F485749

General Info

Members Datasets Scaffolds Average Seq Length
920 342 779 250

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2511231014|2511313512
Length 269
Sequence LGILLLISLDGVAAQAPLRFVISDSWTMPMVQLERGQPTQGILYDVMVSLATRVGVPAEFHVLPRGRVQNAMEQGEVDVRCYAAQSWLPKPSRDYLWSIPLFTQPDVLITRHAPPTTIKPADLPQQSIGTVLGYSYPTLQPLFDGGQLQRDDARNQEQVLEKLLAGRNRYAVSNQWSLDWFNQRLLPEQQLQGVAVLQEHRIGCYVRNDPQIPVQRILSTLVQMKMSGEIDEIVRLYIGGEPAAIDKSETTKNRPGQDPGSSQKSVSER

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231031 Pseudomonas sp. GM16 Isolate Nodule
20 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
21 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
22 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
23 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
24 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
25 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
26 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
27 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
28 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
29 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
30 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
31 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
32 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
33 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
34 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
35 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
36 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
37 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
38 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
39 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
40 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
41 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
42 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
43 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
44 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
45 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
46 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
47 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
48 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
49 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
50 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
51 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
52 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
53 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
54 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
55 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
56 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
57 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
58 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
59 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
60 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
61 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
62 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
63 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
64 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
65 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
66 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
67 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
68 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
69 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
70 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
71 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
72 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
73 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
74 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
75 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
76 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
77 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
78 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
79 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
80 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
81 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
82 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
83 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
84 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
85 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
86 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
87 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
88 2773857670 Pseudomonas sp. 478 Isolate Unclassified
89 2784132072 Pseudomonas sp. 460 Isolate Unclassified
90 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
91 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
92 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
93 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
94 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
95 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
96 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
97 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
98 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
99 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
100 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
101 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
102 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
103 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
104 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
105 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
106 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
107 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
108 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
109 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
110 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
111 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
112 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
113 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
114 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
115 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
116 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
117 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
118 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
119 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
120 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
121 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
122 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
123 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
124 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
125 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
126 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
127 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
128 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
129 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
130 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
131 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
132 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
133 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
134 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
135 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
136 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
137 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
138 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
139 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
140 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
143 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
144 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
145 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
146 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
183 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
