacteria 2252
289 Ga0495591_029585 3300046458 Bacteria 1662
290 Ga0495638_0003973 3300046460 Bacteria 11386
291 Ga0495638_0005045 3300046460 Bacteria 9905
292 Ga0495638_0016221 3300046460 Bacteria 4993
293 Ga0495638_0021673 3300046460 Bacteria 4228
294 Ga0495638_0028624 3300046460 Bacteria 3595
295 Ga0495638_0039684 3300046460 Bacteria 2987
296 Ga0495638_0047797 3300046460 Bacteria 2681
297 Ga0495638_0050167 3300046460 Bacteria 2607
298 Ga0495638_0065621 3300046460 Bacteria 2233
299 Ga0495638_0085266 3300046460 Bacteria 1910
300 Ga0495638_0090013 3300046460 Bacteria 1850
301 Ga0495638_0112501 3300046460 Bacteria 1616
302 Ga0495638_0120694 3300046460 Bacteria 1549
303 Ga0495653_0002877 3300046463 Bacteria 13765
304 Ga0495653_0061304 3300046463 Bacteria 2846
305 Ga0495653_0123602 3300046463 Bacteria 1840
306 Ga0495650_0003570 3300046471 Bacteria 11247
307 Ga0495650_0007590 3300046471 Bacteria 6486
308 Ga0495650_0008841 3300046471 Bacteria 5816
309 Ga0495650_0011242 3300046471 Bacteria 4918
310 Ga0495650_0015242 3300046471 Bacteria 3951
311 Ga0495650_0020101 3300046471 Bacteria 3265
312 Ga0495650_0025809 3300046471 Bacteria 2745
313 Ga0495605_0000940 3300046474 Bacteria 19887
314 Ga0495605_0006090 3300046474 Bacteria 6963
315 Ga0495605_0012347 3300046474 Bacteria 4742
316 Ga0495605_0019215 3300046474 Bacteria 3655
317 Ga0495605_0051587 3300046474 Bacteria 2003
318 Ga0495605_0063106 3300046474 Bacteria 1768
319 Ga0495639_0000065 3300046475 Bacteria 48194
320 Ga0495639_0032924 3300046475 Bacteria 2313
321 Ga0495639_0050124 3300046475 Bacteria 1896
322 Ga0495584_0002333 3300046491 Bacteria 10818
323 Ga0495584_0003543 3300046491 Bacteria 8549
324 Ga0495584_0006475 3300046491 Bacteria 6126
325 Ga0495584_0013423 3300046491 Bacteria 4182
326 Ga0495585_0001357 3300046492 Bacteria 19390
327 Ga0495585_0001948 3300046492 Bacteria 15413
328 Ga0495585_0010785 3300046492 Bacteria 5429
329 Ga0495585_0016187 3300046492 Bacteria 4321
330 Ga0495585_0024562 3300046492 Bacteria 3454
331 Ga0495585_0029930 3300046492 Bacteria 3097
332 Ga0495585_0031000 3300046492 Bacteria 3039
333 Ga0495585_0053030 3300046492 Bacteria 2244
334 Ga0495585_0109280 3300046492 Bacteria 1472
335 Ga0495594_0007244 3300046499 Bacteria 5706
336 Ga0495594_0025949 3300046499 Bacteria 3151
337 Ga0495594_0062246 3300046499 Bacteria 2066
338 Ga0495596_0000934 3300046500 Bacteria 17386
339 Ga0495607_0000567 3300046501 Bacteria 36085
340 Ga0495607_0002582 3300046501 Bacteria 14603
341 Ga0495607_0007648 3300046501 Bacteria 7446
342 Ga0495607_0019813 3300046501 Bacteria 4266
343 Ga0495607_0028193 3300046501 Bacteria 3466
344 Ga0495607_0041321 3300046501 Bacteria 2740
345 Ga0495607_0044449 3300046501 Bacteria 2619
346 Ga0495607_0074605 3300046501 Bacteria 1882
347 Ga0495607_0092439 3300046501 Bacteria 1636
348 Ga0495607_0126823 3300046501 Bacteria 1333
349 Ga0495583_0000968 3300046506 Bacteria 33083
350 Ga0495583_0006665 3300046506 Bacteria 7486
351 Ga0495583_0008063 3300046506 Bacteria 6494
352 Ga0495583_0016033 3300046506 Bacteria 4045
353 Ga0495583_0029751 3300046506 Bacteria 2668
354 Ga0495583_0056837 3300046506 Bacteria 1762
355 Ga0495583_0075693 3300046506 Bacteria 1472
356 Ga0495606_0004137 3300046507 Bacteria 14723
357 Ga0495606_0004359 3300046507 Bacteria 14192
358 Ga0495606_0008856 3300046507 Bacteria 8624
359 Ga0495606_0016105 3300046507 Bacteria 5721
360 Ga0495606_0016567 3300046507 Bacteria 5612
361 Ga0495606_0025103 3300046507 Bacteria 4276
362 Ga0495606_0033179 3300046507 Bacteria 3564
363 Ga0495606_0050747 3300046507 Bacteria 2711
364 Ga0495606_0051999 3300046507 Bacteria 2667
365 Ga0495606_0117659 3300046507 Bacteria 1594
366 Ga0495606_0140459 3300046507 Bacteria 1427
367 Ga0495610_0002477 3300046512 Bacteria 15474
368 Ga0495610_0003667 3300046512 Bacteria 11811
369 Ga0495610_0005284 3300046512 Bacteria 9235
370 Ga0495610_0007015 3300046512 Bacteria 7615
371 Ga0495610_0007241 3300046512 Bacteria 7436
372 Ga0495610_0013393 3300046512 Bacteria 4876
373 Ga0495610_0013823 3300046512 Bacteria 4773
374 Ga0495610_0037198 3300046512 Bacteria 2479
375 Ga0495616_0000688 3300046513 Bacteria 25021
376 Ga0495616_0001617 3300046513 Bacteria 15429
377 Ga0495616_0001890 3300046513 Bacteria 14150
378 Ga0495616_0003259 3300046513 Bacteria 10438
379 Ga0495616_0003406 3300046513 Bacteria 10191
380 Ga0495616_0008304 3300046513 Bacteria 6159
381 Ga0495616_0020640 3300046513 Bacteria 3579
382 Ga0495616_0029807 3300046513 Bacteria 2876
383 Ga0495620_0000434 3300046515 Bacteria 27919
384 Ga0495620_0001458 3300046515 Bacteria 14162
385 Ga0495620_0008529 3300046515 Bacteria 5497
386 Ga0495620_0012822 3300046515 Bacteria 4311
387 Ga0495620_0015309 3300046515 Bacteria 3876
388 Ga0495620_0019817 3300046515 Bacteria 3296
389 Ga0495620_0021488 3300046515 Bacteria 3133
390 Ga0495620_0050430 3300046515 Bacteria 1775
391 Ga0495620_0066449 3300046515 Bacteria 1485
392 Ga0495628_0172642 3300046516 Bacteria 1639
393 Ga0495630_0041729 3300046517 Bacteria 3426
394 Ga0495631_0000521 3300046518 Bacteria 25829
395 Ga0495631_0001477 3300046518 Bacteria 14267
396 Ga0495631_0021451 3300046518 Bacteria 3008
397 Ga0495631_0022069 3300046518 Bacteria 2960
398 Ga0495631_0036198 3300046518 Bacteria 2205
399 Ga0495631_0050489 3300046518 Bacteria 1819
400 Ga0495631_0055350 3300046518 Bacteria 1728
401 Ga0495632_0000432 3300046519 Bacteria 39892
402 Ga0495632_0000608 3300046519 Bacteria 33143
403 Ga0495632_0002118 3300046519 Bacteria 15483
404 Ga0495632_0009643 3300046519 Bacteria 5797
405 Ga0495632_0015579 3300046519 Bacteria 4253
406 Ga0495632_0025118 3300046519 Bacteria 3154
407 Ga0495632_0059838 3300046519 Bacteria 1852
408 Ga0495632_0071393 3300046519 Bacteria 1668
409 Ga0495632_0073366 3300046519 Bacteria 1641
410 Ga0495637_0000837 3300046520 Bacteria 20325
411 Ga0495637_0002079 3300046520 Bacteria 11262
412 Ga0495637_0003716 3300046520 Bacteria 8061
413 Ga0495637_0005587 3300046520 Bacteria 6382
414 Ga0495637_0007357 3300046520 Bacteria 5465
415 Ga0495637_0008313 3300046520 Bacteria 5103
416 Ga0495637_0009357 3300046520 Bacteria 4780
417 Ga0495637_0014416 3300046520 Bacteria 3729
418 Ga0495637_0021536 3300046520 Bacteria 2954
419 Ga0495637_0024329 3300046520 Bacteria 2740
420 Ga0495637_0037568 3300046520 Bacteria 2101
421 Ga0495637_0070663 3300046520 Bacteria 1409
422 Ga0495643_0006310 3300046522 Bacteria 7838
423 Ga0495643_0006574 3300046522 Bacteria 7646
424 Ga0495643_0007271 3300046522 Bacteria 7157
425 Ga0495643_0019799 3300046522 Bacteria 3890
426 Ga0495643_0021429 3300046522 Bacteria 3708
427 Ga0495643_0055736 3300046522 Bacteria 2112
428 Ga0495643_0059137 3300046522 Bacteria 2038
429 Ga0495643_0114178 3300046522 Bacteria 1370
430 Ga0495644_0001017 3300046523 Bacteria 11693
431 Ga0495644_0001772 3300046523 Bacteria 8706
432 Ga0495644_0009347 3300046523 Bacteria 3780
433 Ga0495648_0003287 3300046524 Bacteria 14282
434 Ga0495648_0004727 3300046524 Bacteria 11535
435 Ga0495648_0007722 3300046524 Bacteria 8567
436 Ga0495648_0015729 3300046524 Bacteria 5477
437 Ga0495648_0024542 3300046524 Bacteria 4103
438 Ga0495648_0036117 3300046524 Bacteria 3193
439 Ga0495648_0040463 3300046524 Bacteria 2955
440 Ga0495648_0045101 3300046524 Bacteria 2745
441 Ga0495648_0056475 3300046524 Bacteria 2361
442 Ga0495648_0057483 3300046524 Bacteria 2332
443 Ga0495648_0058528 3300046524 Bacteria 2304
444 Ga0495648_0115136 3300046524 Bacteria 1455
445 Ga0495666_0008103 3300046526 Bacteria 5268
446 Ga0495666_0033682 3300046526 Bacteria 2501
447 Ga0495666_0047894 3300046526 Bacteria 2059
448 Ga0495666_0058766 3300046526 Bacteria 1839
449 Ga0495666_0060725 3300046526 Bacteria 1806
450 Ga0495642_0000172 3300046528 Bacteria 37956
451 Ga0495642_0000827 3300046528 Bacteria 14822
452 Ga0495642_0001419 3300046528 Bacteria 10740
453 Ga0495654_0001740 3300046530 Bacteria 14599
454 Ga0495654_0001776 3300046530 Bacteria 14405
455 Ga0495654_0003337 3300046530 Bacteria 9893
456 Ga0495654_0005587 3300046530 Bacteria 7277
457 Ga0495654_0010615 3300046530 Bacteria 5005
458 Ga0495654_0017039 3300046530 Bacteria 3825
459 Ga0495654_0017187 3300046530 Bacteria 3806
460 Ga0495654_0018968 3300046530 Bacteria 3599
461 Ga0495654_0022047 3300046530 Bacteria 3312
462 Ga0495654_0025046 3300046530 Bacteria 3076
463 Ga0495654_0055270 3300046530 Bacteria 1922
464 Ga0495654_0068056 3300046530 Bacteria 1693
465 Ga0495654_0071364 3300046530 Bacteria 1645
466 Ga0495587_0015865 3300046536 Bacteria 4693
467 Ga0495609_0001480 3300046538 Bacteria 15583
468 Ga0495609_0010467 3300046538 Bacteria 4445
469 Ga0495609_0011673 3300046538 Bacteria 4180
470 Ga0495609_0031527 3300046538 Bacteria 2408
471 Ga0495609_0033063 3300046538 Bacteria 2348
472 Ga0495609_0035664 3300046538 Bacteria 2250
473 Ga0495609_0085765 3300046538 Bacteria 1373
474 Ga0495609_0086838 3300046538 Bacteria 1363
475 Ga0495597_0001891 3300046542 Bacteria 14256
476 Ga0495597_0005760 3300046542 Bacteria 6506
477 Ga0495597_0005961 3300046542 Bacteria 6359
478 Ga0495597_0006150 3300046542 Bacteria 6242
479 Ga0495597_0013147 3300046542 Bacteria 3973
480 Ga0495597_0032700 3300046542 Bacteria 2358
481 Ga0495597_0036137 3300046542 Bacteria 2226
482 Ga0495597_0043214 3300046542 Bacteria 2007
483 Ga0495597_0046965 3300046542 Bacteria 1912
484 Ga0495597_0055974 3300046542 Bacteria 1728
485 Ga0495597_0076499 3300046542 Bacteria 1435
486 Ga0495597_0081848 3300046542 Bacteria 1380
487 Ga0495622_0000424 3300046557 Bacteria 27860
488 Ga0495622_0000946 3300046557 Bacteria 15558
489 Ga0495622_0001179 3300046557 Bacteria 13510
490 Ga0495622_0004741 3300046557 Bacteria 6295
491 Ga0495622_0017851 3300046557 Bacteria 3303
492 Ga0495633_0003869 3300046558 Bacteria 9780
493 Ga0495633_0026023 3300046558 Bacteria 2874
494 Ga0495633_0026523 3300046558 Bacteria 2842