184 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
195 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
200 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
201 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
202 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
203 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
204 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
205 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
206 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
207 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
210 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
211 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
212 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
213 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
214 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
215 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
216 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
217 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
295 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
321 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
322 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
323 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
324 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
325 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
326 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
330 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
331 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
332 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
333 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
334 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
335 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
336 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
337 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
338 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
339 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
340 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
341 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
342 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.67
Metatranscriptomes 0
Isolates 15.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 2.61
Rhizoplane 6.85
Rhizosphere 80.33
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_82 2124908027 Bacteria 33031
2 SwRhRL2b_contig_3738944 2162886007 Bacteria 3133
3 JGI25163J39215_1000402 3300002771 Bacteria 13718
4 JGI25164J39214_1000651 3300002772 Bacteria 14270
5 JGI25165J46597_1000152 3300003214 Bacteria 113071
6 Ga0055536_1003264 3300003781 Bacteria 8791
7 Ga0055536_1003804 3300003781 Bacteria 7957
8 Ga0055530_10000107 3300003791 Bacteria 71445
9 Ga0055530_10000226 3300003791 Bacteria 50165
10 Ga0055530_10006058 3300003791 Bacteria 5524
11 Ga0055540_1000074 3300003792 Bacteria 116719
12 Ga0055540_1000140 3300003792 Bacteria 72280
13 Ga0055540_1000323 3300003792 Bacteria 42284
14 Ga0055531_10000268 3300003794 Bacteria 54171
15 Ga0065714_10000356 3300005288 Bacteria 5378
16 Ga0065714_10003425 3300005288 Bacteria 10873
17 Ga0065714_10015992 3300005288 Bacteria 1436
18 Ga0065714_10021189 3300005288 Bacteria 1115
19 Ga0065714_10071744 3300005288 Bacteria 3502
20 Ga0065714_10086723 3300005288 Bacteria 2085
21 Ga0065714_10153857 3300005288 Bacteria 1090
22 Ga0065704_10001803 3300005289 Bacteria 6507
23 Ga0065712_10003055 3300005290 Bacteria 4863
24 Ga0070665_100287467 3300005548 Bacteria 1646
25 Ga0075364_10221082 3300006051 Bacteria 1285
26 Ga0075364_10229294 3300006051 Bacteria 1261
27 Ga0075364_10300126 3300006051 Bacteria 1093
28 Ga0075364_10331679 3300006051 Bacteria 1036
29 Ga0075364_10345553 3300006051 Bacteria 1014
30 Ga0075432_10007513 3300006058 Bacteria 3712
31 Ga0075432_10008955 3300006058 Bacteria 3412
32 Ga0075432_10015300 3300006058 Bacteria 2615
33 Ga0075432_10024015 3300006058 Bacteria 2088
34 Ga0075432_10082655 3300006058 Bacteria 1166
35 Ga0075432_10085376 3300006058 Bacteria 1149
36 Ga0075432_10107075 3300006058 Bacteria 1038
37 Ga0075369_10049562 3300006186 Bacteria 1814
38 Ga0079104_1000684 3300006946 Bacteria 31336
39 Ga0079104_1001184 3300006946 Bacteria 18781
40 Ga0079104_1030844 3300006946 Bacteria 1334
41 Ga0099826_10007191 3300006948 Bacteria 8189
42 Ga0105251_10007337 3300009011 Bacteria 6816
43 Ga0105251_10023283 3300009011 Bacteria 3199
44 Ga0105251_10023306 3300009011 Bacteria 3197
45 Ga0105244_10020180 3300009036 Bacteria 3704
46 Ga0105244_10112796 3300009036 Bacteria 1321
47 Ga0105244_10137863 3300009036 Bacteria 1175
48 Ga0105244_10182905 3300009036 Bacteria 994
49 Ga0105244_10193799 3300009036 Bacteria 960
50 Ga0105250_10016238 3300009092 Bacteria 3038
51 Ga0105250_10089685 3300009092 Bacteria 1249
52 Ga0105243_10000621 3300009148 Bacteria 35331
53 Ga0105243_10045724 3300009148 Bacteria 3442
54 Ga0105246_10000624 3300011119 Bacteria 19742
55 Ga0157345_1000090 3300012498 Bacteria 19296
56 Ga0157373_10000806 3300013100 Bacteria 24254
57 Ga0157373_10255153 3300013100 Bacteria 1240
58 Ga0157371_10006833 3300013102 Bacteria 9322
59 Ga0157371_10031229 3300013102 Bacteria 3838
60 Ga0157371_10031272 3300013102 Bacteria 3834
61 Ga0157370_10057465 3300013104 Bacteria 3699
62 Ga0157370_10060364 3300013104 Bacteria 3600
63 Ga0157370_10062766 3300013104 Bacteria 3523
64 Ga0157370_10149575 3300013104 Bacteria 2173
65 Ga0157370_10184307 3300013104 Bacteria 1939
66 Ga0157370_10686077 3300013104 Bacteria 935
67 Ga0157369_10068703 3300013105 Bacteria 3807
68 Ga0157369_10298841 3300013105 Bacteria 1675
69 Ga0157369_10429392 3300013105 Bacteria 1369
70 Ga0157369_10508280 3300013105 Bacteria 1246
71 Ga0163162_10090674 3300013306 Bacteria 3138
72 Ga0163162_10535971 3300013306 Bacteria 1299
73 Ga0157375_10208547 3300013308 Bacteria 2111
74 Ga0182008_10003572 3300014497 Bacteria 9324
75 Ga0182008_10015443 3300014497 Bacteria 3984
76 Ga0182008_10017775 3300014497 Bacteria 3685
77 Ga0182008_10046943 3300014497 Bacteria 2146
78 Ga0182008_10116086 3300014497 Bacteria 1328
79 Ga0182008_10130501 3300014497 Bacteria 1253
80 Ga0182008_10157454 3300014497 Bacteria 1141
81 Ga0182008_10229346 3300014497 Bacteria 952
82 Ga0182006_1004941 3300015261 Bacteria 6445
83 Ga0182006_1012726 3300015261 Bacteria 3675
84 Ga0182006_1016814 3300015261 Bacteria 3117
85 Ga0182006_1020734 3300015261 Bacteria 2750
86 Ga0182006_1033357 3300015261 Bacteria 2065
87 Ga0182006_1066182 3300015261 Bacteria 1351
88 Ga0182007_10010922 3300015262 Bacteria 3560
89 Ga0182007_10023368 3300015262 Bacteria 2173
90 Ga0182005_1006173 3300015265 Bacteria 3683
91 Ga0182005_1013705 3300015265 Bacteria 2279
92 Ga0182005_1037378 3300015265 Bacteria 1320
93 Ga0163161_10005503 3300017792 Bacteria 8784
94 Ga0163161_10045478 3300017792 Bacteria 3166
95 Ga0163161_10075482 3300017792 Bacteria 2474
96 Ga0163161_10094288 3300017792 Bacteria 2219
97 Ga0163161_10305827 3300017792 Bacteria 1253
98 Ga0163161_10471049 3300017792 Bacteria 1018
99 Ga0209760_100329 3300025207 Bacteria 14328
100 Ga0207427_100001 3300025231 Bacteria 1410763
101 Ga0209437_100003 3300025233 Bacteria 1517827
102 Ga0209233_1000007 3300025261 Bacteria 1411234
103 Ga0209675_1007408 3300025291 Bacteria 4213
104 Ga0209676_1000021 3300025292 Bacteria 609534
105 Ga0209676_1000055 3300025292 Bacteria 361565
106 Ga0209676_1000127 3300025292 Bacteria 189701
107 Ga0209050_1000009 3300025298 Bacteria 1047265
108 Ga0209050_1000120 3300025298 Bacteria 198658
109 Ga0209050_1000162 3300025298 Bacteria 155309
110 Ga0209050_1001848 3300025298 Bacteria 20466
111 Ga0209051_1000008 3300025303 Bacteria 706935
112 Ga0209051_1000083 3300025303 Bacteria 192732
113 Ga0209051_1000121 3300025303 Bacteria 146477
114 Ga0209051_1019512 3300025303 Bacteria 2955
115 Ga0209257_1000463 3300025304 Bacteria 74737