495 Ga0495633_0082438 3300046558 Bacteria 1496
496 Ga0495633_0084875 3300046558 Bacteria 1473
497 Ga0495656_0001717 3300046615 Bacteria 7169
498 Ga0495668_0003274 3300046616 Bacteria 12308
499 Ga0495668_0005658 3300046616 Bacteria 8381
500 Ga0495668_0010878 3300046616 Bacteria 5478
501 Ga0495634_0002102 3300046642 Bacteria 16821
502 Ga0495611_0000900 3300046648 Bacteria 16165
503 Ga0495611_0010412 3300046648 Bacteria 3935
504 Ga0495611_0012304 3300046648 Bacteria 3638
505 Ga0495611_0113095 3300046648 Bacteria 1264
506 Ga0495625_0005520 3300046660 Bacteria 11494
507 Ga0495625_0008472 3300046660 Bacteria 8775
508 Ga0495625_0011643 3300046660 Bacteria 7155
509 Ga0495625_0019642 3300046660 Bacteria 5233
510 Ga0495625_0124155 3300046660 Bacteria 1754
511 Ga0495625_0184035 3300046660 Bacteria 1387
512 Ga0495635_0005123 3300046663 Bacteria 9117
513 Ga0495659_0000092 3300046664 Bacteria 39277
514 Ga0495659_0001172 3300046664 Bacteria 9087
515 Ga0495659_0006934 3300046664 Bacteria 3585
516 Ga0495661_0001022 3300046665 Bacteria 24842
517 Ga0495661_0005535 3300046665 Bacteria 8963
518 Ga0495661_0016375 3300046665 Bacteria 4916
519 Ga0495661_0017317 3300046665 Bacteria 4760
520 Ga0495661_0048794 3300046665 Bacteria 2570
521 Ga0495661_0103357 3300046665 Bacteria 1599
522 Ga0495661_0124127 3300046665 Bacteria 1422
523 Ga0495588_0044389 3300046674 Bacteria 2276
524 Ga0495588_0050922 3300046674 Bacteria 2131
525 Ga0495657_0018986 3300046675 Bacteria 4967
526 Ga0495623_0000951 3300046679 Bacteria 19518
527 Ga0495623_0004943 3300046679 Bacteria 8742
528 Ga0495646_0011497 3300046680 Bacteria 5619
529 Ga0495669_0018719 3300046684 Bacteria 2980
530 Ga0495613_0101528 3300046689 Bacteria 2077
531 Ga0495613_0134374 3300046689 Bacteria 1770
532 Ga0495624_0004356 3300046690 Bacteria 10381
533 Ga0495670_0000758 3300046691 Bacteria 15506
534 Ga0495670_0005779 3300046691 Bacteria 6063
535 Ga0495670_0006812 3300046691 Bacteria 5624
536 Ga0495670_0010515 3300046691 Bacteria 4546
537 Ga0495670_0030171 3300046691 Bacteria 2693
538 Ga0495670_0041001 3300046691 Bacteria 2309
539 Ga0495670_0054328 3300046691 Bacteria 2006
540 Ga0495671_0003082 3300046692 Bacteria 10355
541 Ga0495671_0006588 3300046692 Bacteria 6697
542 Ga0495671_0011087 3300046692 Bacteria 4974
543 Ga0495671_0019930 3300046692 Bacteria 3539
544 Ga0495671_0024060 3300046692 Bacteria 3176
545 Ga0495671_0025879 3300046692 Bacteria 3046
546 Ga0495671_0026606 3300046692 Bacteria 2997
547 Ga0495671_0031162 3300046692 Bacteria 2727
548 Ga0495671_0034923 3300046692 Bacteria 2554
549 Ga0495671_0047243 3300046692 Bacteria 2151
550 Ga0495671_0058690 3300046692 Bacteria 1903
551 Ga0495649_0002668 3300046694 Bacteria 12433
552 Ga0495649_0004025 3300046694 Bacteria 9679
553 Ga0495649_0004537 3300046694 Bacteria 9062
554 Ga0495649_0006474 3300046694 Bacteria 7287
555 Ga0495649_0010903 3300046694 Bacteria 5353
556 Ga0495649_0023879 3300046694 Bacteria 3414
557 Ga0495649_0030879 3300046694 Bacteria 2956
558 Ga0495649_0033361 3300046694 Bacteria 2833
559 Ga0495649_0034628 3300046694 Bacteria 2778
560 Ga0495649_0084761 3300046694 Bacteria 1691
561 Ga0495589_0000228 3300046794 Bacteria 47419
562 Ga0495589_0001149 3300046794 Bacteria 15754
563 Ga0495589_0001622 3300046794 Bacteria 12901
564 Ga0495589_0001972 3300046794 Bacteria 11616
565 Ga0495589_0005197 3300046794 Bacteria 6886
566 Ga0495589_0011324 3300046794 Bacteria 4630
567 Ga0495589_0014097 3300046794 Bacteria 4120
568 Ga0495589_0015399 3300046794 Bacteria 3936
569 Ga0495589_0055861 3300046794 Bacteria 1944
570 Ga0495600_0029297 3300046809 Bacteria 3564
571 Ga0495600_0036748 3300046809 Bacteria 3182
572 Ga0495660_0001501 3300046810 Bacteria 15761
573 Ga0495660_0002535 3300046810 Bacteria 11652
574 Ga0495660_0010311 3300046810 Bacteria 5433
575 Ga0495660_0016666 3300046810 Bacteria 4234
576 Ga0495660_0018547 3300046810 Bacteria 4000
577 Ga0495660_0023815 3300046810 Bacteria 3490
578 Ga0495660_0025048 3300046810 Bacteria 3391
579 Ga0495660_0029857 3300046810 Bacteria 3074
580 Ga0495660_0033371 3300046810 Bacteria 2887
581 Ga0495660_0036432 3300046810 Bacteria 2744
582 Ga0495660_0038684 3300046810 Bacteria 2651
583 Ga0495660_0039005 3300046810 Bacteria 2639
584 Ga0495660_0050895 3300046810 Bacteria 2255
585 Ga0495660_0059360 3300046810 Bacteria 2058
586 Ga0495660_0090923 3300046810 Bacteria 1586
587 Ga0495581_0030455 3300047315 Bacteria 3126
588 Ga0495604_0011485 3300047317 Bacteria 7033
589 Ga0495604_0047090 3300047317 Bacteria 3360
590 Ga0495636_0002270 3300047318 Bacteria 7382
591 Ga0495674_0017071 3300047319 Bacteria 6761
592 Ga0495672_0001005 3300047320 Bacteria 29105
593 Ga0495672_0003047 3300047320 Bacteria 14692
594 Ga0495672_0003139 3300047320 Bacteria 14380
595 Ga0495672_0004289 3300047320 Bacteria 11759
596 Ga0495672_0012182 3300047320 Bacteria 6015
597 Ga0495672_0023190 3300047320 Bacteria 4022
598 Ga0495672_0043556 3300047320 Bacteria 2698
599 Ga0495672_0066184 3300047320 Bacteria 2063
600 Ga0495672_0066934 3300047320 Bacteria 2047
601 Ga0495672_0085571 3300047320 Bacteria 1746
602 Ga0495676_0003472 3300047321 Bacteria 14266
603 Ga0495680_0009050 3300047322 Bacteria 8995
604 Ga0495680_0009406 3300047322 Bacteria 8790
605 Ga0495680_0028024 3300047322 Bacteria 4621
606 Ga0495680_0134514 3300047322 Bacteria 1813
607 Ga0495683_0000621 3300047323 Bacteria 26501
608 Ga0495683_0001434 3300047323 Bacteria 15687
609 Ga0495683_0005151 3300047323 Bacteria 7280
610 Ga0495683_0009386 3300047323 Bacteria 5213
611 Ga0495683_0016931 3300047323 Bacteria 3780
612 Ga0495683_0027492 3300047323 Bacteria 2908
613 Ga0495683_0030461 3300047323 Bacteria 2752
614 Ga0495683_0032761 3300047323 Bacteria 2646
615 Ga0495683_0055324 3300047323 Bacteria 1975
616 Ga0495683_0080258 3300047323 Bacteria 1592
617 Ga0495683_0088378 3300047323 Bacteria 1504
618 Ga0495687_001061 3300047443 Bacteria 27140
619 Ga0495687_004681 3300047443 Bacteria 9111
620 Ga0495687_005800 3300047443 Bacteria 7744
621 Ga0495675_0046321 3300047444 Bacteria 2768
622 Ga0495679_004909 3300047446 Bacteria 6034
623 Ga0495679_008305 3300047446 Bacteria 4234
624 Ga0495679_009683 3300047446 Bacteria 3838
625 Ga0495679_012504 3300047446 Bacteria 3227
626 Ga0495679_014739 3300047446 Bacteria 2883
627 Ga0495679_014916 3300047446 Bacteria 2860
628 Ga0495679_018849 3300047446 Bacteria 2439
629 Ga0495679_022103 3300047446 Bacteria 2183
630 Ga0495685_016190 3300047447 Bacteria 2547
631 Ga0495673_0001327 3300047469 Bacteria 20080
632 Ga0495673_0001771 3300047469 Bacteria 16424
633 Ga0495673_0002202 3300047469 Bacteria 14080
634 Ga0495673_0002545 3300047469 Bacteria 12709
635 Ga0495673_0004707 3300047469 Bacteria 8466
636 Ga0495673_0009171 3300047469 Bacteria 5491
637 Ga0495673_0014414 3300047469 Bacteria 4111
638 Ga0495673_0016671 3300047469 Bacteria 3751
639 Ga0495673_0019109 3300047469 Bacteria 3439
640 Ga0495673_0027293 3300047469 Bacteria 2719
641 Ga0495673_0034151 3300047469 Bacteria 2353
642 Ga0495673_0049186 3300047469 Bacteria 1856
643 Ga0495673_0051825 3300047469 Bacteria 1795
644 Ga0495681_0001359 3300047470 Bacteria 18478
645 Ga0495681_0002069 3300047470 Bacteria 14574
646 Ga0495681_0003220 3300047470 Bacteria 11394
647 Ga0495681_0004058 3300047470 Bacteria 10068
648 Ga0495681_0012286 3300047470 Bacteria 5041
649 Ga0495681_0014961 3300047470 Bacteria 4417
650 Ga0495681_0015165 3300047470 Bacteria 4371
651 Ga0495681_0019270 3300047470 Bacteria 3731
652 Ga0495681_0034151 3300047470 Bacteria 2537
653 Ga0495681_0035106 3300047470 Bacteria 2493
654 Ga0495681_0036999 3300047470 Bacteria 2408
655 Ga0495681_0039298 3300047470 Bacteria 2312
656 Ga0495681_0049781 3300047470 Bacteria 1978
657 Ga0495681_0062966 3300047470 Bacteria 1703
658 Ga0495684_0164788 3300047471 Bacteria 1651
659 Ga0495686_0002140 3300047472 Bacteria 19307
660 Ga0495686_0006469 3300047472 Bacteria 8958
661 Ga0495686_0008804 3300047472 Bacteria 7351
662 Ga0495686_0038250 3300047472 Bacteria 3069
663 Ga0495686_0053215 3300047472 Bacteria 2537
664 Ga0495686_0071277 3300047472 Bacteria 2139
665 Ga0495593_0009697 3300047673 Bacteria 5586
666 Ga0495593_0072049 3300047673 Bacteria 1794
667 Ga0495602_0009094 3300048088 Bacteria 10343
668 Ga0495626_0000548 3300048091 Bacteria 37317
669 Ga0495626_0000625 3300048091 Bacteria 34456
670 Ga0495626_0002054 3300048091 Bacteria 14731
671 Ga0495626_0003664 3300048091 Bacteria 9748
672 Ga0495626_0006456 3300048091 Bacteria 6679
673 Ga0495626_0008367 3300048091 Bacteria 5680
674 Ga0496102_0000823 3300048905 Bacteria 30109
675 Ga0496103_0005342 3300048906 Bacteria 7699
676 Ga0496105_0035658 3300048908 Bacteria 4095
677 Ga0496105_0309304 3300048908 Bacteria 1269
678 Ga0496106_0076099 3300048909 Bacteria 2572
679 Ga0496112_0188629 3300048915 Bacteria 2024
680 Ga0496116_0000792 3300048919 Bacteria 40176
681 Ga0496116_0001175 3300048919 Bacteria 30771
682 Ga0496116_0001281 3300048919 Bacteria 28911
683 Ga0496116_0008523 3300048919 Bacteria 8883
684 Ga0496116_0012520 3300048919 Bacteria 6923
685 Ga0496116_0017100 3300048919 Bacteria 5647
686 Ga0496117_0009060 3300048920 Bacteria 9356
687 Ga0496117_0009704 3300048920 Bacteria 8897
688 Ga0496117_0011726 3300048920 Bacteria 7817
689 Ga0496117_0055041 3300048920 Bacteria 2783
690 Ga0496118_0018614 3300048921 Bacteria 6250
691 Ga0496118_0024006 3300048921 Bacteria 5278
692 Ga0496118_0028938 3300048921 Bacteria 4655
693 Ga0496118_0056906 3300048921 Bacteria 2935
694 Ga0496118_0099793 3300048921 Bacteria 1966
695 Ga0496119_0081804 3300048922 Bacteria 1858
696 Ga0496120_0007781 3300048923 Bacteria 7915
697 Ga0496121_0001360 3300048924 Bacteria 41696
698 Ga0496121_0024586 3300048924 Bacteria 5754
699 Ga0496121_0025706 3300048924 Bacteria 5577
700 Ga0496121_0049337 3300048924 Bacteria 3570