116 Ga0209257_1011451 3300025304 Bacteria 4269
117 Ga0207696_1003882 3300025711 Bacteria 6612
118 Ga0207696_1004450 3300025711 Bacteria 6035
119 Ga0207696_1019209 3300025711 Bacteria 2231
120 Ga0207696_1055476 3300025711 Bacteria 1124
121 Ga0207696_1056796 3300025711 Bacteria 1108
122 Ga0207655_1000187 3300025728 Bacteria 109886
123 Ga0207655_1001660 3300025728 Bacteria 19711
124 Ga0207655_1009485 3300025728 Bacteria 6034
125 Ga0207655_1035671 3300025728 Bacteria 2217
126 Ga0207655_1084513 3300025728 Bacteria 1135
127 Ga0207713_1005042 3300025735 Bacteria 8394
128 Ga0207713_1006066 3300025735 Bacteria 7450
129 Ga0207713_1006144 3300025735 Bacteria 7377
130 Ga0207713_1011352 3300025735 Bacteria 4853
131 Ga0207713_1098403 3300025735 Bacteria 1014
132 Ga0207681_10014425 3300025923 Bacteria 4911
133 Ga0207709_10000236 3300025935 Bacteria 69891
134 Ga0207709_10000516 3300025935 Bacteria 33987
135 Ga0209281_1000011 3300027111 Bacteria 695292
136 Ga0209281_1000090 3300027111 Bacteria 242950
137 Ga0209282_1061890 3300027666 Bacteria 2082
138 Ga0207428_10029541 3300027907 Bacteria 4542
139 Ga0207428_10076781 3300027907 Bacteria 2616
140 Ga0207428_10084799 3300027907 Bacteria 2468
141 Ga0207428_10139226 3300027907 Bacteria 1854
142 Ga0207428_10365225 3300027907 Bacteria 1061
143 Ga0207428_10371819 3300027907 Bacteria 1050
144 Ga0307511_10193615 3300030521 Bacteria 1069
145 Ga0316177_1188831 3300030731 Bacteria 2065
146 Ga0316178_1110600 3300030735 Bacteria 5098
147 Ga0316181_1236466 3300030744 Bacteria 1082
148 Ga0307408_100001387 3300031548 Bacteria 18018
149 Ga0307408_100050349 3300031548 Bacteria 2995
150 Ga0307408_100093337 3300031548 Bacteria 2276
151 Ga0307408_100540722 3300031548 Bacteria 1026
152 Ga0307405_10039162 3300031731 Bacteria 2862
153 Ga0307406_10153599 3300031901 Bacteria 1645
154 Ga0307406_10475873 3300031901 Bacteria 1007
155 Ga0307406_10558817 3300031901 Bacteria 937
156 Ga0307407_10027776 3300031903 Bacteria 3016
157 Ga0307412_10047326 3300031911 Bacteria 2825
158 Ga0307412_10051434 3300031911 Bacteria 2722
159 Ga0307412_10051435 3300031911 Bacteria 2722
160 Ga0307412_10061299 3300031911 Bacteria 2528
161 Ga0307409_100067120 3300031995 Bacteria 2831
162 Ga0307409_100523887 3300031995 Bacteria 1158
163 Ga0307414_10139572 3300032004 Bacteria 1895
164 Ga0307414_10230573 3300032004 Bacteria 1526
165 Ga0307414_10411800 3300032004 Bacteria 1177
166 Ga0307414_10437021 3300032004 Bacteria 1144
167 Ga0307414_10517488 3300032004 Bacteria 1058
168 Ga0307411_10053396 3300032005 Bacteria 2647
169 Ga0307411_10121545 3300032005 Bacteria 1890
170 Ga0307510_10005771 3300033180 Bacteria 14755
171 Ga0307510_10286553 3300033180 Bacteria 1115
172 Ga0439438_005868 3300041405 Bacteria 4446
173 Ga0439438_008843 3300041405 Bacteria 3302
174 Ga0439438_010722 3300041405 Bacteria 2884
175 Ga0439438_010742 3300041405 Bacteria 2882
176 Ga0439438_021597 3300041405 Bacteria 1793
177 Ga0439438_046932 3300041405 Bacteria 1108
178 Ga0439447_003278 3300041407 Bacteria 5758
179 Ga0439447_008945 3300041407 Bacteria 3070
180 Ga0439447_011825 3300041407 Bacteria 2529
181 Ga0439447_032245 3300041407 Bacteria 1310
182 Ga0439447_047112 3300041407 Bacteria 1036
183 Ga0439447_048983 3300041407 Bacteria 1012
184 Ga0439466_0002381 3300041411 Bacteria 7371
185 Ga0439466_0002915 3300041411 Bacteria 6690
186 Ga0439466_0013887 3300041411 Bacteria 2942
187 Ga0439466_0048085 3300041411 Bacteria 1404
188 Ga0439466_0064488 3300041411 Bacteria 1174
189 Ga0439466_0087033 3300041411 Bacteria 981
190 Ga0439466_0094208 3300041411 Bacteria 937
191 Ga0439431_0004512 3300041997 Bacteria 3060
192 Ga0439445_0025577 3300042004 Bacteria 1506
193 Ga0439445_0070051 3300042004 Bacteria 969
194 Ga0439432_010586 3300042006 Bacteria 3189
195 Ga0439432_012174 3300042006 Bacteria 2950
196 Ga0439432_012462 3300042006 Bacteria 2909
197 Ga0439432_032134 3300042006 Bacteria 1694
198 Ga0439432_080669 3300042006 Bacteria 985
199 Ga0439451_003578 3300042009 Bacteria 3146
200 Ga0439452_000461 3300042010 Bacteria 22773
201 Ga0439452_008775 3300042010 Bacteria 3018
202 Ga0439452_029884 3300042010 Bacteria 1348
203 Ga0439452_037747 3300042010 Bacteria 1150
204 Ga0439456_007086 3300042013 Bacteria 2296
205 Ga0439463_000613 3300042016 Bacteria 9914
206 Ga0439463_005528 3300042016 Bacteria 3141
207 Ga0439463_060131 3300042016 Bacteria 971
208 Ga0439463_063383 3300042016 Bacteria 944
209 Ga0450911_000800 3300042115 Bacteria 8690
210 Ga0450911_003968 3300042115 Bacteria 2495
211 Ga0450919_006006 3300042121 Bacteria 1446
212 Ga0450920_006111 3300042122 Bacteria 2157
213 Ga0450922_003469 3300042124 Bacteria 1451
214 Ga0450923_044108 3300042125 Bacteria 944
215 Ga0450891_006460 3300042129 Bacteria 1079
216 Ga0450892_005700 3300042130 Bacteria 1028
217 Ga0450902_005851 3300042137 Bacteria 1872
218 Ga0450902_017113 3300042137 Bacteria 1183
219 Ga0450905_001215 3300042142 Bacteria 3264
220 Ga0450905_002489 3300042142 Bacteria 2367
221 Ga0450905_020724 3300042142 Bacteria 968
222 Ga0450906_000874 3300042145 Bacteria 6614
223 Ga0450906_015557 3300042145 Bacteria 1380
224 Ga0450906_018396 3300042145 Bacteria 1254
225 Ga0450907_000151 3300042146 Bacteria 26642
226 Ga0450907_002221 3300042146 Bacteria 3784
227 Ga0450910_000958 3300042147 Bacteria 3490
228 Ga0450910_002447 3300042147 Bacteria 2441
229 Ga0439446_0010903 3300042156 Bacteria 2457
230 Ga0450909_000347 3300042185 Bacteria 5828
231 Ga0450909_002287 3300042185 Bacteria 2713
232 Ga0439434_0035662 3300042435 Bacteria 1520
233 Ga0439460_0003624 3300042461 Bacteria 3738
234 Ga0450918_023632 3300042531 Bacteria 1074
235 Ga0450918_031293 3300042531 Bacteria 940
236 Ga0439440_0010877 3300042993 Bacteria 1910
237 Ga0439440_0047396 3300042993 Bacteria 1065
238 Ga0495617_001947 3300046452 Bacteria 8656
239 Ga0495617_021982 3300046452 Bacteria 2155
240 Ga0495617_022210 3300046452 Bacteria 2144
241 Ga0495617_050041 3300046452 Bacteria 1390
242 Ga0495617_054640 3300046452 Bacteria 1325
243 Ga0495617_056988 3300046452 Bacteria 1295
244 Ga0495617_066423 3300046452 Bacteria 1188
245 Ga0495627_000501 3300046453 Bacteria 32809
246 Ga0495627_004891 3300046453 Bacteria 5512
247 Ga0495627_007136 3300046453 Bacteria 4317
248 Ga0495627_011548 3300046453 Bacteria 3167
249 Ga0495627_011989 3300046453 Bacteria 3088
250 Ga0495627_040790 3300046453 Bacteria 1428
251 Ga0495627_069333 3300046453 Bacteria 1032
252 Ga0495603_0033952 3300046455 Bacteria 3069
253 Ga0495603_0079667 3300046455 Bacteria 1920
254 Ga0495603_0157778 3300046455 Bacteria 1316
255 Ga0495590_0000444 3300046457 Bacteria 20557
256 Ga0495590_0007580 3300046457 Bacteria 4175
257 Ga0495590_0010739 3300046457 Bacteria 3432
258 Ga0495590_0015304 3300046457 Bacteria 2786
259 Ga0495590_0024494 3300046457 Bacteria 2126
260 Ga0495590_0071147 3300046457 Bacteria 1220
261 Ga0495590_0093029 3300046457 Bacteria 1067
262 Ga0495590_0120221 3300046457 Bacteria 941
263 Ga0495591_000310 3300046458 Bacteria 44305
264 Ga0495591_002320 3300046458 Bacteria 10753
265 Ga0495591_011988 3300046458 Bacteria 3250
266 Ga0495591_013860 3300046458 Bacteria 2926
267 Ga0495591_023591 3300046458 Bacteria 1967
268 Ga0495591_025727 3300046458 Bacteria 1841
269 Ga0495591_026036 3300046458 Bacteria 1825
270 Ga0495591_053154 3300046458 Bacteria 1099
271 Ga0495591_055677 3300046458 Bacteria 1065
272 Ga0495629_0303747 3300046459 Bacteria 1093
273 Ga0495638_0000726 3300046460 Bacteria 35496
274 Ga0495638_0008919 3300046460 Bacteria 7071
275 Ga0495638_0014617 3300046460 Bacteria 5297
276 Ga0495638_0015802 3300046460 Bacteria 5056
277 Ga0495638_0071323 3300046460 Bacteria 2125
278 Ga0495638_0103144 3300046460 Bacteria 1703
279 Ga0495638_0165282 3300046460 Bacteria 1273
280 Ga0495638_0177101 3300046460 Bacteria 1219
281 Ga0495638_0184338 3300046460 Bacteria 1188