701 Ga0496121_0062087 3300048924 Bacteria 3063
702 Ga0496121_0237749 3300048924 Bacteria 1271
703 Ga0496122_0013738 3300048925 Bacteria 7896
704 Ga0496122_0015843 3300048925 Bacteria 7179
705 Ga0496122_0028696 3300048925 Bacteria 4712
706 Ga0496122_0050507 3300048925 Bacteria 3171
707 Ga0496122_0051689 3300048925 Bacteria 3119
708 Ga0496122_0129226 3300048925 Bacteria 1609
709 Ga0496122_0164845 3300048925 Bacteria 1345
710 Ga0496123_0030181 3300048926 Bacteria 3972
711 Ga0496123_0038840 3300048926 Bacteria 3339
712 Ga0496123_0055380 3300048926 Bacteria 2602
713 Ga0496123_0084980 3300048926 Bacteria 1906
714 Ga0496124_0002422 3300048927 Bacteria 24482
715 Ga0496124_0006609 3300048927 Bacteria 12592
716 Ga0496124_0044177 3300048927 Bacteria 3825
717 Ga0496125_0001891 3300048928 Bacteria 28759
718 Ga0496125_0044986 3300048928 Bacteria 3722
719 Ga0496125_0046905 3300048928 Bacteria 3619
720 Ga0496125_0048285 3300048928 Bacteria 3551
721 Ga0496125_0055274 3300048928 Bacteria 3236
722 Ga0496125_0076135 3300048928 Bacteria 2592
723 Ga0496126_0058062 3300048929 Bacteria 3489
724 Ga0496126_0113399 3300048929 Bacteria 2359
725 Ga0495678_002077 3300049459 Bacteria 14269
726 Ga0495678_003074 3300049459 Bacteria 10591
727 Ga0495678_006150 3300049459 Bacteria 6441
728 Ga0495678_007957 3300049459 Bacteria 5426
729 Ga0495678_008701 3300049459 Bacteria 5094
730 Ga0495678_020523 3300049459 Bacteria 2922
731 Ga0495678_023780 3300049459 Bacteria 2657
732 Ga0495678_024915 3300049459 Bacteria 2576
733 Ga0495678_032636 3300049459 Bacteria 2155
734 Ga0495678_035487 3300049459 Bacteria 2043
735 Ga0495678_036264 3300049459 Bacteria 2013
736 Ga0495682_0003376 3300049460 Bacteria 7113
737 Ga0495682_0010238 3300049460 Bacteria 3639
738 Ga0495682_0015283 3300049460 Bacteria 2909
739 Ga0495682_0021144 3300049460 Bacteria 2439
740 Ga0495682_0026447 3300049460 Bacteria 2154
741 Ga0501226_002164 3300049853 Bacteria 2432
742 nmdc:mga03683_24164_c1 3300050489 Bacteria 2376
743 nmdc:mga00v17_248014_c1 3300050491 Bacteria 1155
744 nmdc:mga00v17_39265_c1 3300050491 Bacteria 2834
745 Ga0500634_0009316 3300053161 Bacteria 4960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0019472 Ga0495603_0019472_3126_4094 322
2 3300046648 Ga0495611_0113095 Ga0495611_0113095_239_1237 332
3 3300046665 Ga0495661_0124127 Ga0495661_0124127_23_1021 332
4 3300053161 Ga0500634_0009316 Ga0500634_0009316_90_1100 332
5 3300031911 Ga0307412_10231337 Ga0307412_102313371 338
6 3300046457 Ga0495590_0050897 Ga0495590_0050897_11_1027 338
7 3300046542 Ga0495597_0081848 Ga0495597_0081848_20_1039 339
8 3300042138 Ga0450903_015338 Ga0450903_015338_169_1194 341
9 3300048922 Ga0496119_0081804 Ga0496119_0081804_815_1846 343
10 3300048928 Ga0496125_0055274 Ga0496125_0055274_2181_3212 343
11 3300048929 Ga0496126_0058062 Ga0496126_0058062_2364_3467 345
12 3300028786 Ga0307517_10152992 Ga0307517_101529923 350
13 3300046457 Ga0495590_0047497 Ga0495590_0047497_425_1480 351
14 3300048925 Ga0496122_0164845 Ga0496122_0164845_272_1327 351
15 3300042127 Ga0450890_000704 Ga0450890_000704_1864_2928 353
16 3300046492 Ga0495585_0109280 Ga0495585_0109280_366_1442 358
17 3300050491 nmdc:mga00v17_248014_c1 nmdc:mga00v17_248014_c1_58_1134 358
18 3300046692 Ga0495671_0047243 Ga0495671_0047243_1043_2122 359
19 3300047323 Ga0495683_0088378 Ga0495683_0088378_379_1458 359
20 3300048928 Ga0496125_0048285 Ga0496125_0048285_32_1111 359
21 iso_pu_bacteria 2511231011 2511294753 360
22 3300042137 Ga0450902_018181 Ga0450902_018181_30_1118 362
23 3300047472 Ga0495686_0053215 Ga0495686_0053215_1417_2508 363
24 3300046460 Ga0495638_0016221 Ga0495638_0016221_3854_4951 364
25 3300046474 Ga0495605_0063106 Ga0495605_0063106_604_1701 364
26 3300046558 Ga0495633_0084875 Ga0495633_0084875_99_1193 364
27 3300046691 Ga0495670_0054328 Ga0495670_0054328_37_1131 364
28 3300046501 Ga0495607_0126823 Ga0495607_0126823_26_1123 365
29 3300047469 Ga0495673_0049186 Ga0495673_0049186_23_1120 365
30 3300046492 Ga0495585_0001948 Ga0495585_0001948_5802_6908 367
31 3300048924 Ga0496121_0237749 Ga0496121_0237749_31_1140 367
32 3300041405 Ga0439438_005280 Ga0439438_005280_1781_2971 371
33 3300041407 Ga0439447_019208 Ga0439447_019208_644_1804 376
34 3300006914 Ga0075436_100130792 Ga0075436_1001307922 377
35 3300046452 Ga0495617_030317 Ga0495617_030317_392_1582 377
36 3300046453 Ga0495627_012841 Ga0495627_012841_983_2173 377
37 3300046794 Ga0495589_0055861 Ga0495589_0055861_75_1265 377
38 3300047470 Ga0495681_0036999 Ga0495681_0036999_546_1736 377
39 iso_pu_bacteria 2946027586 2946030043 377
40 3300046492 Ga0495585_0031000 Ga0495585_0031000_751_1941 379
41 3300046519 Ga0495632_0059838 Ga0495632_0059838_394_1584 379
42 3300046524 Ga0495648_0058528 Ga0495648_0058528_649_1839 379
43 3300046542 Ga0495597_0005961 Ga0495597_0005961_2810_4000 379
44 3300046526 Ga0495666_0058766 Ga0495666_0058766_48_1193 380
45 3300047446 Ga0495679_014739 Ga0495679_014739_949_2145 380
46 3300042004 Ga0439445_0022641 Ga0439445_0022641_143_1336 382
47 3300046512 Ga0495610_0007241 Ga0495610_0007241_4936_6138 382
48 3300046524 Ga0495648_0007722 Ga0495648_0007722_859_2049 382
49 3300046530 Ga0495654_0017187 Ga0495654_0017187_1334_2536 382
50 3300046538 Ga0495609_0035664 Ga0495609_0035664_564_1754 382
51 3300047320 Ga0495672_0066934 Ga0495672_0066934_653_1843 382
52 3300047470 Ga0495681_0003220 Ga0495681_0003220_5542_6732 382
53 3300005288 Ga0065714_10066807 Ga0065714_100668073 383
54 3300005353 Ga0070669_100002265 Ga0070669_1000022658 383
55 3300005457 Ga0070662_100005483 Ga0070662_1000054837 383
56 3300005539 Ga0068853_100004607 Ga0068853_1000046075 383
57 3300005834 Ga0068851_10001533 Ga0068851_100015339 383
58 3300009011 Ga0105251_10004533 Ga0105251_100045336 383
59 3300013100 Ga0157373_10014828 Ga0157373_100148283 383
60 3300013105 Ga0157369_10079052 Ga0157369_100790525 383
61 3300014497 Ga0182008_10006743 Ga0182008_100067433 383
62 3300014497 Ga0182008_10007964 Ga0182008_100079643 383
63 3300017792 Ga0163161_10047768 Ga0163161_100477683 383
64 3300025321 Ga0207656_10000182 Ga0207656_100001824 383
65 3300025735 Ga0207713_1003318 Ga0207713_10033186 383
66 3300025923 Ga0207681_10002526 Ga0207681_100025267 383
67 3300026041 Ga0207639_10006923 Ga0207639_100069238 383
68 3300046513 Ga0495616_0008304 Ga0495616_0008304_2162_3352 384
69 3300046520 Ga0495637_0014416 Ga0495637_0014416_2161_3351 384
70 3300046523 Ga0495644_0001772 Ga0495644_0001772_2119_3309 384
71 3300046660 Ga0495625_0019642 Ga0495625_0019642_2586_3776 384
72 3300047323 Ga0495683_0009386 Ga0495683_0009386_2211_3401 384
73 3300041411 Ga0439466_0053530 Ga0439466_0053530_65_1222 385
74 3300042010 Ga0439452_000244 Ga0439452_000244_30457_31614 385
75 3300042013 Ga0439456_003748 Ga0439456_003748_399_1556 385
76 3300042115 Ga0450911_000347 Ga0450911_000347_8757_9914 385
77 3300042136 Ga0450900_002605 Ga0450900_002605_362_1519 385
78 3300042013 Ga0439456_008233 Ga0439456_008233_70_1230 386
79 3300042016 Ga0439463_001643 Ga0439463_001643_1476_2636 386
80 3300047320 Ga0495672_0012182 Ga0495672_0012182_1281_2441 386
81 3300015261 Ga0182006_1003132 Ga0182006_10031327 387
82 3300042006 Ga0439432_001278 Ga0439432_001278_5826_7019 387
83 3300042010 Ga0439452_016806 Ga0439452_016806_742_1935 387
84 3300042185 Ga0450909_003127 Ga0450909_003127_389_1582 387
85 3300046460 Ga0495638_0090013 Ga0495638_0090013_118_1281 387
86 3300009036 Ga0105244_10001357 Ga0105244_100013578 388
87 3300013308 Ga0157375_10010903 Ga0157375_100109037 388
88 3300017792 Ga0163161_10148504 Ga0163161_101485042 388
89 3300025728 Ga0207655_1006095 Ga0207655_10060957 388
90 3300048929 Ga0496126_0113399 Ga0496126_0113399_962_2161 388
91 3300009148 Ga0105243_10000582 Ga0105243_1000058231 389
92 3300025935 Ga0207709_10014724 Ga0207709_100147242 389
93 3300042142 Ga0450905_007785 Ga0450905_007785_13_1185 389
94 iso_pu_bacteria 2860867994 2860869781 389
95 iso_pu_bacteria 8055878733 8055883553 389
96 3300046507 Ga0495606_0004137 Ga0495606_0004137_5690_6892 390
97 3300047446 Ga0495679_004909 Ga0495679_004909_205_1407 390
98 iso_pu_bacteria 2511231156 2511826370 390
99 iso_pu_bacteria 2599185212 2599615031 390
100 iso_pu_bacteria 2599185311 2599994443 390
101 iso_pu_bacteria 2599185316 2600024702 390
102 iso_pu_bacteria 2599185317 2600030605 390
103 iso_pu_bacteria 2599185318 2600038204 390
104 iso_pu_bacteria 2599185319 2600045145 390
105 iso_pu_bacteria 2599185322 2600061560 390
106 iso_pu_bacteria 2599185323 2600068337 390
107 iso_pu_bacteria 2599185325 2600077945 390
108 iso_pu_bacteria 2600254930 2600360049 390
109 iso_pu_bacteria 2643221650 2644281853 390
110 iso_pu_bacteria 2667528176 2671125206 390
111 iso_pu_bacteria 2675903515 2678264721 390
112 iso_pu_bacteria 2744054620 2745005175 390
113 iso_pu_bacteria 2825651385 2825656391 390
114 iso_pu_bacteria 3007619802 3007624839 390
115 3300009011 Ga0105251_10005623 Ga0105251_100056236 391
116 3300009092 Ga0105250_10000232 Ga0105250_1000023247 391
117 3300025711 Ga0207696_1001107 Ga0207696_100110713 391
118 3300025735 Ga0207713_1003884 Ga0207713_10038845 391
119 3300031731 Ga0307405_10012041 Ga0307405_100120413 391
120 3300048927 Ga0496124_0044177 Ga0496124_0044177_51_1250 391
121 iso_pu_bacteria 2511231010 2511287340 391
122 iso_pu_bacteria 2511231023 2511366986 391
123 iso_pu_bacteria 2511231031 2511416213 391
124 iso_pu_bacteria 2599185248 2599771188 391
125 iso_pu_bacteria 2599185289 2599886337 391
126 iso_pu_bacteria 2599185291 2599898051 391
127 iso_pu_bacteria 2599185305 2599960364 391
128 iso_pu_bacteria 2599185306 2599969468 391
129 iso_pu_bacteria 2599185308 2599981320 391
130 iso_pu_bacteria 2599185313 2600004981 391
131 iso_pu_bacteria 2599185314 2600015147 391
132 iso_pu_bacteria 2599185315 2600017865 391
133 iso_pu_bacteria 2599185321 2600055427 391
134 iso_pu_bacteria 2599185324 2600070052 391
135 iso_pu_bacteria 2600255318 2601795573 391
136 iso_pu_bacteria 2603880185 2606075643 391
137 iso_pu_bacteria 2603880199 2606128446 391
138 iso_pu_bacteria 2623620443 2624479510 391
139 iso_pu_bacteria 2667528170 2671090145 391
140 iso_pu_bacteria 2675903420 2677900911 391
141 iso_pu_bacteria 2713897149 2715757777 391
142 iso_pu_bacteria 2738543025 2739316688 391
143 iso_pu_bacteria 2773857673 2774137667 391
144 iso_pu_bacteria 2784132063 2784265580 391
145 iso_pu_bacteria 2808606361 2808858379 391
146 iso_pu_bacteria 2808606376 2808926291 391
147 iso_pu_bacteria 2808606378 2808938512 391
148 iso_pu_bacteria 2808606380 2808948336 391
149 iso_pu_bacteria 2808606383 2808966864 391
150 iso_pu_bacteria 2808606389 2809001694 391
151 iso_pu_bacteria 2818991456 2819654722 391
152 iso_pu_bacteria 2842854478 2842856778 391
153 iso_pu_bacteria 2852657418 2852658994 391
154 iso_pu_bacteria 2878029506 2878031514 391
155 iso_pu_bacteria 2880230671 2880232384 391
156 iso_pu_bacteria 2904518522 2904521725 391
157 iso_pu_bacteria 2919063839 2919064015 391
158 iso_pu_bacteria 2931369376 2931373913 391
159 iso_pu_bacteria 2969304461 2969306297 391
160 iso_pu_bacteria 2988728565 2988730236 391
161 iso_pu_bacteria 3007419365 3007424588 391
162 iso_pu_bacteria 3007718800 3007722439 391
163 iso_pu_bacteria 3007855910 3007856283 391
164 iso_pu_bacteria 8056143049 8056144735 391
165 iso_pu_bacteria 8056172158 8056175485 391
166 iso_pu_bacteria 8056569372 8056573150 391
167 iso_pu_bacteria 2511231015 2511321720 392
168 iso_pu_bacteria 2511231017 2511331744 392
169 iso_pu_bacteria 2511231021 2511359429 392
170 iso_pu_bacteria 2643221589 2643952644 392
171 iso_pu_bacteria 2643221602 2644022406 392
172 iso_pu_bacteria 2713897148 2715753923 392
173 iso_pu_bacteria 2738543004 2739201254 392
174 iso_pu_bacteria 2808606382 2808957720 392
175 iso_pu_bacteria 2842832357 2842832618 392
176 iso_pu_bacteria 2842843487 2842848296 392
177 iso_pu_bacteria 2904550169 2904553121 392
178 iso_pu_bacteria 2912963787 2912967729 392
179 iso_pu_bacteria 2919385768 2919386478 392
180 iso_pu_bacteria 2919487758 2919491239 392
181 iso_pu_bacteria 2939636861 2939639666 392
182 iso_pu_bacteria 2946006987 2946010993 392
183 iso_pu_bacteria 2974289157 2974292048 392
184 iso_pu_bacteria 2998139840 2998141693 392
185 iso_pu_bacteria 3007511990 3007513088 392
186 iso_pu_bacteria 3007614139 3007616803 392
187 iso_pu_bacteria 3007861166 3007863069 392
188 iso_pu_bacteria 8029995093 8029999064 392
189 iso_pu_bacteria 8056166840 8056169299 392
190 3300011119 Ga0105246_10000325 Ga0105246_100003259 393
191 iso_pu_bacteria 2511231007 2511270732 393
192 iso_pu_bacteria 2511231016 2511328793 393
193 iso_pu_bacteria 2511231018 2511339791 393
194 iso_pu_bacteria 2511231019 2511346845 393
195 iso_pu_bacteria 2599185167 2599401731 393
196 iso_pu_bacteria 2599185179 2599451730 393
197 iso_pu_bacteria 2599185190 2599514973 393
198 iso_pu_bacteria 2599185191 2599521074 393
199 iso_pu_bacteria 2599185288 2599882305 393
200 iso_pu_bacteria 2599185290 2599894226 393
201 iso_pu_bacteria 2599185302 2599943942 393
202 iso_pu_bacteria 2599185303 2599952250 393
203 iso_pu_bacteria 2599185304 2599955844 393
204 iso_pu_bacteria 2599185309 2599986615 393
205 iso_pu_bacteria 2599185310 2599989570 393
206 iso_pu_bacteria 2599185312 2600000083 393
207 iso_pu_bacteria 2599185320 2600048339 393
208 iso_pu_bacteria 2619619299 2621300775 393
209 iso_pu_bacteria 2623620446 2624493484 393
210 iso_pu_bacteria 2643221565 2643841682 393
211 iso_pu_bacteria 2643221633 2644188612 393
212 iso_pu_bacteria 2738541265 2738670607 393
213 iso_pu_bacteria 2738541282 2738749000 393
214 iso_pu_bacteria 2738541294 2738810960 393
215 iso_pu_bacteria 2738541303 2738858042 393
216 iso_pu_bacteria 2738541309 2738898320 393
217 iso_pu_bacteria 2773857670 2774121267 393
218 iso_pu_bacteria 2784132072 2784317439 393
219 iso_pu_bacteria 2808606377 2808927440 393
220 iso_pu_bacteria 2808606381 2808950021 393
221 iso_pu_bacteria 2808606385 2808979325 393
222 iso_pu_bacteria 2808606388 2808995249 393
223 iso_pu_bacteria 2808606445 2809216446 393
224 iso_pu_bacteria 2816332298 2817489925 393
225 iso_pu_bacteria 2834028612 2834029795 393
226 iso_pu_bacteria 2852612431 2852618332 393
227 iso_pu_bacteria 2852667396 2852673532 393
228 iso_pu_bacteria 2860339153 2860339944 393
229 iso_pu_bacteria 2919456309 2919457038 393
230 iso_pu_bacteria 2919697872 2919702785 393
231 iso_pu_bacteria 2923586266 2923590178 393
232 iso_pu_bacteria 2931390751 2931392867 393
233 iso_pu_bacteria 2931396565 2931400163 393
234 iso_pu_bacteria 2945928738 2945928816 393
235 iso_pu_bacteria 2945961074 2945965057 393
236 iso_pu_bacteria 8019775933 8019780334 393
237 iso_pu_bacteria 8054285046 8054289386 393
238 iso_pu_bacteria 8054503363 8054505358 393
239 iso_pu_bacteria 8055817908 8055819929 393
240 iso_pu_bacteria 8056155041 8056156156 393
241 iso_pu_bacteria 8056161164 8056165111 393
242 iso_pu_bacteria 8056177738 8056181218 393
243 3300002737 JGI25162J39368_1000412 JGI25162J39368_10004128 394
244 3300002771 JGI25163J39215_1000722 JGI25163J39215_10007223 394
245 3300002772 JGI25164J39214_1000291 JGI25164J39214_100029129 394
246 3300003214 JGI25165J46597_1000538 JGI25165J46597_100053829 394
247 3300005288 Ga0065714_10064686 Ga0065714_100646863 394
248 3300005288 Ga0065714_10066954 Ga0065714_100669545 394
249 3300009011 Ga0105251_10003278 Ga0105251_1000327812 394
250 3300009036 Ga0105244_10011409 Ga0105244_100114093 394
251 3300025207 Ga0209760_100028 Ga0209760_10002811 394
252 3300025231 Ga0207427_100008 Ga0207427_100008161 394
253 3300025233 Ga0209437_100014 Ga0209437_100014550 394
254 3300025261 Ga0209233_1000008 Ga0209233_1000008550 394
255 3300025728 Ga0207655_1000113 Ga0207655_1000113107 394
256 3300025735 Ga0207713_1009955 Ga0207713_10099553 394
257 3300030742 Ga0316183_1154384 Ga0316183_11543842 394
258 3300031507 Ga0307509_10102173 Ga0307509_101021732 394
259 3300031548 Ga0307408_100250211 Ga0307408_1002502111 394
260 3300046460 Ga0495638_0085266 Ga0495638_0085266_652_1839 394
261 3300046471 Ga0495650_0011242 Ga0495650_0011242_792_1979 394
262 3300046501 Ga0495607_0002582 Ga0495607_0002582_6048_7235 394
263 3300046513 Ga0495616_0001890 Ga0495616_0001890_5823_7010 394
264 3300046558 Ga0495633_0082438 Ga0495633_0082438_191_1375 394
265 3300046692 Ga0495671_0031162 Ga0495671_0031162_414_1601 394
266 3300047446 Ga0495679_009683 Ga0495679_009683_1443_2627 394
267 3300047470 Ga0495681_0002069 Ga0495681_0002069_7329_8516 394
268 3300048915 Ga0496112_0188629 Ga0496112_0188629_153_1337 394
269 3300048925 Ga0496122_0051689 Ga0496122_0051689_726_1910 394
270 3300048926 Ga0496123_0055380 Ga0496123_0055380_241_1425 394
271 3300048928 Ga0496125_0046905 Ga0496125_0046905_1376_2560 394
272 3300049460 Ga0495682_0015283 Ga0495682_0015283_1174_2361 394
273 3300003323 rootH1_10232297 rootH1_102322973 395
274 3300003781 Ga0055536_1000727 Ga0055536_100072717 395
275 3300003791 Ga0055530_10000299 Ga0055530_1000029919 395
276 3300003791 Ga0055530_10000634 Ga0055530_1000063431 395
277 3300003792 Ga0055540_1000289 Ga0055540_100028919 395
278 3300003792 Ga0055540_1000390 Ga0055540_100039031 395
279 3300003794 Ga0055531_10000546 Ga0055531_100005469 395
280 3300005548 Ga0070665_100017490 Ga0070665_1000174905 395
281 3300006051 Ga0075364_10117186 Ga0075364_101171862 395
282 3300009011 Ga0105251_10009193 Ga0105251_100091933 395
283 3300009092 Ga0105250_10006210 Ga0105250_100062104 395
284 3300009092 Ga0105250_10007279 Ga0105250_100072794 395
285 3300009148 Ga0105243_10001065 Ga0105243_1000106519 395
286 3300009148 Ga0105243_10330894 Ga0105243_103308941 395
287 3300011119 Ga0105246_10002743 Ga0105246_100027433 395
288 3300012498 Ga0157345_1000125 Ga0157345_10001256 395
289 3300013100 Ga0157373_10007713 Ga0157373_100077137 395
290 3300013100 Ga0157373_10016383 Ga0157373_100163833 395
291 3300013100 Ga0157373_10025076 Ga0157373_100250764 395
292 3300013100 Ga0157373_10163779 Ga0157373_101637792 395
293 3300013102 Ga0157371_10007299 Ga0157371_100072997 395
294 3300013104 Ga0157370_10187879 Ga0157370_101878792 395
295 3300013105 Ga0157369_10005784 Ga0157369_100057847 395
296 3300013105 Ga0157369_10007408 Ga0157369_100074088 395
297 3300013306 Ga0163162_10003705 Ga0163162_100037057 395
298 3300013307 Ga0157372_10007707 Ga0157372_100077074 395
299 3300013308 Ga0157375_10074194 Ga0157375_100741942 395
300 3300014497 Ga0182008_10010003 Ga0182008_100100034 395
301 3300015261 Ga0182006_1007212 Ga0182006_10072121 395
302 3300015265 Ga0182005_1018297 Ga0182005_10182971 395
303 3300015265 Ga0182005_1022668 Ga0182005_10226681 395
304 3300017792 Ga0163161_10001215 Ga0163161_100012157 395
305 3300025230 Ga0209563_110457 Ga0209563_1104571 395
306 3300025291 Ga0209675_1002342 Ga0209675_10023423 395
307 3300025292 Ga0209676_1000016 Ga0209676_1000016611 395
308 3300025292 Ga0209676_1000033 Ga0209676_1000033429 395
309 3300025298 Ga0209050_1000399 Ga0209050_100039961 395
310 3300025298 Ga0209050_1000477 Ga0209050_100047754 395
311 3300025303 Ga0209051_1000043 Ga0209051_100004319 395
312 3300025303 Ga0209051_1000106 Ga0209051_1000106134 395
313 3300025304 Ga0209257_1000604 Ga0209257_100060419 395
314 3300025304 Ga0209257_1007864 Ga0209257_10078642 395
315 3300025711 Ga0207696_1000025 Ga0207696_1000025317 395
316 3300025711 Ga0207696_1000708 Ga0207696_10007087 395
317 3300025711 Ga0207696_1003011 Ga0207696_10030112 395
318 3300025728 Ga0207655_1000863 Ga0207655_100086326 395
319 3300025728 Ga0207655_1005839 Ga0207655_10058397 395
320 3300025735 Ga0207713_1002442 Ga0207713_10024427 395
321 3300025735 Ga0207713_1003877 Ga0207713_10038773 395