282 Ga0495638_0200303 3300046460 Bacteria 1127
283 Ga0495638_0203726 3300046460 Bacteria 1115
284 Ga0495638_0265853 3300046460 Bacteria 938
285 Ga0495638_0273617 3300046460 Bacteria 920
286 Ga0495638_0295459 3300046460 Bacteria 875
287 Ga0495653_0000981 3300046463 Bacteria 21955
288 Ga0495650_0016833 3300046471 Bacteria 3683
289 Ga0495650_0017635 3300046471 Bacteria 3573
290 Ga0495650_0019735 3300046471 Bacteria 3306
291 Ga0495650_0021292 3300046471 Bacteria 3138
292 Ga0495650_0099130 3300046471 Bacteria 1097
293 Ga0495650_0143395 3300046471 Bacteria 862
294 Ga0495650_0187039 3300046471 Bacteria 725
295 Ga0495582_0256750 3300046473 Bacteria 1002
296 Ga0495605_0005109 3300046474 Bacteria 7651
297 Ga0495605_0008392 3300046474 Bacteria 5840
298 Ga0495605_0013841 3300046474 Bacteria 4432
299 Ga0495605_0018909 3300046474 Bacteria 3688
300 Ga0495605_0021181 3300046474 Bacteria 3446
301 Ga0495605_0080804 3300046474 Bacteria 1521
302 Ga0495605_0112549 3300046474 Bacteria 1240
303 Ga0495605_0151554 3300046474 Bacteria 1034
304 Ga0495605_0172916 3300046474 Bacteria 953
305 Ga0495639_0002271 3300046475 Bacteria 8422
306 Ga0495639_0002710 3300046475 Bacteria 7705
307 Ga0495639_0212922 3300046475 Bacteria 948
308 Ga0495584_0003891 3300046491 Bacteria 8081
309 Ga0495584_0016254 3300046491 Bacteria 3795
310 Ga0495584_0019585 3300046491 Bacteria 3437
311 Ga0495584_0023165 3300046491 Bacteria 3149
312 Ga0495584_0024493 3300046491 Bacteria 3061
313 Ga0495584_0029935 3300046491 Bacteria 2758
314 Ga0495584_0075065 3300046491 Bacteria 1699
315 Ga0495584_0078833 3300046491 Bacteria 1657
316 Ga0495584_0102352 3300046491 Bacteria 1448
317 Ga0495584_0159510 3300046491 Bacteria 1146
318 Ga0495584_0165371 3300046491 Bacteria 1124
319 Ga0495585_0004299 3300046492 Bacteria 9273
320 Ga0495585_0004885 3300046492 Bacteria 8590
321 Ga0495585_0007669 3300046492 Bacteria 6582
322 Ga0495585_0019087 3300046492 Bacteria 3956
323 Ga0495585_0030157 3300046492 Bacteria 3085
324 Ga0495585_0030286 3300046492 Bacteria 3078
325 Ga0495585_0031340 3300046492 Bacteria 3018
326 Ga0495585_0076873 3300046492 Bacteria 1813
327 Ga0495585_0132077 3300046492 Bacteria 1313
328 Ga0495585_0151538 3300046492 Bacteria 1208
329 Ga0495585_0184474 3300046492 Bacteria 1071
330 Ga0495585_0191683 3300046492 Bacteria 1045
331 Ga0495585_0238793 3300046492 Bacteria 910
332 Ga0495594_0020293 3300046499 Bacteria 3538
333 Ga0495594_0037719 3300046499 Bacteria 2637
334 Ga0495594_0223584 3300046499 Bacteria 1073
335 Ga0495594_0242992 3300046499 Bacteria 1026
336 Ga0495596_0001042 3300046500 Bacteria 16463
337 Ga0495596_0015937 3300046500 Bacteria 3130
338 Ga0495596_0229227 3300046500 Bacteria 721
339 Ga0495607_0001014 3300046501 Bacteria 25836
340 Ga0495607_0001116 3300046501 Bacteria 24345
341 Ga0495607_0004187 3300046501 Bacteria 10713
342 Ga0495607_0005920 3300046501 Bacteria 8674
343 Ga0495607_0011355 3300046501 Bacteria 5934
344 Ga0495607_0034029 3300046501 Bacteria 3095
345 Ga0495607_0059623 3300046501 Bacteria 2176
346 Ga0495607_0138634 3300046501 Bacteria 1257
347 Ga0495607_0153866 3300046501 Bacteria 1174
348 Ga0495607_0161842 3300046501 Bacteria 1136
349 Ga0495607_0187586 3300046501 Bacteria 1032
350 Ga0495607_0198386 3300046501 Bacteria 995
351 Ga0495583_0008133 3300046506 Bacteria 6459
352 Ga0495583_0077862 3300046506 Bacteria 1445
353 Ga0495583_0078339 3300046506 Bacteria 1439
354 Ga0495583_0135209 3300046506 Bacteria 1029
355 Ga0495583_0145072 3300046506 Bacteria 986
356 Ga0495606_0005734 3300046507 Bacteria 11744
357 Ga0495606_0007627 3300046507 Bacteria 9618
358 Ga0495606_0021735 3300046507 Bacteria 4694
359 Ga0495606_0054879 3300046507 Bacteria 2579
360 Ga0495606_0079333 3300046507 Bacteria 2044
361 Ga0495606_0141627 3300046507 Bacteria 1419
362 Ga0495606_0317319 3300046507 Bacteria 838
363 Ga0495606_0324668 3300046507 Bacteria 825
364 Ga0495610_0002656 3300046512 Bacteria 14760
365 Ga0495610_0015687 3300046512 Bacteria 4392
366 Ga0495610_0016019 3300046512 Bacteria 4333
367 Ga0495610_0029967 3300046512 Bacteria 2857
368 Ga0495610_0049832 3300046512 Bacteria 2047
369 Ga0495610_0062367 3300046512 Bacteria 1768
370 Ga0495610_0077926 3300046512 Bacteria 1529
371 Ga0495610_0122729 3300046512 Bacteria 1136
372 Ga0495610_0130686 3300046512 Bacteria 1090
373 Ga0495610_0130694 3300046512 Bacteria 1090
374 Ga0495610_0158882 3300046512 Bacteria 957
375 Ga0495616_0004514 3300046513 Bacteria 8761
376 Ga0495616_0019823 3300046513 Bacteria 3666
377 Ga0495616_0035753 3300046513 Bacteria 2567
378 Ga0495616_0058775 3300046513 Bacteria 1892
379 Ga0495616_0071221 3300046513 Bacteria 1681
380 Ga0495616_0092287 3300046513 Bacteria 1431
381 Ga0495616_0134655 3300046513 Bacteria 1129
382 Ga0495616_0192194 3300046513 Bacteria 901
383 Ga0495620_0000551 3300046515 Bacteria 23678
384 Ga0495620_0000886 3300046515 Bacteria 18382
385 Ga0495620_0006213 3300046515 Bacteria 6579
386 Ga0495620_0047635 3300046515 Bacteria 1843
387 Ga0495620_0079070 3300046515 Bacteria 1332
388 Ga0495620_0088577 3300046515 Bacteria 1243
389 Ga0495628_0164408 3300046516 Bacteria 1685
390 Ga0495628_0281280 3300046516 Bacteria 1235
391 Ga0495630_0006130 3300046517 Bacteria 8524
392 Ga0495630_0227449 3300046517 Bacteria 1424
393 Ga0495631_0006495 3300046518 Bacteria 6033
394 Ga0495631_0029801 3300046518 Bacteria 2479
395 Ga0495631_0076746 3300046518 Bacteria 1442
396 Ga0495631_0129494 3300046518 Bacteria 1084
397 Ga0495631_0197036 3300046518 Bacteria 861
398 Ga0495632_0002085 3300046519 Bacteria 15633
399 Ga0495632_0003243 3300046519 Bacteria 11667
400 Ga0495632_0005193 3300046519 Bacteria 8684
401 Ga0495632_0020410 3300046519 Bacteria 3587
402 Ga0495632_0023643 3300046519 Bacteria 3278
403 Ga0495632_0053918 3300046519 Bacteria 1972
404 Ga0495632_0142616 3300046519 Bacteria 1110
405 Ga0495632_0166867 3300046519 Bacteria 1012
406 Ga0495632_0169804 3300046519 Bacteria 1002
407 Ga0495632_0263995 3300046519 Bacteria 769
408 Ga0495637_0000647 3300046520 Bacteria 24394
409 Ga0495637_0004677 3300046520 Bacteria 7066
410 Ga0495637_0005757 3300046520 Bacteria 6279
411 Ga0495637_0007830 3300046520 Bacteria 5274
412 Ga0495637_0012922 3300046520 Bacteria 3978
413 Ga0495637_0018505 3300046520 Bacteria 3230
414 Ga0495637_0027011 3300046520 Bacteria 2571
415 Ga0495637_0069277 3300046520 Bacteria 1427
416 Ga0495637_0083543 3300046520 Bacteria 1269
417 Ga0495637_0084276 3300046520 Bacteria 1262
418 Ga0495637_0092046 3300046520 Bacteria 1194
419 Ga0495637_0095567 3300046520 Bacteria 1166
420 Ga0495637_0097528 3300046520 Bacteria 1152
421 Ga0495637_0104989 3300046520 Bacteria 1100
422 Ga0495637_0127049 3300046520 Bacteria 976
423 Ga0495643_0013197 3300046522 Bacteria 4955
424 Ga0495643_0027149 3300046522 Bacteria 3221
425 Ga0495643_0083934 3300046522 Bacteria 1653
426 Ga0495643_0138169 3300046522 Bacteria 1217
427 Ga0495643_0138960 3300046522 Bacteria 1213
428 Ga0495643_0170009 3300046522 Bacteria 1066
429 Ga0495643_0175774 3300046522 Bacteria 1043
430 Ga0495643_0201981 3300046522 Bacteria 953
431 Ga0495643_0218675 3300046522 Bacteria 905
432 Ga0495644_0000518 3300046523 Bacteria 16495
433 Ga0495644_0006158 3300046523 Bacteria 4664
434 Ga0495644_0020831 3300046523 Bacteria 2501
435 Ga0495644_0040700 3300046523 Bacteria 1751
436 Ga0495644_0065118 3300046523 Bacteria 1369
437 Ga0495648_0002458 3300046524 Bacteria 17068
438 Ga0495648_0007322 3300046524 Bacteria 8845
439 Ga0495648_0023930 3300046524 Bacteria 4171
440 Ga0495648_0039349 3300046524 Bacteria 3009
441 Ga0495648_0042816 3300046524 Bacteria 2845
442 Ga0495648_0044816 3300046524 Bacteria 2757
443 Ga0495648_0048674 3300046524 Bacteria 2607
444 Ga0495648_0052022 3300046524 Bacteria 2491
445 Ga0495648_0087341 3300046524 Bacteria 1756
446 Ga0495648_0093438 3300046524 Bacteria 1677
447 Ga0495648_0122344 3300046524 Bacteria 1396