322 3300025735 Ga0207713_1045270 Ga0207713_10452702 395
323 3300025735 Ga0207713_1045917 Ga0207713_10459171 395
324 3300025933 Ga0207706_10070083 Ga0207706_100700833 395
325 3300025935 Ga0207709_10000053 Ga0207709_10000053206 395
326 3300027111 Ga0209281_1006777 Ga0209281_10067773 395
327 3300030734 Ga0316179_1078203 Ga0316179_10782032 395
328 3300030735 Ga0316178_1011502 Ga0316178_10115023 395
329 3300031548 Ga0307408_100002794 Ga0307408_1000027944 395
330 3300031548 Ga0307408_100007990 Ga0307408_1000079902 395
331 3300031548 Ga0307408_100182624 Ga0307408_1001826241 395
332 3300031731 Ga0307405_10015369 Ga0307405_100153693 395
333 3300031731 Ga0307405_10109643 Ga0307405_101096432 395
334 3300031901 Ga0307406_10010034 Ga0307406_100100343 395
335 3300031911 Ga0307412_10004703 Ga0307412_100047034 395
336 3300031911 Ga0307412_10048714 Ga0307412_100487143 395
337 3300031911 Ga0307412_10081867 Ga0307412_100818672 395
338 3300032002 Ga0307416_100359111 Ga0307416_1003591111 395
339 3300032002 Ga0307416_100387978 Ga0307416_1003879781 395
340 3300032005 Ga0307411_10001157 Ga0307411_100011575 395
341 3300032005 Ga0307411_10105255 Ga0307411_101052552 395
342 3300033180 Ga0307510_10004948 Ga0307510_100049488 395
343 3300041405 Ga0439438_006114 Ga0439438_006114_2129_3322 395
344 3300041405 Ga0439438_007150 Ga0439438_007150_1157_2356 395
345 3300041405 Ga0439438_007958 Ga0439438_007958_1128_2327 395
346 3300041407 Ga0439447_015386 Ga0439447_015386_502_1701 395
347 3300041407 Ga0439447_030151 Ga0439447_030151_117_1316 395
348 3300042115 Ga0450911_001754 Ga0450911_001754_1827_3014 395
349 3300046452 Ga0495617_009557 Ga0495617_009557_1604_2791 395
350 3300046452 Ga0495617_014581 Ga0495617_014581_885_2072 395
351 3300046452 Ga0495617_028198 Ga0495617_028198_53_1240 395
352 3300046453 Ga0495627_000985 Ga0495627_000985_12256_13443 395
353 3300046453 Ga0495627_001679 Ga0495627_001679_7256_8443 395
354 3300046458 Ga0495591_000968 Ga0495591_000968_6160_7347 395
355 3300046458 Ga0495591_001335 Ga0495591_001335_5846_7033 395
356 3300046458 Ga0495591_002084 Ga0495591_002084_1163_2350 395
357 3300046458 Ga0495591_013402 Ga0495591_013402_65_1252 395
358 3300046458 Ga0495591_019672 Ga0495591_019672_44_1231 395
359 3300046460 Ga0495638_0005045 Ga0495638_0005045_2853_4052 395
360 3300046460 Ga0495638_0047797 Ga0495638_0047797_995_2182 395
361 3300046460 Ga0495638_0112501 Ga0495638_0112501_90_1277 395
362 3300046463 Ga0495653_0002877 Ga0495653_0002877_5825_7012 395
363 3300046471 Ga0495650_0008841 Ga0495650_0008841_1686_2873 395
364 3300046471 Ga0495650_0025809 Ga0495650_0025809_1132_2319 395
365 3300046474 Ga0495605_0019215 Ga0495605_0019215_1207_2394 395
366 3300046491 Ga0495584_0006475 Ga0495584_0006475_174_1361 395
367 3300046492 Ga0495585_0010785 Ga0495585_0010785_3006_4193 395
368 3300046492 Ga0495585_0016187 Ga0495585_0016187_120_1319 395
369 3300046501 Ga0495607_0007648 Ga0495607_0007648_5110_6297 395
370 3300046501 Ga0495607_0019813 Ga0495607_0019813_1785_2972 395
371 3300046501 Ga0495607_0092439 Ga0495607_0092439_326_1513 395
372 3300046507 Ga0495606_0004359 Ga0495606_0004359_5815_7002 395
373 3300046507 Ga0495606_0016567 Ga0495606_0016567_1506_2693 395
374 3300046507 Ga0495606_0025103 Ga0495606_0025103_2510_3697 395
375 3300046507 Ga0495606_0051999 Ga0495606_0051999_1405_2604 395
376 3300046512 Ga0495610_0002477 Ga0495610_0002477_8413_9600 395
377 3300046512 Ga0495610_0003667 Ga0495610_0003667_5749_6936 395
378 3300046513 Ga0495616_0001617 Ga0495616_0001617_8395_9582 395
379 3300046513 Ga0495616_0003259 Ga0495616_0003259_3415_4602 395
380 3300046513 Ga0495616_0003406 Ga0495616_0003406_1793_2980 395
381 3300046515 Ga0495620_0000434 Ga0495620_0000434_20773_21960 395
382 3300046515 Ga0495620_0001458 Ga0495620_0001458_5854_7041 395
383 3300046515 Ga0495620_0050430 Ga0495620_0050430_546_1733 395
384 3300046515 Ga0495620_0066449 Ga0495620_0066449_51_1238 395
385 3300046518 Ga0495631_0001477 Ga0495631_0001477_5806_6993 395
386 3300046518 Ga0495631_0036198 Ga0495631_0036198_66_1253 395
387 3300046518 Ga0495631_0050489 Ga0495631_0050489_58_1245 395
388 3300046519 Ga0495632_0002118 Ga0495632_0002118_8426_9613 395
389 3300046520 Ga0495637_0000837 Ga0495637_0000837_4785_5972 395
390 3300046520 Ga0495637_0003716 Ga0495637_0003716_5872_7059 395
391 3300046520 Ga0495637_0021536 Ga0495637_0021536_763_1950 395
392 3300046520 Ga0495637_0024329 Ga0495637_0024329_428_1627 395
393 3300046520 Ga0495637_0070663 Ga0495637_0070663_34_1221 395
394 3300046522 Ga0495643_0007271 Ga0495643_0007271_5838_7025 395
395 3300046522 Ga0495643_0019799 Ga0495643_0019799_1080_2267 395
396 3300046522 Ga0495643_0021429 Ga0495643_0021429_1555_2742 395
397 3300046522 Ga0495643_0059137 Ga0495643_0059137_103_1290 395
398 3300046523 Ga0495644_0009347 Ga0495644_0009347_1100_2287 395
399 3300046524 Ga0495648_0003287 Ga0495648_0003287_7271_8458 395
400 3300046524 Ga0495648_0015729 Ga0495648_0015729_3306_4493 395
401 3300046524 Ga0495648_0024542 Ga0495648_0024542_1650_2837 395
402 3300046524 Ga0495648_0036117 Ga0495648_0036117_34_1221 395
403 3300046526 Ga0495666_0060725 Ga0495666_0060725_568_1755 395
404 3300046530 Ga0495654_0001776 Ga0495654_0001776_7303_8490 395
405 3300046530 Ga0495654_0003337 Ga0495654_0003337_7256_8443 395
406 3300046530 Ga0495654_0010615 Ga0495654_0010615_3259_4446 395
407 3300046530 Ga0495654_0068056 Ga0495654_0068056_401_1588 395
408 3300046530 Ga0495654_0071364 Ga0495654_0071364_69_1256 395
409 3300046538 Ga0495609_0001480 Ga0495609_0001480_5854_7041 395
410 3300046538 Ga0495609_0010467 Ga0495609_0010467_1453_2640 395
411 3300046538 Ga0495609_0031527 Ga0495609_0031527_888_2075 395
412 3300046542 Ga0495597_0001891 Ga0495597_0001891_7275_8462 395
413 3300046542 Ga0495597_0055974 Ga0495597_0055974_34_1221 395
414 3300046557 Ga0495622_0000424 Ga0495622_0000424_20873_22060 395
415 3300046558 Ga0495633_0003869 Ga0495633_0003869_3071_4258 395
416 3300046616 Ga0495668_0010878 Ga0495668_0010878_1303_2490 395
417 3300046648 Ga0495611_0000900 Ga0495611_0000900_5842_7029 395
418 3300046660 Ga0495625_0005520 Ga0495625_0005520_4434_5621 395
419 3300046660 Ga0495625_0011643 Ga0495625_0011643_80_1267 395
420 3300046665 Ga0495661_0017317 Ga0495661_0017317_2882_4069 395
421 3300046665 Ga0495661_0048794 Ga0495661_0048794_1168_2355 395
422 3300046689 Ga0495613_0101528 Ga0495613_0101528_153_1340 395
423 3300046690 Ga0495624_0004356 Ga0495624_0004356_1858_3045 395
424 3300046691 Ga0495670_0000758 Ga0495670_0000758_5891_7078 395
425 3300046692 Ga0495671_0011087 Ga0495671_0011087_1987_3174 395
426 3300046692 Ga0495671_0019930 Ga0495671_0019930_2149_3348 395
427 3300046692 Ga0495671_0025879 Ga0495671_0025879_158_1345 395
428 3300046692 Ga0495671_0026606 Ga0495671_0026606_26_1213 395
429 3300046694 Ga0495649_0004025 Ga0495649_0004025_7302_8489 395
430 3300046694 Ga0495649_0030879 Ga0495649_0030879_1060_2259 395
431 3300046694 Ga0495649_0034628 Ga0495649_0034628_938_2125 395
432 3300046794 Ga0495589_0001149 Ga0495589_0001149_5853_7040 395
433 3300046809 Ga0495600_0036748 Ga0495600_0036748_193_1380 395
434 3300046810 Ga0495660_0001501 Ga0495660_0001501_5913_7112 395
435 3300046810 Ga0495660_0002535 Ga0495660_0002535_3275_4462 395
436 3300046810 Ga0495660_0010311 Ga0495660_0010311_1779_2966 395
437 3300046810 Ga0495660_0016666 Ga0495660_0016666_574_1773 395
438 3300046810 Ga0495660_0029857 Ga0495660_0029857_103_1290 395
439 3300046810 Ga0495660_0038684 Ga0495660_0038684_1165_2352 395
440 3300046810 Ga0495660_0090923 Ga0495660_0090923_53_1252 395
441 3300047320 Ga0495672_0003139 Ga0495672_0003139_7333_8520 395
442 3300047320 Ga0495672_0085571 Ga0495672_0085571_155_1342 395
443 3300047321 Ga0495676_0003472 Ga0495676_0003472_5866_7053 395
444 3300047322 Ga0495680_0009050 Ga0495680_0009050_5966_7153 395
445 3300047323 Ga0495683_0032761 Ga0495683_0032761_474_1661 395
446 3300047323 Ga0495683_0055324 Ga0495683_0055324_725_1924 395
447 3300047323 Ga0495683_0080258 Ga0495683_0080258_76_1263 395
448 3300047446 Ga0495679_008305 Ga0495679_008305_22_1209 395
449 3300047446 Ga0495679_012504 Ga0495679_012504_1846_3033 395
450 3300047446 Ga0495679_018849 Ga0495679_018849_54_1241 395
451 3300047469 Ga0495673_0001771 Ga0495673_0001771_6073_7260 395
452 3300047469 Ga0495673_0004707 Ga0495673_0004707_3074_4261 395
453 3300047469 Ga0495673_0027293 Ga0495673_0027293_1289_2488 395
454 3300047470 Ga0495681_0004058 Ga0495681_0004058_5875_7062 395
455 3300047470 Ga0495681_0014961 Ga0495681_0014961_1708_2895 395
456 3300047470 Ga0495681_0062966 Ga0495681_0062966_421_1608 395
457 3300047471 Ga0495684_0164788 Ga0495684_0164788_28_1215 395
458 3300047472 Ga0495686_0002140 Ga0495686_0002140_12265_13452 395
459 3300047472 Ga0495686_0071277 Ga0495686_0071277_776_1963 395
460 3300048088 Ga0495602_0009094 Ga0495602_0009094_1824_3011 395
461 3300048091 Ga0495626_0000625 Ga0495626_0000625_29897_31084 395
462 3300048091 Ga0495626_0003664 Ga0495626_0003664_7111_8298 395
463 3300048919 Ga0496116_0001281 Ga0496116_0001281_21565_22752 395
464 3300048919 Ga0496116_0008523 Ga0496116_0008523_3256_4443 395
465 3300048919 Ga0496116_0012520 Ga0496116_0012520_2671_3858 395
466 3300048920 Ga0496117_0009060 Ga0496117_0009060_5921_7108 395
467 3300048921 Ga0496118_0018614 Ga0496118_0018614_1936_3123 395
468 3300048921 Ga0496118_0028938 Ga0496118_0028938_1841_3028 395
469 3300048924 Ga0496121_0025706 Ga0496121_0025706_1241_2428 395
470 3300048925 Ga0496122_0028696 Ga0496122_0028696_3151_4338 395
471 3300048925 Ga0496122_0129226 Ga0496122_0129226_75_1262 395
472 3300048926 Ga0496123_0030181 Ga0496123_0030181_2092_3279 395
473 3300049459 Ga0495678_002077 Ga0495678_002077_5827_7014 395
474 3300049459 Ga0495678_007957 Ga0495678_007957_3269_4456 395
475 3300049459 Ga0495678_032636 Ga0495678_032636_727_1914 395
476 3300049459 Ga0495678_035487 Ga0495678_035487_753_1952 395
477 3300049459 Ga0495678_036264 Ga0495678_036264_112_1299 395
478 3300049460 Ga0495682_0003376 Ga0495682_0003376_143_1330 395
479 3300049853 Ga0501226_002164 Ga0501226_002164_62_1255 395
480 3300006051 Ga0075364_10038173 Ga0075364_100381733 396
481 3300006946 Ga0079104_1000433 Ga0079104_100043320 396
482 3300009011 Ga0105251_10012782 Ga0105251_100127823 396
483 3300017792 Ga0163161_10005635 Ga0163161_100056351 396
484 3300017792 Ga0163161_10071395 Ga0163161_100713952 396
485 3300025728 Ga0207655_1042673 Ga0207655_10426732 396
486 3300027111 Ga0209281_1000331 Ga0209281_100033147 396
487 3300027907 Ga0207428_10063484 Ga0207428_100634843 396
488 3300027907 Ga0207428_10076825 Ga0207428_100768253 396
489 3300027907 Ga0207428_10098898 Ga0207428_100988981 396
490 3300027907 Ga0207428_10190164 Ga0207428_101901641 396
491 3300041405 Ga0439438_000514 Ga0439438_000514_2999_4189 396
492 3300042115 Ga0450911_004571 Ga0450911_004571_917_2107 396
493 3300042121 Ga0450919_006964 Ga0450919_006964_51_1241 396
494 3300042125 Ga0450923_002468 Ga0450923_002468_1348_2538 396
495 3300046452 Ga0495617_005122 Ga0495617_005122_931_2121 396
496 3300046452 Ga0495617_005677 Ga0495617_005677_1474_2664 396
497 3300046452 Ga0495617_020304 Ga0495617_020304_633_1823 396
498 3300046457 Ga0495590_0000476 Ga0495590_0000476_5838_7028 396
499 3300046457 Ga0495590_0013089 Ga0495590_0013089_825_2015 396
500 3300046457 Ga0495590_0019034 Ga0495590_0019034_347_1537 396
501 3300046458 Ga0495591_001024 Ga0495591_001024_9812_11002 396
502 3300046458 Ga0495591_015525 Ga0495591_015525_767_1957 396
503 3300046458 Ga0495591_029585 Ga0495591_029585_118_1308 396
504 3300046460 Ga0495638_0003973 Ga0495638_0003973_6432_7622 396
505 3300046460 Ga0495638_0039684 Ga0495638_0039684_76_1266 396
506 3300046460 Ga0495638_0050167 Ga0495638_0050167_95_1285 396
507 3300046460 Ga0495638_0065621 Ga0495638_0065621_865_2055 396
508 3300046460 Ga0495638_0120694 Ga0495638_0120694_102_1292 396
509 3300046471 Ga0495650_0003570 Ga0495650_0003570_3743_4933 396
510 3300046474 Ga0495605_0000940 Ga0495605_0000940_12873_14063 396
511 3300046491 Ga0495584_0003543 Ga0495584_0003543_1495_2685 396
512 3300046492 Ga0495585_0001357 Ga0495585_0001357_9899_11089 396
513 3300046500 Ga0495596_0000934 Ga0495596_0000934_8574_9764 396
514 3300046501 Ga0495607_0028193 Ga0495607_0028193_732_1922 396
515 3300046501 Ga0495607_0044449 Ga0495607_0044449_445_1635 396
516 3300046501 Ga0495607_0074605 Ga0495607_0074605_165_1355 396
517 3300046506 Ga0495583_0008063 Ga0495583_0008063_2112_3302 396
518 3300046507 Ga0495606_0008856 Ga0495606_0008856_6686_7876 396
519 3300046507 Ga0495606_0050747 Ga0495606_0050747_1028_2218 396
520 3300046507 Ga0495606_0117659 Ga0495606_0117659_219_1409 396
521 3300046507 Ga0495606_0140459 Ga0495606_0140459_195_1385 396
522 3300046512 Ga0495610_0007015 Ga0495610_0007015_4685_5875 396
523 3300046512 Ga0495610_0013393 Ga0495610_0013393_2265_3455 396
524 3300046512 Ga0495610_0013823 Ga0495610_0013823_555_1745 396
525 3300046513 Ga0495616_0029807 Ga0495616_0029807_646_1836 396
526 3300046515 Ga0495620_0012822 Ga0495620_0012822_1357_2547 396
527 3300046515 Ga0495620_0015309 Ga0495620_0015309_1672_2862 396
528 3300046515 Ga0495620_0019817 Ga0495620_0019817_740_1930 396
529 3300046518 Ga0495631_0021451 Ga0495631_0021451_209_1399 396
530 3300046518 Ga0495631_0022069 Ga0495631_0022069_1327_2517 396
531 3300046519 Ga0495632_0009643 Ga0495632_0009643_967_2157 396
532 3300046519 Ga0495632_0025118 Ga0495632_0025118_444_1634 396
533 3300046519 Ga0495632_0071393 Ga0495632_0071393_426_1616 396
534 3300046520 Ga0495637_0009357 Ga0495637_0009357_1175_2365 396
535 3300046520 Ga0495637_0037568 Ga0495637_0037568_777_1967 396
536 3300046522 Ga0495643_0006310 Ga0495643_0006310_507_1697 396
537 3300046522 Ga0495643_0055736 Ga0495643_0055736_426_1616 396
538 3300046522 Ga0495643_0114178 Ga0495643_0114178_44_1234 396
539 3300046523 Ga0495644_0001017 Ga0495644_0001017_4877_6067 396
540 3300046524 Ga0495648_0004727 Ga0495648_0004727_3937_5127 396
541 3300046524 Ga0495648_0045101 Ga0495648_0045101_1421_2611 396
542 3300046524 Ga0495648_0057483 Ga0495648_0057483_382_1572 396
543 3300046524 Ga0495648_0115136 Ga0495648_0115136_186_1376 396
544 3300046528 Ga0495642_0000827 Ga0495642_0000827_5827_7017 396
545 3300046530 Ga0495654_0017039 Ga0495654_0017039_1702_2892 396
546 3300046530 Ga0495654_0025046 Ga0495654_0025046_1293_2483 396
547 3300046530 Ga0495654_0055270 Ga0495654_0055270_220_1410 396
548 3300046538 Ga0495609_0033063 Ga0495609_0033063_157_1347 396
549 3300046538 Ga0495609_0086838 Ga0495609_0086838_64_1254 396
550 3300046542 Ga0495597_0032700 Ga0495597_0032700_662_1852 396
551 3300046542 Ga0495597_0046965 Ga0495597_0046965_400_1590 396
552 3300046542 Ga0495597_0076499 Ga0495597_0076499_222_1412 396
553 3300046557 Ga0495622_0017851 Ga0495622_0017851_1103_2293 396
554 3300046616 Ga0495668_0003274 Ga0495668_0003274_6226_7416 396
555 3300046616 Ga0495668_0005658 Ga0495668_0005658_5878_7068 396
556 3300046648 Ga0495611_0010412 Ga0495611_0010412_163_1353 396
557 3300046665 Ga0495661_0103357 Ga0495661_0103357_298_1488 396
558 3300046674 Ga0495588_0050922 Ga0495588_0050922_520_1710 396
559 3300046684 Ga0495669_0018719 Ga0495669_0018719_1516_2706 396
560 3300046691 Ga0495670_0010515 Ga0495670_0010515_2836_4026 396
561 3300046691 Ga0495670_0030171 Ga0495670_0030171_987_2177 396
562 3300046692 Ga0495671_0006588 Ga0495671_0006588_3197_4387 396
563 3300046692 Ga0495671_0024060 Ga0495671_0024060_1566_2756 396
564 3300046692 Ga0495671_0034923 Ga0495671_0034923_771_1961 396
565 3300046694 Ga0495649_0004537 Ga0495649_0004537_6242_7432 396
566 3300046694 Ga0495649_0006474 Ga0495649_0006474_5824_7014 396
567 3300046694 Ga0495649_0033361 Ga0495649_0033361_1274_2464 396
568 3300046794 Ga0495589_0001622 Ga0495589_0001622_4543_5733 396
569 3300046794 Ga0495589_0005197 Ga0495589_0005197_1193_2383 396
570 3300046794 Ga0495589_0011324 Ga0495589_0011324_1433_2623 396
571 3300046810 Ga0495660_0023815 Ga0495660_0023815_2151_3341 396
572 3300046810 Ga0495660_0036432 Ga0495660_0036432_1082_2272 396
573 3300046810 Ga0495660_0050895 Ga0495660_0050895_296_1486 396
574 3300047320 Ga0495672_0001005 Ga0495672_0001005_26718_27908 396
575 3300047323 Ga0495683_0001434 Ga0495683_0001434_5838_7028 396
576 3300047323 Ga0495683_0005151 Ga0495683_0005151_5439_6629 396
577 3300047323 Ga0495683_0016931 Ga0495683_0016931_785_1975 396
578 3300047323 Ga0495683_0030461 Ga0495683_0030461_553_1743 396
579 3300047443 Ga0495687_001061 Ga0495687_001061_5326_6516 396
580 3300047443 Ga0495687_005800 Ga0495687_005800_709_1899 396
581 3300047469 Ga0495673_0009171 Ga0495673_0009171_2666_3856 396
582 3300047469 Ga0495673_0014414 Ga0495673_0014414_1091_2281 396
583 3300047469 Ga0495673_0016671 Ga0495673_0016671_1584_2774 396
584 3300047469 Ga0495673_0019109 Ga0495673_0019109_717_1907 396
585 3300047470 Ga0495681_0012286 Ga0495681_0012286_3221_4417 396
586 3300047470 Ga0495681_0039298 Ga0495681_0039298_182_1372 396
587 3300047470 Ga0495681_0049781 Ga0495681_0049781_726_1916 396
588 3300047472 Ga0495686_0006469 Ga0495686_0006469_3629_4825 396
589 3300047472 Ga0495686_0038250 Ga0495686_0038250_705_1895 396
590 3300048091 Ga0495626_0000548 Ga0495626_0000548_9385_10575 396
591 3300048091 Ga0495626_0008367 Ga0495626_0008367_3806_4996 396
592 3300048925 Ga0496122_0050507 Ga0496122_0050507_1048_2238 396
593 3300048927 Ga0496124_0006609 Ga0496124_0006609_6127_7317 396
594 3300049459 Ga0495678_003074 Ga0495678_003074_4492_5682 396
595 3300049459 Ga0495678_024915 Ga0495678_024915_730_1920 396
596 3300049460 Ga0495682_0021144 Ga0495682_0021144_496_1686 396
597 3300049460 Ga0495682_0026447 Ga0495682_0026447_259_1449 396
598 3300050489 nmdc:mga03683_24164_c1 nmdc:mga03683_24164_c1_124_1314 396
599 3300050491 nmdc:mga00v17_39265_c1 nmdc:mga00v17_39265_c1_739_1929 396
600 iso_pu_bacteria 2844665904 2844671949 396
601 iso_pu_bacteria 8019769354 8019772997 396
602 2124908027 MRS2a_Contig_121 MRS2a_00023300 397
603 2124908027 MRS2a_Contig_928 MRS2a_00771360 397
604 3300002737 JGI25162J39368_1000401 JGI25162J39368_100040131 397
605 3300002771 JGI25163J39215_1000731 JGI25163J39215_10007313 397
606 3300002772 JGI25164J39214_1000282 JGI25164J39214_100028231 397
607 3300003214 JGI25165J46597_1000520 JGI25165J46597_100052031 397
608 3300003781 Ga0055536_1000111 Ga0055536_100011139 397
609 3300003791 Ga0055530_10000146 Ga0055530_1000014636 397
610 3300003792 Ga0055540_1001454 Ga0055540_10014544 397
611 3300005288 Ga0065714_10000086 Ga0065714_1000008610 397
612 3300005288 Ga0065714_10010899 Ga0065714_100108993 397
613 3300005288 Ga0065714_10011589 Ga0065714_100115893 397
614 3300005288 Ga0065714_10066647 Ga0065714_100666476 397
615 3300005290 Ga0065712_10000074 Ga0065712_100000743 397
616 3300005331 Ga0070670_100013921 Ga0070670_1000139215 397
617 3300005344 Ga0070661_100000583 Ga0070661_10000058320 397
618 3300005435 Ga0070714_100073970 Ga0070714_1000739703 397
619 3300005564 Ga0070664_100006005 Ga0070664_1000060054 397
620 3300006058 Ga0075432_10024228 Ga0075432_100242282 397
621 3300009036 Ga0105244_10002261 Ga0105244_100022618 397
622 3300009036 Ga0105244_10010446 Ga0105244_100104463 397
623 3300009148 Ga0105243_10073455 Ga0105243_100734552 397
624 3300009176 Ga0105242_10005806 Ga0105242_100058064 397
625 3300009545 Ga0105237_10001739 Ga0105237_1000173920 397
626 3300011119 Ga0105246_10126886 Ga0105246_101268861 397
627 3300013100 Ga0157373_10014693 Ga0157373_100146931 397
628 3300013100 Ga0157373_10015976 Ga0157373_100159764 397
629 3300013100 Ga0157373_10027008 Ga0157373_100270084 397
630 3300013100 Ga0157373_10049609 Ga0157373_100496092 397