448 Ga0495648_0132351 3300046524 Bacteria 1324
449 Ga0495648_0169890 3300046524 Bacteria 1118
450 Ga0495648_0192276 3300046524 Bacteria 1028
451 Ga0495648_0204298 3300046524 Bacteria 986
452 Ga0495666_0000114 3300046526 Bacteria 33536
453 Ga0495666_0005803 3300046526 Bacteria 6223
454 Ga0495666_0018108 3300046526 Bacteria 3508
455 Ga0495666_0158496 3300046526 Bacteria 1050
456 Ga0495642_0000256 3300046528 Bacteria 29844
457 Ga0495642_0001924 3300046528 Bacteria 8803
458 Ga0495642_0001961 3300046528 Bacteria 8653
459 Ga0495652_0159388 3300046529 Bacteria 1754
460 Ga0495654_0000675 3300046530 Bacteria 26908
461 Ga0495654_0004364 3300046530 Bacteria 8416
462 Ga0495654_0013188 3300046530 Bacteria 4426
463 Ga0495654_0016816 3300046530 Bacteria 3854
464 Ga0495654_0018555 3300046530 Bacteria 3643
465 Ga0495654_0026578 3300046530 Bacteria 2974
466 Ga0495654_0053440 3300046530 Bacteria 1963
467 Ga0495654_0055180 3300046530 Bacteria 1924
468 Ga0495654_0055402 3300046530 Bacteria 1919
469 Ga0495654_0056619 3300046530 Bacteria 1894
470 Ga0495654_0062475 3300046530 Bacteria 1785
471 Ga0495654_0113676 3300046530 Bacteria 1232
472 Ga0495654_0117869 3300046530 Bacteria 1204
473 Ga0495654_0120424 3300046530 Bacteria 1188
474 Ga0495654_0125910 3300046530 Bacteria 1154
475 Ga0495654_0131226 3300046530 Bacteria 1124
476 Ga0495654_0132667 3300046530 Bacteria 1116
477 Ga0495654_0163526 3300046530 Bacteria 975
478 Ga0495665_0339435 3300046531 Bacteria 766
479 Ga0495586_0130120 3300046535 Bacteria 1409
480 Ga0495587_0001129 3300046536 Bacteria 17456
481 Ga0495587_0119116 3300046536 Bacteria 1512
482 Ga0495609_0005814 3300046538 Bacteria 6400
483 Ga0495609_0010504 3300046538 Bacteria 4438
484 Ga0495609_0020173 3300046538 Bacteria 3080
485 Ga0495609_0020292 3300046538 Bacteria 3070
486 Ga0495609_0061220 3300046538 Bacteria 1663
487 Ga0495609_0142489 3300046538 Bacteria 1022
488 Ga0495609_0151171 3300046538 Bacteria 987
489 Ga0495609_0158763 3300046538 Bacteria 959
490 Ga0495609_0187977 3300046538 Bacteria 867
491 Ga0495597_0001496 3300046542 Bacteria 16715
492 Ga0495597_0006668 3300046542 Bacteria 5948
493 Ga0495597_0015389 3300046542 Bacteria 3623
494 Ga0495597_0020438 3300046542 Bacteria 3084
495 Ga0495597_0021335 3300046542 Bacteria 3011
496 Ga0495597_0021884 3300046542 Bacteria 2970
497 Ga0495597_0034793 3300046542 Bacteria 2275
498 Ga0495597_0040074 3300046542 Bacteria 2094
499 Ga0495597_0072666 3300046542 Bacteria 1479
500 Ga0495597_0127668 3300046542 Bacteria 1056
501 Ga0495597_0134508 3300046542 Bacteria 1023
502 Ga0495597_0137719 3300046542 Bacteria 1008
503 Ga0495597_0148816 3300046542 Bacteria 961
504 Ga0495597_0158069 3300046542 Bacteria 926
505 Ga0495622_0007834 3300046557 Bacteria 4960
506 Ga0495622_0031617 3300046557 Bacteria 2472
507 Ga0495622_0036173 3300046557 Bacteria 2302
508 Ga0495622_0076568 3300046557 Bacteria 1541
509 Ga0495622_0109680 3300046557 Bacteria 1263
510 Ga0495622_0120403 3300046557 Bacteria 1198
511 Ga0495633_0009286 3300046558 Bacteria 5447
512 Ga0495656_0013418 3300046615 Bacteria 3048
513 Ga0495656_0029010 3300046615 Bacteria 2225
514 Ga0495668_0000195 3300046616 Bacteria 89153
515 Ga0495634_0004292 3300046642 Bacteria 11235
516 Ga0495611_0001350 3300046648 Bacteria 12405
517 Ga0495611_0004182 3300046648 Bacteria 6281
518 Ga0495611_0015137 3300046648 Bacteria 3296
519 Ga0495625_0019950 3300046660 Bacteria 5184
520 Ga0495625_0021737 3300046660 Bacteria 4932
521 Ga0495625_0021888 3300046660 Bacteria 4910
522 Ga0495625_0026076 3300046660 Bacteria 4420
523 Ga0495625_0047322 3300046660 Bacteria 3101
524 Ga0495625_0054775 3300046660 Bacteria 2847
525 Ga0495625_0107220 3300046660 Bacteria 1912
526 Ga0495625_0165934 3300046660 Bacteria 1476
527 Ga0495625_0223795 3300046660 Bacteria 1231
528 Ga0495625_0282297 3300046660 Bacteria 1068
529 Ga0495635_0005820 3300046663 Bacteria 8592
530 Ga0495635_0077281 3300046663 Bacteria 2280
531 Ga0495659_0007277 3300046664 Bacteria 3508
532 Ga0495659_0010426 3300046664 Bacteria 2981
533 Ga0495661_0008122 3300046665 Bacteria 7276
534 Ga0495661_0033879 3300046665 Bacteria 3218
535 Ga0495661_0115392 3300046665 Bacteria 1491
536 Ga0495661_0130687 3300046665 Bacteria 1376
537 Ga0495661_0226676 3300046665 Bacteria 965
538 Ga0495661_0241100 3300046665 Bacteria 927
539 Ga0495588_0046233 3300046674 Bacteria 2232
540 Ga0495588_0051756 3300046674 Bacteria 2115
541 Ga0495588_0057212 3300046674 Bacteria 2014
542 Ga0495588_0064191 3300046674 Bacteria 1905
543 Ga0495588_0258297 3300046674 Bacteria 918
544 Ga0495657_0161249 3300046675 Bacteria 1387
545 Ga0495623_0007410 3300046679 Bacteria 7124
546 Ga0495623_0086609 3300046679 Bacteria 1930
547 Ga0495646_0175756 3300046680 Bacteria 1177
548 Ga0495669_0009322 3300046684 Bacteria 4136
549 Ga0495669_0121681 3300046684 Bacteria 1223
550 Ga0495613_0114061 3300046689 Bacteria 1945
551 Ga0495613_0126856 3300046689 Bacteria 1829
552 Ga0495624_0421371 3300046690 Bacteria 801
553 Ga0495670_0000686 3300046691 Bacteria 16108
554 Ga0495670_0009112 3300046691 Bacteria 4881
555 Ga0495670_0014350 3300046691 Bacteria 3895
556 Ga0495670_0037258 3300046691 Bacteria 2424
557 Ga0495670_0041843 3300046691 Bacteria 2286
558 Ga0495670_0052818 3300046691 Bacteria 2035
559 Ga0495670_0243071 3300046691 Bacteria 958
560 Ga0495670_0261081 3300046691 Bacteria 924
561 Ga0495671_0004282 3300046692 Bacteria 8575
562 Ga0495671_0010981 3300046692 Bacteria 5002
563 Ga0495671_0016070 3300046692 Bacteria 4002
564 Ga0495671_0016364 3300046692 Bacteria 3960
565 Ga0495671_0017017 3300046692 Bacteria 3872
566 Ga0495671_0021151 3300046692 Bacteria 3420
567 Ga0495671_0025622 3300046692 Bacteria 3062
568 Ga0495671_0027539 3300046692 Bacteria 2934
569 Ga0495671_0047865 3300046692 Bacteria 2134
570 Ga0495671_0067169 3300046692 Bacteria 1764
571 Ga0495671_0080828 3300046692 Bacteria 1593
572 Ga0495671_0117619 3300046692 Bacteria 1297
573 Ga0495671_0153819 3300046692 Bacteria 1119
574 Ga0495671_0169251 3300046692 Bacteria 1062
575 Ga0495671_0205597 3300046692 Bacteria 954
576 Ga0495671_0219822 3300046692 Bacteria 919
577 Ga0495671_0245003 3300046692 Bacteria 865
578 Ga0495649_0000362 3300046694 Bacteria 39295
579 Ga0495649_0000791 3300046694 Bacteria 25472
580 Ga0495649_0000863 3300046694 Bacteria 24377
581 Ga0495649_0004735 3300046694 Bacteria 8825
582 Ga0495649_0009474 3300046694 Bacteria 5786
583 Ga0495649_0015710 3300046694 Bacteria 4304
584 Ga0495649_0028664 3300046694 Bacteria 3085
585 Ga0495649_0034874 3300046694 Bacteria 2768
586 Ga0495649_0040778 3300046694 Bacteria 2540
587 Ga0495649_0052565 3300046694 Bacteria 2207
588 Ga0495649_0088253 3300046694 Bacteria 1654
589 Ga0495649_0144841 3300046694 Bacteria 1249
590 Ga0495649_0157928 3300046694 Bacteria 1189
591 Ga0495649_0206581 3300046694 Bacteria 1018
592 Ga0495649_0280801 3300046694 Bacteria 851
593 Ga0495589_0000971 3300046794 Bacteria 17509
594 Ga0495589_0011311 3300046794 Bacteria 4631
595 Ga0495589_0012629 3300046794 Bacteria 4369
596 Ga0495589_0019829 3300046794 Bacteria 3440
597 Ga0495589_0023321 3300046794 Bacteria 3154
598 Ga0495589_0085384 3300046794 Bacteria 1534
599 Ga0495589_0102954 3300046794 Bacteria 1380
600 Ga0495589_0115874 3300046794 Bacteria 1291
601 Ga0495589_0122540 3300046794 Bacteria 1251
602 Ga0495589_0131950 3300046794 Bacteria 1199
603 Ga0495589_0154313 3300046794 Bacteria 1095
604 Ga0495660_0005512 3300046810 Bacteria 7584
605 Ga0495660_0008773 3300046810 Bacteria 5903
606 Ga0495660_0037217 3300046810 Bacteria 2711
607 Ga0495660_0052505 3300046810 Bacteria 2214
608 Ga0495660_0107169 3300046810 Bacteria 1430
609 Ga0495660_0155587 3300046810 Bacteria 1125
610 Ga0495660_0161019 3300046810 Bacteria 1100
611 Ga0495660_0172805 3300046810 Bacteria 1051
612 Ga0495660_0177302 3300046810 Bacteria 1033
613 Ga0495660_0185727 3300046810 Bacteria 1002