631 3300013102 Ga0157371_10000923 Ga0157371_100009236 397
632 3300013102 Ga0157371_10001987 Ga0157371_100019876 397
633 3300013104 Ga0157370_10009927 Ga0157370_100099274 397
634 3300013104 Ga0157370_10052640 Ga0157370_100526404 397
635 3300013104 Ga0157370_10060812 Ga0157370_100608123 397
636 3300013105 Ga0157369_10021535 Ga0157369_100215356 397
637 3300013105 Ga0157369_10160673 Ga0157369_101606731 397
638 3300013306 Ga0163162_10084771 Ga0163162_100847712 397
639 3300013308 Ga0157375_10171442 Ga0157375_101714423 397
640 3300014497 Ga0182008_10000586 Ga0182008_1000058627 397
641 3300014497 Ga0182008_10003003 Ga0182008_100030036 397
642 3300014497 Ga0182008_10010392 Ga0182008_100103925 397
643 3300015261 Ga0182006_1001437 Ga0182006_10014375 397
644 3300015262 Ga0182007_10001683 Ga0182007_100016837 397
645 3300015262 Ga0182007_10010428 Ga0182007_100104283 397
646 3300015262 Ga0182007_10018839 Ga0182007_100188392 397
647 3300015265 Ga0182005_1000824 Ga0182005_10008247 397
648 3300015265 Ga0182005_1013542 Ga0182005_10135423 397
649 3300017792 Ga0163161_10035426 Ga0163161_100354262 397
650 3300017792 Ga0163161_10038720 Ga0163161_100387203 397
651 3300025207 Ga0209760_100163 Ga0209760_1001637 397
652 3300025231 Ga0207427_100007 Ga0207427_1000077 397
653 3300025233 Ga0209437_100006 Ga0209437_100006273 397
654 3300025261 Ga0209233_1000086 Ga0209233_10000867 397
655 3300025292 Ga0209676_1000006 Ga0209676_1000006255 397
656 3300025298 Ga0209050_1000070 Ga0209050_1000070264 397
657 3300025303 Ga0209051_1000086 Ga0209051_100008697 397
658 3300025728 Ga0207655_1000269 Ga0207655_100026963 397
659 3300025728 Ga0207655_1000448 Ga0207655_100044847 397
660 3300025728 Ga0207655_1004360 Ga0207655_10043603 397
661 3300025728 Ga0207655_1007048 Ga0207655_10070484 397
662 3300025735 Ga0207713_1019988 Ga0207713_10199882 397
663 3300025914 Ga0207671_10001830 Ga0207671_100018308 397
664 3300025920 Ga0207649_10000061 Ga0207649_1000006151 397
665 3300025925 Ga0207650_10001064 Ga0207650_100010647 397
666 3300025934 Ga0207686_10052003 Ga0207686_100520032 397
667 3300025945 Ga0207679_10000018 Ga0207679_10000018176 397
668 3300025961 Ga0207712_10036241 Ga0207712_100362414 397
669 3300027907 Ga0207428_10223057 Ga0207428_102230572 397
670 3300041405 Ga0439438_002940 Ga0439438_002940_5164_6357 397
671 3300041405 Ga0439438_007014 Ga0439438_007014_677_1870 397
672 3300041405 Ga0439438_008756 Ga0439438_008756_618_1814 397
673 3300041407 Ga0439447_002277 Ga0439447_002277_1910_3103 397
674 3300041407 Ga0439447_002583 Ga0439447_002583_225_1418 397
675 3300041407 Ga0439447_014090 Ga0439447_014090_75_1271 397
676 3300041411 Ga0439466_0001387 Ga0439466_0001387_5473_6678 397
677 3300041411 Ga0439466_0003479 Ga0439466_0003479_1800_2993 397
678 3300041411 Ga0439466_0007378 Ga0439466_0007378_1877_3070 397
679 3300041413 Ga0439465_0008609 Ga0439465_0008609_1879_3072 397
680 3300042006 Ga0439432_004912 Ga0439432_004912_714_1907 397
681 3300042006 Ga0439432_013081 Ga0439432_013081_734_1927 397
682 3300042009 Ga0439451_001959 Ga0439451_001959_2820_4013 397
683 3300042009 Ga0439451_003079 Ga0439451_003079_1203_2396 397
684 3300042010 Ga0439452_000266 Ga0439452_000266_6093_7289 397
685 3300042010 Ga0439452_001477 Ga0439452_001477_5097_6290 397
686 3300042010 Ga0439452_012047 Ga0439452_012047_924_2117 397
687 3300042016 Ga0439463_005773 Ga0439463_005773_482_1675 397
688 3300042115 Ga0450911_005737 Ga0450911_005737_599_1792 397
689 3300042121 Ga0450919_000576 Ga0450919_000576_3269_4462 397
690 3300042137 Ga0450902_001089 Ga0450902_001089_2089_3282 397
691 3300042138 Ga0450903_002363 Ga0450903_002363_43_1236 397
692 3300042146 Ga0450907_000076 Ga0450907_000076_29752_30945 397
693 3300042147 Ga0450910_001205 Ga0450910_001205_956_2149 397
694 3300042435 Ga0439434_0000359 Ga0439434_0000359_5229_6422 397
695 3300042461 Ga0439460_0013324 Ga0439460_0013324_358_1551 397
696 3300042461 Ga0439460_0021264 Ga0439460_0021264_557_1750 397
697 3300042533 Ga0450901_001134 Ga0450901_001134_123_1319 397
698 3300042993 Ga0439440_0001586 Ga0439440_0001586_2799_3992 397
699 3300046452 Ga0495617_000141 Ga0495617_000141_6106_7299 397
700 3300046452 Ga0495617_009729 Ga0495617_009729_1710_2903 397
701 3300046452 Ga0495617_017070 Ga0495617_017070_378_1571 397
702 3300046453 Ga0495627_007765 Ga0495627_007765_2081_3274 397
703 3300046453 Ga0495627_010066 Ga0495627_010066_108_1304 397
704 3300046455 Ga0495603_0002181 Ga0495603_0002181_3034_4227 397
705 3300046457 Ga0495590_0001301 Ga0495590_0001301_6106_7299 397
706 3300046457 Ga0495590_0022053 Ga0495590_0022053_120_1313 397
707 3300046458 Ga0495591_003568 Ga0495591_003568_5514_6707 397
708 3300046458 Ga0495591_005551 Ga0495591_005551_2998_4191 397
709 3300046458 Ga0495591_010097 Ga0495591_010097_1002_2195 397
710 3300046458 Ga0495591_010997 Ga0495591_010997_903_2096 397
711 3300046460 Ga0495638_0021673 Ga0495638_0021673_1816_3012 397
712 3300046460 Ga0495638_0028624 Ga0495638_0028624_1826_3019 397
713 3300046463 Ga0495653_0061304 Ga0495653_0061304_1244_2440 397
714 3300046463 Ga0495653_0123602 Ga0495653_0123602_149_1345 397
715 3300046471 Ga0495650_0007590 Ga0495650_0007590_3090_4283 397
716 3300046471 Ga0495650_0015242 Ga0495650_0015242_2048_3241 397
717 3300046471 Ga0495650_0020101 Ga0495650_0020101_1162_2355 397
718 3300046474 Ga0495605_0006090 Ga0495605_0006090_1685_2878 397
719 3300046474 Ga0495605_0012347 Ga0495605_0012347_2013_3206 397
720 3300046474 Ga0495605_0051587 Ga0495605_0051587_179_1372 397
721 3300046475 Ga0495639_0000065 Ga0495639_0000065_6767_7960 397
722 3300046475 Ga0495639_0032924 Ga0495639_0032924_690_1883 397
723 3300046475 Ga0495639_0050124 Ga0495639_0050124_687_1880 397
724 3300046491 Ga0495584_0002333 Ga0495584_0002333_4937_6130 397
725 3300046491 Ga0495584_0013423 Ga0495584_0013423_1823_3016 397
726 3300046492 Ga0495585_0024562 Ga0495585_0024562_185_1378 397
727 3300046492 Ga0495585_0029930 Ga0495585_0029930_122_1315 397
728 3300046492 Ga0495585_0053030 Ga0495585_0053030_194_1387 397
729 3300046499 Ga0495594_0007244 Ga0495594_0007244_4086_5279 397
730 3300046499 Ga0495594_0025949 Ga0495594_0025949_1250_2443 397
731 3300046499 Ga0495594_0062246 Ga0495594_0062246_84_1277 397
732 3300046501 Ga0495607_0000567 Ga0495607_0000567_28974_30167 397
733 3300046501 Ga0495607_0041321 Ga0495607_0041321_1121_2314 397
734 3300046506 Ga0495583_0000968 Ga0495583_0000968_9978_11171 397
735 3300046506 Ga0495583_0006665 Ga0495583_0006665_1328_2521 397
736 3300046506 Ga0495583_0016033 Ga0495583_0016033_1345_2538 397
737 3300046506 Ga0495583_0029751 Ga0495583_0029751_817_2010 397
738 3300046506 Ga0495583_0056837 Ga0495583_0056837_558_1751 397
739 3300046506 Ga0495583_0075693 Ga0495583_0075693_180_1373 397
740 3300046507 Ga0495606_0016105 Ga0495606_0016105_1351_2544 397
741 3300046507 Ga0495606_0033179 Ga0495606_0033179_905_2098 397
742 3300046512 Ga0495610_0005284 Ga0495610_0005284_3734_4930 397
743 3300046512 Ga0495610_0037198 Ga0495610_0037198_414_1607 397
744 3300046513 Ga0495616_0000688 Ga0495616_0000688_3024_4217 397
745 3300046513 Ga0495616_0020640 Ga0495616_0020640_1252_2445 397
746 3300046515 Ga0495620_0008529 Ga0495620_0008529_2560_3753 397
747 3300046515 Ga0495620_0021488 Ga0495620_0021488_933_2126 397
748 3300046516 Ga0495628_0172642 Ga0495628_0172642_323_1519 397
749 3300046517 Ga0495630_0041729 Ga0495630_0041729_1190_2386 397
750 3300046518 Ga0495631_0000521 Ga0495631_0000521_16845_18038 397
751 3300046518 Ga0495631_0055350 Ga0495631_0055350_132_1325 397
752 3300046519 Ga0495632_0000432 Ga0495632_0000432_10266_11459 397
753 3300046519 Ga0495632_0000608 Ga0495632_0000608_5908_7101 397
754 3300046519 Ga0495632_0015579 Ga0495632_0015579_822_2015 397
755 3300046519 Ga0495632_0073366 Ga0495632_0073366_231_1424 397
756 3300046520 Ga0495637_0002079 Ga0495637_0002079_7200_8393 397
757 3300046520 Ga0495637_0005587 Ga0495637_0005587_4125_5318 397
758 3300046520 Ga0495637_0007357 Ga0495637_0007357_2942_4135 397
759 3300046520 Ga0495637_0008313 Ga0495637_0008313_3073_4269 397
760 3300046522 Ga0495643_0006574 Ga0495643_0006574_3851_5044 397
761 3300046524 Ga0495648_0040463 Ga0495648_0040463_1111_2304 397
762 3300046524 Ga0495648_0056475 Ga0495648_0056475_817_2010 397
763 3300046526 Ga0495666_0008103 Ga0495666_0008103_2738_3934 397
764 3300046526 Ga0495666_0033682 Ga0495666_0033682_115_1308 397
765 3300046526 Ga0495666_0047894 Ga0495666_0047894_832_2025 397
766 3300046528 Ga0495642_0000172 Ga0495642_0000172_7036_8229 397
767 3300046528 Ga0495642_0001419 Ga0495642_0001419_4703_5896 397
768 3300046530 Ga0495654_0001740 Ga0495654_0001740_7251_8444 397
769 3300046530 Ga0495654_0005587 Ga0495654_0005587_1323_2516 397
770 3300046530 Ga0495654_0018968 Ga0495654_0018968_1040_2233 397
771 3300046530 Ga0495654_0022047 Ga0495654_0022047_835_2028 397
772 3300046536 Ga0495587_0015865 Ga0495587_0015865_496_1692 397
773 3300046538 Ga0495609_0011673 Ga0495609_0011673_800_1993 397
774 3300046538 Ga0495609_0085765 Ga0495609_0085765_11_1204 397
775 3300046542 Ga0495597_0005760 Ga0495597_0005760_1048_2241 397
776 3300046542 Ga0495597_0006150 Ga0495597_0006150_1169_2365 397
777 3300046542 Ga0495597_0013147 Ga0495597_0013147_1740_2936 397
778 3300046542 Ga0495597_0036137 Ga0495597_0036137_268_1464 397
779 3300046542 Ga0495597_0043214 Ga0495597_0043214_567_1760 397
780 3300046557 Ga0495622_0000946 Ga0495622_0000946_6805_7998 397
781 3300046557 Ga0495622_0001179 Ga0495622_0001179_6104_7297 397
782 3300046557 Ga0495622_0004741 Ga0495622_0004741_2998_4191 397
783 3300046558 Ga0495633_0026023 Ga0495633_0026023_714_1919 397
784 3300046558 Ga0495633_0026523 Ga0495633_0026523_296_1489 397
785 3300046615 Ga0495656_0001717 Ga0495656_0001717_389_1582 397