614 Ga0495660_0189342 3300046810 Bacteria 989
615 Ga0495660_0217860 3300046810 Bacteria 901
616 Ga0495660_0242925 3300046810 Bacteria 838
617 Ga0495581_0028264 3300047315 Bacteria 3251
618 Ga0495581_0077264 3300047315 Bacteria 1926
619 Ga0495604_0030547 3300047317 Bacteria 4278
620 Ga0495604_0247182 3300047317 Bacteria 1217
621 Ga0495636_0059909 3300047318 Bacteria 1607
622 Ga0495674_0032971 3300047319 Bacteria 4695
623 Ga0495672_0000643 3300047320 Bacteria 38804
624 Ga0495672_0004715 3300047320 Bacteria 11028
625 Ga0495672_0005579 3300047320 Bacteria 9945
626 Ga0495672_0006948 3300047320 Bacteria 8613
627 Ga0495672_0024737 3300047320 Bacteria 3863
628 Ga0495672_0029445 3300047320 Bacteria 3458
629 Ga0495672_0043701 3300047320 Bacteria 2692
630 Ga0495672_0058428 3300047320 Bacteria 2235
631 Ga0495672_0059602 3300047320 Bacteria 2208
632 Ga0495672_0081514 3300047320 Bacteria 1801
633 Ga0495672_0160049 3300047320 Bacteria 1158
634 Ga0495672_0160064 3300047320 Bacteria 1158
635 Ga0495676_0032623 3300047321 Bacteria 4393
636 Ga0495676_0046217 3300047321 Bacteria 3535
637 Ga0495680_0014684 3300047322 Bacteria 6774
638 Ga0495680_0053148 3300047322 Bacteria 3155
639 Ga0495680_0122266 3300047322 Bacteria 1920
640 Ga0495683_0000059 3300047323 Bacteria 116530
641 Ga0495683_0004238 3300047323 Bacteria 8190
642 Ga0495683_0006877 3300047323 Bacteria 6182
643 Ga0495683_0025044 3300047323 Bacteria 3059
644 Ga0495683_0026532 3300047323 Bacteria 2964
645 Ga0495683_0044768 3300047323 Bacteria 2225
646 Ga0495683_0134288 3300047323 Bacteria 1164
647 Ga0495683_0156820 3300047323 Bacteria 1055
648 Ga0495683_0224293 3300047323 Bacteria 836
649 Ga0495687_001577 3300047443 Bacteria 20677
650 Ga0495687_004882 3300047443 Bacteria 8795
651 Ga0495687_011984 3300047443 Bacteria 4619
652 Ga0495687_089043 3300047443 Bacteria 1187
653 Ga0495675_0030531 3300047444 Bacteria 3438
654 Ga0495675_0069529 3300047444 Bacteria 2223
655 Ga0495675_0355014 3300047444 Bacteria 861
656 Ga0495677_0013934 3300047445 Bacteria 2926
657 Ga0495677_0014247 3300047445 Bacteria 2896
658 Ga0495679_005477 3300047446 Bacteria 5622
659 Ga0495679_007095 3300047446 Bacteria 4725
660 Ga0495679_007390 3300047446 Bacteria 4582
661 Ga0495679_014703 3300047446 Bacteria 2889
662 Ga0495679_040239 3300047446 Bacteria 1454
663 Ga0495685_040134 3300047447 Bacteria 1601
664 Ga0495673_0004837 3300047469 Bacteria 8326
665 Ga0495673_0010953 3300047469 Bacteria 4905
666 Ga0495673_0012607 3300047469 Bacteria 4472
667 Ga0495673_0012910 3300047469 Bacteria 4405
668 Ga0495673_0016156 3300047469 Bacteria 3824
669 Ga0495673_0025403 3300047469 Bacteria 2845
670 Ga0495673_0026404 3300047469 Bacteria 2777
671 Ga0495673_0027144 3300047469 Bacteria 2728
672 Ga0495673_0031324 3300047469 Bacteria 2490
673 Ga0495673_0040956 3300047469 Bacteria 2088
674 Ga0495673_0042318 3300047469 Bacteria 2045
675 Ga0495673_0076074 3300047469 Bacteria 1400
676 Ga0495673_0107347 3300047469 Bacteria 1120
677 Ga0495673_0128975 3300047469 Bacteria 995
678 Ga0495681_0000622 3300047470 Bacteria 26985
679 Ga0495681_0001658 3300047470 Bacteria 16506
680 Ga0495681_0003351 3300047470 Bacteria 11149
681 Ga0495681_0013637 3300047470 Bacteria 4704
682 Ga0495681_0014558 3300047470 Bacteria 4498
683 Ga0495681_0014807 3300047470 Bacteria 4450
684 Ga0495681_0014875 3300047470 Bacteria 4436
685 Ga0495681_0022139 3300047470 Bacteria 3408
686 Ga0495681_0024532 3300047470 Bacteria 3175
687 Ga0495681_0041802 3300047470 Bacteria 2223
688 Ga0495681_0044169 3300047470 Bacteria 2144
689 Ga0495681_0072022 3300047470 Bacteria 1563
690 Ga0495681_0113620 3300047470 Bacteria 1169
691 Ga0495681_0129105 3300047470 Bacteria 1077
692 Ga0495681_0151057 3300047470 Bacteria 974
693 Ga0495681_0161373 3300047470 Bacteria 933
694 Ga0495684_0183410 3300047471 Bacteria 1550
695 Ga0495686_0002054 3300047472 Bacteria 19818
696 Ga0495686_0020607 3300047472 Bacteria 4394
697 Ga0495686_0040950 3300047472 Bacteria 2951
698 Ga0495686_0115217 3300047472 Bacteria 1607
699 Ga0495593_0030725 3300047673 Bacteria 2938
700 Ga0495593_0072051 3300047673 Bacteria 1794
701 Ga0495593_0156728 3300047673 Bacteria 1150
702 Ga0495602_0296126 3300048088 Bacteria 1186
703 Ga0495626_0001185 3300048091 Bacteria 21635
704 Ga0495626_0004511 3300048091 Bacteria 8522
705 Ga0495626_0005023 3300048091 Bacteria 7899
706 Ga0495626_0006732 3300048091 Bacteria 6504
707 Ga0495626_0015648 3300048091 Bacteria 3877
708 Ga0495626_0023103 3300048091 Bacteria 3065
709 Ga0495626_0028025 3300048091 Bacteria 2733
710 Ga0495626_0032043 3300048091 Bacteria 2526
711 Ga0495626_0035698 3300048091 Bacteria 2371
712 Ga0495626_0118956 3300048091 Bacteria 1137
713 Ga0495626_0145687 3300048091 Bacteria 1001
714 Ga0495626_0158951 3300048091 Bacteria 948
715 Ga0495626_0162779 3300048091 Bacteria 934
716 Ga0495626_0169337 3300048091 Bacteria 911
717 Ga0496102_0008223 3300048905 Bacteria 8930
718 Ga0496102_0501401 3300048905 Bacteria 1136
719 Ga0496103_0004516 3300048906 Bacteria 8433
720 Ga0496105_0071156 3300048908 Bacteria 2875
721 Ga0496106_0065512 3300048909 Bacteria 2766
722 Ga0496106_0300873 3300048909 Bacteria 1286
723 Ga0496107_0064701 3300048910 Bacteria 2651
724 Ga0496110_0038310 3300048913 Bacteria 4171
725 Ga0496114_0773212 3300048917 Bacteria 838
726 Ga0496115_0058739 3300048918 Bacteria 3096
727 Ga0496116_0000185 3300048919 Bacteria 123912
728 Ga0496116_0001926 3300048919 Bacteria 22375
729 Ga0496117_0028050 3300048920 Bacteria 4364
730 Ga0496117_0038629 3300048920 Bacteria 3535
731 Ga0496117_0131694 3300048920 Bacteria 1514
732 Ga0496118_0015212 3300048921 Bacteria 7144
733 Ga0496118_0031531 3300048921 Bacteria 4391
734 Ga0496118_0192862 3300048921 Bacteria 1216
735 Ga0496118_0286299 3300048921 Bacteria 914
736 Ga0496121_0012336 3300048924 Bacteria 9344
737 Ga0496121_0064935 3300048924 Bacteria 2973
738 Ga0496121_0161060 3300048924 Bacteria 1640
739 Ga0496121_0221769 3300048924 Bacteria 1331
740 Ga0496122_0014645 3300048925 Bacteria 7566
741 Ga0496122_0031501 3300048925 Bacteria 4411
742 Ga0496123_0001153 3300048926 Bacteria 39367
743 Ga0496123_0028448 3300048926 Bacteria 4137
744 Ga0496123_0043667 3300048926 Bacteria 3075
745 Ga0496124_0001273 3300048927 Bacteria 38340
746 Ga0496124_0038917 3300048927 Bacteria 4125
747 Ga0496124_0443810 3300048927 Bacteria 887
748 Ga0496124_0507218 3300048927 Bacteria 807
749 Ga0496125_0041347 3300048928 Bacteria 3942
750 Ga0496125_0354368 3300048928 Bacteria 875
751 Ga0496126_0050497 3300048929 Bacteria 3789
752 Ga0495678_001039 3300049459 Bacteria 23532
753 Ga0495678_008494 3300049459 Bacteria 5172
754 Ga0495678_013518 3300049459 Bacteria 3830
755 Ga0495678_016301 3300049459 Bacteria 3400
756 Ga0495678_018634 3300049459 Bacteria 3116
757 Ga0495678_021670 3300049459 Bacteria 2825
758 Ga0495678_025790 3300049459 Bacteria 2519
759 Ga0495678_055082 3300049459 Bacteria 1519
760 Ga0495678_079818 3300049459 Bacteria 1177
761 Ga0495678_094446 3300049459 Bacteria 1046
762 Ga0495678_101866 3300049459 Bacteria 993
763 Ga0495682_0005294 3300049460 Bacteria 5382
764 Ga0495682_0018954 3300049460 Bacteria 2590
765 Ga0495682_0029747 3300049460 Bacteria 2023
766 Ga0495682_0040576 3300049460 Bacteria 1706
767 Ga0495682_0063736 3300049460 Bacteria 1329
768 Ga0495682_0071410 3300049460 Bacteria 1249
769 Ga0495682_0117754 3300049460 Bacteria 951
770 Ga0501227_015242 3300049665 Bacteria 1716
771 Ga0501241_008395 3300049758 Bacteria 1888
772 Ga0501269_005693 3300049766 Bacteria 1498
773 Ga0501226_006650 3300049853 Bacteria 1308
774 nmdc:mga03683_19680_c1 3300050489 Bacteria 2580
775 nmdc:mga00v17_241278_c1 3300050491 Bacteria 1172
776 nmdc:mga00v17_242512_c1 3300050491 Bacteria 1169
777 nmdc:mga00v17_353056_c1 3300050491 Bacteria 956
778 nmdc:mga08x19_505211_c1 3300050514 Bacteria 854
779 Ga0500618_000733 3300053125 Bacteria 18747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0093029 Ga0495590_0093029_15_635 198
2 3300046520 Ga0495637_0092046 Ga0495637_0092046_29_700 215
3 3300046522 Ga0495643_0027149 Ga0495643_0027149_11_661 215
4 3300046530 Ga0495654_0117869 Ga0495654_0117869_507_1178 215
5 3300046691 Ga0495670_0052818 Ga0495670_0052818_25_675 215
6 3300015261 Ga0182006_1066182 Ga0182006_10661822 216
7 3300027907 Ga0207428_10029541 Ga0207428_100295412 216
8 3300041411 Ga0439466_0064488 Ga0439466_0064488_45_743 216
9 3300050514 nmdc:mga08x19_505211_c1 nmdc:mga08x19_505211_c1_117_815 216
10 3300046471 Ga0495650_0187039 Ga0495650_0187039_55_711 217
11 3300046458 Ga0495591_023591 Ga0495591_023591_1262_1921 218
12 3300046518 Ga0495631_0197036 Ga0495631_0197036_194_850 218
13 3300046519 Ga0495632_0263995 Ga0495632_0263995_43_702 218
14 3300046523 Ga0495644_0006158 Ga0495644_0006158_3969_4628 218
15 3300046531 Ga0495665_0339435 Ga0495665_0339435_80_736 218
16 3300046665 Ga0495661_0226676 Ga0495661_0226676_253_912 218
17 3300046665 Ga0495661_0241100 Ga0495661_0241100_12_668 218
18 3300047443 Ga0495687_089043 Ga0495687_089043_514_1170 218
19 3300047469 Ga0495673_0012607 Ga0495673_0012607_3805_4461 218
20 3300047469 Ga0495673_0026404 Ga0495673_0026404_22_678 218
21 3300046491 Ga0495584_0102352 Ga0495584_0102352_30_704 223
22 3300046500 Ga0495596_0229227 Ga0495596_0229227_17_691 223
23 3300046512 Ga0495610_0130694 Ga0495610_0130694_27_701 223
24 3300046522 Ga0495643_0218675 Ga0495643_0218675_212_886 223
25 3300046524 Ga0495648_0204298 Ga0495648_0204298_13_687 223
26 3300046692 Ga0495671_0067169 Ga0495671_0067169_1071_1745 223
27 3300046694 Ga0495649_0206581 Ga0495649_0206581_53_727 223
28 3300046542 Ga0495597_0127668 Ga0495597_0127668_10_717 227
29 3300046474 Ga0495605_0080804 Ga0495605_0080804_27_731 228
30 iso_pu_bacteria 2913036834 2913038701 229
31 3300047320 Ga0495672_0004715 Ga0495672_0004715_242_943 230
32 3300042115 Ga0450911_003968 Ga0450911_003968_16_726 236
33 3300046452 Ga0495617_056988 Ga0495617_056988_220_933 237
34 3300046492 Ga0495585_0030286 Ga0495585_0030286_226_939 237
35 3300046491 Ga0495584_0029935 Ga0495584_0029935_15_737 240
36 3300046616 Ga0495668_0000195 Ga0495668_0000195_13_738 240
37 iso_pu_bacteria 2808606382 2808957876 240
38 iso_pu_bacteria 3007511990 3007513249 240
39 3300046452 Ga0495617_066423 Ga0495617_066423_168_896 241
40 3300046501 Ga0495607_0161842 Ga0495607_0161842_116_844 241
41 3300046524 Ga0495648_0002458 Ga0495648_0002458_3196_3921 241
42 3300046690 Ga0495624_0421371 Ga0495624_0421371_62_790 241
43 3300046810 Ga0495660_0242925 Ga0495660_0242925_80_808 241
44 3300048918 Ga0496115_0058739 Ga0496115_0058739_14_739 241
45 iso_pu_bacteria 2511231016 2511324661 241
46 iso_pu_bacteria 2511231018 2511338165 241
47 iso_pu_bacteria 2511231019 2511342952 241
48 iso_pu_bacteria 2511231004 2511257338 242
49 iso_pu_bacteria 2511231007 2511269283 242
50 iso_pu_bacteria 2511231022 2511365397 242
51 iso_pu_bacteria 2623620446 2624493318 242
52 iso_pu_bacteria 2919697872 2919699407 242
53 iso_pu_bacteria 3007419365 3007421419 242
54 iso_pu_bacteria 8019775933 8019776322 242
55 iso_pu_bacteria 8056155041 8056156538 242
56 iso_pu_bacteria 8056177738 8056183677 242
57 3300042016 Ga0439463_063383 Ga0439463_063383_16_750 243
58 3300046522 Ga0495643_0083934 Ga0495643_0083934_139_873 243
59 iso_pu_bacteria 2599185160 2599357257 243
60 iso_pu_bacteria 2599185161 2599361932 243
61 iso_pu_bacteria 2599185162 2599368252 243
62 iso_pu_bacteria 2599185163 2599375041 243
63 iso_pu_bacteria 2599185164 2599382362 243
64 iso_pu_bacteria 2599185165 2599388809 243
65 iso_pu_bacteria 2599185166 2599393899 243
66 iso_pu_bacteria 2599185168 2599405664 243
67 iso_pu_bacteria 2599185181 2599464242 243
68 iso_pu_bacteria 2599185182 2599468538 243
69 iso_pu_bacteria 2599185186 2599493261 243
70 iso_pu_bacteria 2599185356 2600216517 243
71 iso_pu_bacteria 2600255313 2601776890 243
72 iso_pu_bacteria 2667528171 2671098570 243
73 iso_pu_bacteria 2818991464 2819703649 243
74 iso_pu_bacteria 2844665904 2844669388 243
75 iso_pu_bacteria 2917070673 2917072669 243
76 iso_pu_bacteria 2935353572 2935354832 243
77 iso_pu_bacteria 637000220 637319242 243
78 3300005288 Ga0065714_10021189 Ga0065714_100211891 244
79 3300013102 Ga0157371_10031272 Ga0157371_100312723 244
80 3300013104 Ga0157370_10060364 Ga0157370_100603641 244
81 3300014497 Ga0182008_10046943 Ga0182008_100469432 244
82 3300014497 Ga0182008_10130501 Ga0182008_101305012 244
83 3300015261 Ga0182006_1016814 Ga0182006_10168143 244
84 3300015262 Ga0182007_10023368 Ga0182007_100233682 244
85 3300042016 Ga0439463_060131 Ga0439463_060131_191_949 244
86 3300042129 Ga0450891_006460 Ga0450891_006460_220_972 244
87 3300046474 Ga0495605_0018909 Ga0495605_0018909_185_919 244
88 3300046507 Ga0495606_0005734 Ga0495606_0005734_10755_11492 244
89 3300046519 Ga0495632_0166867 Ga0495632_0166867_87_824 244
90 3300049460 Ga0495682_0040576 Ga0495682_0040576_517_1254 244
91 3300049758 Ga0501241_008395 Ga0501241_008395_194_931 244
92 iso_pu_bacteria 2511231008 2511280993 244
93 iso_pu_bacteria 2511231010 2511288373 244
94 iso_pu_bacteria 2511231023 2511372632 244
95 iso_pu_bacteria 2511231031 2511415563 244
96 iso_pu_bacteria 2599185212 2599611478 244
97 iso_pu_bacteria 2599185248 2599770411 244
98 iso_pu_bacteria 2599185289 2599889576 244
99 iso_pu_bacteria 2599185291 2599901104 244
100 iso_pu_bacteria 2599185302 2599941682 244
101 iso_pu_bacteria 2599185304 2599952798 244
102 iso_pu_bacteria 2599185305 2599963164 244
103 iso_pu_bacteria 2599185306 2599969070 244
104 iso_pu_bacteria 2599185308 2599980335 244
105 iso_pu_bacteria 2599185309 2599981851 244
106 iso_pu_bacteria 2599185310 2599987760 244
107 iso_pu_bacteria 2599185311 2599995251 244
108 iso_pu_bacteria 2599185312 2599998348 244
109 iso_pu_bacteria 2599185313 2600005540 244
110 iso_pu_bacteria 2599185314 2600014146 244
111 iso_pu_bacteria 2599185315 2600019991 244
112 iso_pu_bacteria 2599185316 2600022466 244
113 iso_pu_bacteria 2599185317 2600027486 244
114 iso_pu_bacteria 2599185318 2600034258 244
115 iso_pu_bacteria 2599185319 2600039766 244
116 iso_pu_bacteria 2599185320 2600046090 244
117 iso_pu_bacteria 2599185321 2600054584 244
118 iso_pu_bacteria 2599185322 2600057426 244
119 iso_pu_bacteria 2599185323 2600064604 244
120 iso_pu_bacteria 2599185324 2600072235 244
121 iso_pu_bacteria 2599185325 2600075741 244
122 iso_pu_bacteria 2600254930 2600356805 244
123 iso_pu_bacteria 2600255318 2601795723 244
124 iso_pu_bacteria 2603880185 2606075430 244
125 iso_pu_bacteria 2603880199 2606128293 244
126 iso_pu_bacteria 2643221565 2643846266 244
127 iso_pu_bacteria 2643221650 2644286824 244
128 iso_pu_bacteria 2667528170 2671093750 244
129 iso_pu_bacteria 2667528176 2671126146 244
130 iso_pu_bacteria 2675903515 2678262725 244
131 iso_pu_bacteria 2713897148 2715753296 244
132 iso_pu_bacteria 2713897149 2715757930 244
133 iso_pu_bacteria 2744054620 2745009064 244
134 iso_pu_bacteria 2825651385 2825652911 244
135 iso_pu_bacteria 2842832357 2842832464 244
136 iso_pu_bacteria 2878029506 2878031669 244
137 iso_pu_bacteria 2919063839 2919063863 244
138 iso_pu_bacteria 2919385768 2919386643 244
139 iso_pu_bacteria 2919456309 2919456869 244
140 iso_pu_bacteria 2919487758 2919493064 244
141 iso_pu_bacteria 2923586266 2923587156 244
142 iso_pu_bacteria 2929144301 2929146154 244
143 iso_pu_bacteria 2931369376 2931370478 244
144 iso_pu_bacteria 2969304461 2969306459 244
145 iso_pu_bacteria 2974289157 2974291844 244
146 iso_pu_bacteria 2998139840 2998141856 244
147 iso_pu_bacteria 3007855910 3007857780 244
148 iso_pu_bacteria 8029995093 8029998845 244
149 iso_pu_bacteria 8056166840 8056169141 244
150 iso_pu_bacteria 8056172158 8056175291 244
151 3300006058 Ga0075432_10024015 Ga0075432_100240152 245