786 3300046642 Ga0495634_0002102 Ga0495634_0002102_7496_8692 397
787 3300046648 Ga0495611_0012304 Ga0495611_0012304_154_1347 397
788 3300046660 Ga0495625_0008472 Ga0495625_0008472_4821_6014 397
789 3300046660 Ga0495625_0124155 Ga0495625_0124155_356_1552 397
790 3300046660 Ga0495625_0184035 Ga0495625_0184035_101_1294 397
791 3300046663 Ga0495635_0005123 Ga0495635_0005123_1315_2511 397
792 3300046664 Ga0495659_0000092 Ga0495659_0000092_6201_7394 397
793 3300046664 Ga0495659_0001172 Ga0495659_0001172_3185_4378 397
794 3300046664 Ga0495659_0006934 Ga0495659_0006934_2344_3537 397
795 3300046665 Ga0495661_0001022 Ga0495661_0001022_1273_2466 397
796 3300046665 Ga0495661_0005535 Ga0495661_0005535_6054_7247 397
797 3300046665 Ga0495661_0016375 Ga0495661_0016375_44_1237 397
798 3300046674 Ga0495588_0044389 Ga0495588_0044389_955_2148 397
799 3300046675 Ga0495657_0018986 Ga0495657_0018986_2654_3850 397
800 3300046679 Ga0495623_0000951 Ga0495623_0000951_2870_4066 397
801 3300046679 Ga0495623_0004943 Ga0495623_0004943_6449_7645 397
802 3300046680 Ga0495646_0011497 Ga0495646_0011497_3988_5184 397
803 3300046689 Ga0495613_0134374 Ga0495613_0134374_537_1733 397
804 3300046691 Ga0495670_0005779 Ga0495670_0005779_2453_3646 397
805 3300046691 Ga0495670_0006812 Ga0495670_0006812_4420_5613 397
806 3300046691 Ga0495670_0041001 Ga0495670_0041001_940_2133 397
807 3300046692 Ga0495671_0003082 Ga0495671_0003082_2605_3798 397
808 3300046692 Ga0495671_0058690 Ga0495671_0058690_685_1881 397
809 3300046694 Ga0495649_0002668 Ga0495649_0002668_809_2002 397
810 3300046694 Ga0495649_0010903 Ga0495649_0010903_3344_4537 397
811 3300046694 Ga0495649_0023879 Ga0495649_0023879_1293_2489 397
812 3300046694 Ga0495649_0084761 Ga0495649_0084761_76_1269 397
813 3300046794 Ga0495589_0000228 Ga0495589_0000228_40123_41316 397
814 3300046794 Ga0495589_0001972 Ga0495589_0001972_3564_4757 397
815 3300046794 Ga0495589_0014097 Ga0495589_0014097_2889_4082 397
816 3300046794 Ga0495589_0015399 Ga0495589_0015399_1961_3154 397
817 3300046809 Ga0495600_0029297 Ga0495600_0029297_290_1486 397
818 3300046810 Ga0495660_0018547 Ga0495660_0018547_1059_2252 397
819 3300046810 Ga0495660_0025048 Ga0495660_0025048_963_2156 397
820 3300046810 Ga0495660_0033371 Ga0495660_0033371_1224_2417 397
821 3300046810 Ga0495660_0039005 Ga0495660_0039005_492_1685 397
822 3300046810 Ga0495660_0059360 Ga0495660_0059360_198_1391 397
823 3300047315 Ga0495581_0030455 Ga0495581_0030455_1116_2309 397
824 3300047317 Ga0495604_0011485 Ga0495604_0011485_1519_2715 397
825 3300047317 Ga0495604_0047090 Ga0495604_0047090_1198_2394 397
826 3300047318 Ga0495636_0002270 Ga0495636_0002270_2104_3297 397
827 3300047319 Ga0495674_0017071 Ga0495674_0017071_3508_4704 397
828 3300047320 Ga0495672_0003047 Ga0495672_0003047_6106_7299 397
829 3300047320 Ga0495672_0004289 Ga0495672_0004289_5987_7180 397
830 3300047320 Ga0495672_0023190 Ga0495672_0023190_1712_2905 397
831 3300047320 Ga0495672_0043556 Ga0495672_0043556_885_2081 397
832 3300047320 Ga0495672_0066184 Ga0495672_0066184_299_1498 397
833 3300047322 Ga0495680_0009406 Ga0495680_0009406_1102_2298 397
834 3300047322 Ga0495680_0028024 Ga0495680_0028024_1693_2889 397
835 3300047322 Ga0495680_0134514 Ga0495680_0134514_223_1419 397
836 3300047323 Ga0495683_0000621 Ga0495683_0000621_16834_18027 397
837 3300047323 Ga0495683_0027492 Ga0495683_0027492_266_1459 397
838 3300047443 Ga0495687_004681 Ga0495687_004681_4108_5301 397
839 3300047444 Ga0495675_0046321 Ga0495675_0046321_683_1879 397
840 3300047446 Ga0495679_014916 Ga0495679_014916_761_1954 397
841 3300047446 Ga0495679_022103 Ga0495679_022103_376_1569 397
842 3300047447 Ga0495685_016190 Ga0495685_016190_668_1861 397
843 3300047469 Ga0495673_0001327 Ga0495673_0001327_12425_13618 397
844 3300047469 Ga0495673_0002202 Ga0495673_0002202_5960_7159 397
845 3300047469 Ga0495673_0002545 Ga0495673_0002545_5445_6638 397
846 3300047469 Ga0495673_0034151 Ga0495673_0034151_146_1339 397
847 3300047469 Ga0495673_0051825 Ga0495673_0051825_247_1440 397
848 3300047470 Ga0495681_0001359 Ga0495681_0001359_12178_13374 397
849 3300047470 Ga0495681_0015165 Ga0495681_0015165_451_1647 397
850 3300047470 Ga0495681_0019270 Ga0495681_0019270_1797_2990 397
851 3300047470 Ga0495681_0034151 Ga0495681_0034151_386_1579 397
852 3300047470 Ga0495681_0035106 Ga0495681_0035106_731_1924 397
853 3300047472 Ga0495686_0008804 Ga0495686_0008804_1983_3179 397
854 3300047673 Ga0495593_0009697 Ga0495593_0009697_1472_2668 397
855 3300047673 Ga0495593_0072049 Ga0495593_0072049_104_1297 397
856 3300048091 Ga0495626_0002054 Ga0495626_0002054_7450_8643 397
857 3300048091 Ga0495626_0006456 Ga0495626_0006456_805_1998 397
858 3300048905 Ga0496102_0000823 Ga0496102_0000823_21295_22491 397
859 3300048906 Ga0496103_0005342 Ga0496103_0005342_4971_6167 397
860 3300048908 Ga0496105_0035658 Ga0496105_0035658_2110_3303 397
861 3300048908 Ga0496105_0309304 Ga0496105_0309304_35_1228 397
862 3300048909 Ga0496106_0076099 Ga0496106_0076099_1095_2288 397
863 3300048919 Ga0496116_0000792 Ga0496116_0000792_9934_11139 397
864 3300048919 Ga0496116_0001175 Ga0496116_0001175_6174_7367 397
865 3300048919 Ga0496116_0017100 Ga0496116_0017100_3422_4618 397
866 3300048920 Ga0496117_0009704 Ga0496117_0009704_4190_5395 397
867 3300048920 Ga0496117_0011726 Ga0496117_0011726_5500_6693 397
868 3300048920 Ga0496117_0055041 Ga0496117_0055041_690_1886 397
869 3300048921 Ga0496118_0024006 Ga0496118_0024006_687_1883 397
870 3300048921 Ga0496118_0056906 Ga0496118_0056906_972_2165 397
871 3300048921 Ga0496118_0099793 Ga0496118_0099793_286_1491 397
872 3300048923 Ga0496120_0007781 Ga0496120_0007781_5451_6644 397
873 3300048924 Ga0496121_0001360 Ga0496121_0001360_11464_12669 397
874 3300048924 Ga0496121_0024586 Ga0496121_0024586_573_1766 397
875 3300048924 Ga0496121_0049337 Ga0496121_0049337_1214_2407 397
876 3300048924 Ga0496121_0062087 Ga0496121_0062087_804_1997 397
877 3300048925 Ga0496122_0013738 Ga0496122_0013738_5543_6748 397
878 3300048925 Ga0496122_0015843 Ga0496122_0015843_3011_4204 397
879 3300048926 Ga0496123_0038840 Ga0496123_0038840_1466_2671 397
880 3300048926 Ga0496123_0084980 Ga0496123_0084980_27_1220 397
881 3300048927 Ga0496124_0002422 Ga0496124_0002422_780_1973 397
882 3300048928 Ga0496125_0001891 Ga0496125_0001891_26226_27419 397
883 3300048928 Ga0496125_0044986 Ga0496125_0044986_2183_3382 397
884 3300048928 Ga0496125_0076135 Ga0496125_0076135_168_1361 397
885 3300049459 Ga0495678_006150 Ga0495678_006150_45_1238 397
886 3300049459 Ga0495678_008701 Ga0495678_008701_1068_2261 397
887 3300049459 Ga0495678_020523 Ga0495678_020523_718_1911 397
888 3300049459 Ga0495678_023780 Ga0495678_023780_698_1891 397
889 3300049460 Ga0495682_0010238 Ga0495682_0010238_954_2147 397
890 iso_pu_bacteria 2511231006 2511266603 397
891 iso_pu_bacteria 2512047018 2512324167 397
892 iso_pu_bacteria 2554235341 2555671427 397
893 iso_pu_bacteria 2582580891 2583791170 397
894 iso_pu_bacteria 2597489887 2597859511 397
895 iso_pu_bacteria 2599185160 2599354416 397
896 iso_pu_bacteria 2599185161 2599359870 397
897 iso_pu_bacteria 2599185162 2599366192 397
898 iso_pu_bacteria 2599185163 2599372982 397
899 iso_pu_bacteria 2599185164 2599379524 397
900 iso_pu_bacteria 2599185165 2599385498 397
901 iso_pu_bacteria 2599185166 2599391841 397
902 iso_pu_bacteria 2599185168 2599403607 397
903 iso_pu_bacteria 2599185181 2599461250 397
904 iso_pu_bacteria 2599185182 2599469792 397
905 iso_pu_bacteria 2599185185 2599482341 397
906 iso_pu_bacteria 2599185186 2599490270 397
907 iso_pu_bacteria 2599185257 2599803939 397
908 iso_pu_bacteria 2599185356 2600213865 397
909 iso_pu_bacteria 2600254931 2600364415 397
910 iso_pu_bacteria 2600255313 2601774033 397
911 iso_pu_bacteria 2667528171 2671096997 397
912 iso_pu_bacteria 2671180172 2671770492 397
913 iso_pu_bacteria 2740892503 2743739042 397
914 iso_pu_bacteria 2818991464 2819702090 397
915 iso_pu_bacteria 2917070673 2917075294 397
916 iso_pu_bacteria 2923153595 2923158122 397
917 iso_pu_bacteria 2929189879 2929191761 397
918 iso_pu_bacteria 2935353572 2935356282 397
919 iso_pu_bacteria 2984286254 2984288055 397
920 iso_pu_bacteria 3007395558 3007397424 397
921 iso_pu_bacteria 637000220 637321748 397
922 iso_pu_bacteria 8015687852 8015692218 397
923 iso_pu_bacteria 8055770955 8055775427 397
924 iso_pu_bacteria 8057798959 8057804243 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

19

125

0.85

PF07690

MFS_1

Major Facilitator Superfamily

17

351

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.873 11 385
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8495 11 385
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8491 11 385
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8443 11 385
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8408 11 385
ID Description Score Start End Superfamily
af_Q59XM0_143_338_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8847 11 186 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8822 11 180 1.20.1250.20
af_Q8R090_126_283_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8805 45 188 1.20.1250.20
af_Q8VCV9_1_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8748 13 180 1.20.1250.20
af_A0A1D6MD70_48_293_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8713 11 184 1.20.1250.20
ID Description Score Start End GO Terms
AF-C5BIU7-F1-model_v4 Major facilitator family protein 0.9859 5 392 GO:0016020
GO:0022857
AF-A0A7W4JGR8-F1-model_v4 MFS transporter 0.9856 7 383 GO:0016020
GO:0022857
AF-A0A1V9V4B8-F1-model_v4 MFS transporter 0.9854 7 393 GO:0016020
GO:0022857
AF-W6W608-F1-model_v4 deleted 0.9851 1 359
AF-A0A426VFG5-F1-model_v4 MFS transporter 0.985 11 387 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
90.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map