152 3300014497 Ga0182008_10015443 Ga0182008_100154433 245
153 3300030521 Ga0307511_10193615 Ga0307511_101936151 245
154 3300041405 Ga0439438_010722 Ga0439438_010722_1951_2700 245
155 3300042006 Ga0439432_012174 Ga0439432_012174_2023_2772 245
156 3300042016 Ga0439463_005528 Ga0439463_005528_427_1182 245
157 3300042145 Ga0450906_018396 Ga0450906_018396_477_1226 245
158 3300046453 Ga0495627_011548 Ga0495627_011548_191_928 245
159 3300046460 Ga0495638_0008919 Ga0495638_0008919_6140_6877 245
160 3300046460 Ga0495638_0015802 Ga0495638_0015802_4090_4827 245
161 3300046474 Ga0495605_0021181 Ga0495605_0021181_2326_3066 245
162 3300046491 Ga0495584_0016254 Ga0495584_0016254_198_941 245
163 3300046491 Ga0495584_0019585 Ga0495584_0019585_2523_3260 245
164 3300046491 Ga0495584_0024493 Ga0495584_0024493_198_938 245
165 3300046492 Ga0495585_0007669 Ga0495585_0007669_5367_6104 245
166 3300046501 Ga0495607_0005920 Ga0495607_0005920_7738_8484 245
167 3300046512 Ga0495610_0158882 Ga0495610_0158882_19_756 245
168 3300046518 Ga0495631_0076746 Ga0495631_0076746_506_1246 245
169 3300046519 Ga0495632_0002085 Ga0495632_0002085_7865_8608 245
170 3300046520 Ga0495637_0012922 Ga0495637_0012922_497_1237 245
171 3300046520 Ga0495637_0018505 Ga0495637_0018505_174_917 245
172 3300046520 Ga0495637_0097528 Ga0495637_0097528_236_973 245
173 3300046524 Ga0495648_0048674 Ga0495648_0048674_1787_2527 245
174 3300046530 Ga0495654_0026578 Ga0495654_0026578_138_878 245
175 3300046542 Ga0495597_0015389 Ga0495597_0015389_221_1000 245
176 3300046542 Ga0495597_0021335 Ga0495597_0021335_2136_2876 245
177 3300046660 Ga0495625_0021888 Ga0495625_0021888_185_922 245
178 3300046660 Ga0495625_0107220 Ga0495625_0107220_122_862 245
179 3300046660 Ga0495625_0165934 Ga0495625_0165934_578_1318 245
180 3300046664 Ga0495659_0010426 Ga0495659_0010426_2114_2860 245
181 3300046691 Ga0495670_0000686 Ga0495670_0000686_516_1262 245
182 3300046692 Ga0495671_0004282 Ga0495671_0004282_192_932 245
183 3300046692 Ga0495671_0010981 Ga0495671_0010981_4077_4856 245
184 3300046694 Ga0495649_0004735 Ga0495649_0004735_7880_8623 245
185 3300046810 Ga0495660_0052505 Ga0495660_0052505_1261_1998 245
186 3300047323 Ga0495683_0025044 Ga0495683_0025044_2129_2869 245
187 3300047443 Ga0495687_004882 Ga0495687_004882_7851_8594 245
188 3300047445 Ga0495677_0014247 Ga0495677_0014247_1952_2698 245
189 3300047469 Ga0495673_0025403 Ga0495673_0025403_1949_2689 245
190 3300047470 Ga0495681_0001658 Ga0495681_0001658_266_1045 245
191 3300047470 Ga0495681_0129105 Ga0495681_0129105_174_911 245
192 3300047470 Ga0495681_0151057 Ga0495681_0151057_89_826 245
193 3300048091 Ga0495626_0015648 Ga0495626_0015648_2935_3678 245
194 3300048091 Ga0495626_0023103 Ga0495626_0023103_2124_2864 245
195 3300049459 Ga0495678_013518 Ga0495678_013518_2886_3629 245
196 3300049459 Ga0495678_016301 Ga0495678_016301_459_1199 245
197 3300049459 Ga0495678_101866 Ga0495678_101866_19_798 245
198 iso_pu_bacteria 2511231006 2511263839 245
199 iso_pu_bacteria 2511231012 2511299944 245
200 iso_pu_bacteria 2511231014 2511313512 245
201 iso_pu_bacteria 2511231015 2511318895 245
202 iso_pu_bacteria 2511231017 2511331761 245
203 iso_pu_bacteria 2511231020 2511350559 245
204 iso_pu_bacteria 2511231021 2511355824 245
205 iso_pu_bacteria 2512047018 2512326949 245
206 iso_pu_bacteria 2582580891 2583791267 245
207 iso_pu_bacteria 2597489887 2597857088 245
208 iso_pu_bacteria 2599185185 2599484110 245
209 iso_pu_bacteria 2599185188 2599504586 245
210 iso_pu_bacteria 2599185257 2599801761 245
211 iso_pu_bacteria 2599185300 2599934248 245
212 iso_pu_bacteria 2600254931 2600365553 245
213 iso_pu_bacteria 2643221589 2643952789 245
214 iso_pu_bacteria 2643221602 2644022551 245
215 iso_pu_bacteria 2643221633 2644188763 245
216 iso_pu_bacteria 2651869719 2652543541 245
217 iso_pu_bacteria 2671180172 2671768710 245
218 iso_pu_bacteria 2738543004 2739201096 245
219 iso_pu_bacteria 2738543015 2739262024 245
220 iso_pu_bacteria 2773857670 2774121128 245
221 iso_pu_bacteria 2784132072 2784314202 245
222 iso_pu_bacteria 2791355520 2794596530 245
223 iso_pu_bacteria 2808606361 2808854480 245
224 iso_pu_bacteria 2808606376 2808924460 245
225 iso_pu_bacteria 2808606378 2808934560 245
226 iso_pu_bacteria 2808606380 2808946443 245
227 iso_pu_bacteria 2808606383 2808962985 245
228 iso_pu_bacteria 2808606389 2808997598 245
229 iso_pu_bacteria 2808606445 2809216593 245
230 iso_pu_bacteria 2842854478 2842857435 245
231 iso_pu_bacteria 2860339153 2860339783 245
232 iso_pu_bacteria 2904550169 2904552693 245
233 iso_pu_bacteria 2919481497 2919481974 245
234 iso_pu_bacteria 2931396565 2931400320 245
235 iso_pu_bacteria 2939636861 2939639519 245
236 iso_pu_bacteria 2984286254 2984290501 245
237 iso_pu_bacteria 2988728565 2988733675 245
238 iso_pu_bacteria 3007866637 3007870153 245
239 iso_pu_bacteria 8015687852 8015689746 245
240 iso_pu_bacteria 8019769354 8019772830 245
241 iso_pu_bacteria 8055770955 8055772885 245
242 iso_pu_bacteria 8056125926 8056127782 245
243 iso_pu_bacteria 8056143049 8056145090 245
244 iso_pu_bacteria 8057798959 8057799310 245
245 3300006058 Ga0075432_10007513 Ga0075432_100075131 246
246 3300009036 Ga0105244_10020180 Ga0105244_100201801 246
247 3300013104 Ga0157370_10686077 Ga0157370_106860771 246
248 3300014497 Ga0182008_10017775 Ga0182008_100177753 246
249 3300015261 Ga0182006_1012726 Ga0182006_10127262 246
250 3300015262 Ga0182007_10010922 Ga0182007_100109223 246
251 3300015265 Ga0182005_1006173 Ga0182005_10061732 246
252 3300015265 Ga0182005_1037378 Ga0182005_10373782 246
253 3300017792 Ga0163161_10045478 Ga0163161_100454782 246
254 3300025728 Ga0207655_1009485 Ga0207655_10094852 246
255 3300041407 Ga0439447_047112 Ga0439447_047112_28_780 246
256 3300042142 Ga0450905_002489 Ga0450905_002489_1477_2280 246
257 3300046452 Ga0495617_001947 Ga0495617_001947_7723_8469 246
258 3300046453 Ga0495627_040790 Ga0495627_040790_170_910 246
259 3300046453 Ga0495627_069333 Ga0495627_069333_253_993 246
260 3300046455 Ga0495603_0079667 Ga0495603_0079667_106_849 246
261 3300046457 Ga0495590_0007580 Ga0495590_0007580_2749_3495 246
262 3300046460 Ga0495638_0177101 Ga0495638_0177101_354_1094 246
263 3300046460 Ga0495638_0200303 Ga0495638_0200303_219_959 246
264 3300046460 Ga0495638_0265853 Ga0495638_0265853_101_844 246
265 3300046471 Ga0495650_0016833 Ga0495650_0016833_196_942 246
266 3300046474 Ga0495605_0008392 Ga0495605_0008392_74_820 246
267 3300046474 Ga0495605_0112549 Ga0495605_0112549_253_993 246
268 3300046474 Ga0495605_0172916 Ga0495605_0172916_35_778 246
269 3300046475 Ga0495639_0002271 Ga0495639_0002271_181_924 246
270 3300046491 Ga0495584_0023165 Ga0495584_0023165_1547_2287 246
271 3300046492 Ga0495585_0030157 Ga0495585_0030157_2239_2979 246
272 3300046492 Ga0495585_0191683 Ga0495585_0191683_142_882 246
273 3300046499 Ga0495594_0020293 Ga0495594_0020293_2726_3469 246
274 3300046501 Ga0495607_0001116 Ga0495607_0001116_15889_16635 246
275 3300046501 Ga0495607_0059623 Ga0495607_0059623_218_958 246
276 3300046506 Ga0495583_0077862 Ga0495583_0077862_634_1377 246
277 3300046506 Ga0495583_0145072 Ga0495583_0145072_125_871 246
278 3300046507 Ga0495606_0054879 Ga0495606_0054879_153_893 246
279 3300046507 Ga0495606_0141627 Ga0495606_0141627_376_1116 246
280 3300046512 Ga0495610_0049832 Ga0495610_0049832_160_900 246
281 3300046512 Ga0495610_0077926 Ga0495610_0077926_310_1050 246
282 3300046513 Ga0495616_0019823 Ga0495616_0019823_197_943 246
283 3300046515 Ga0495620_0000551 Ga0495620_0000551_14624_15364 246
284 3300046519 Ga0495632_0003243 Ga0495632_0003243_2634_3374 246
285 3300046519 Ga0495632_0142616 Ga0495632_0142616_127_867 246
286 3300046520 Ga0495637_0007830 Ga0495637_0007830_4377_5117 246
287 3300046520 Ga0495637_0083543 Ga0495637_0083543_283_1023 246
288 3300046522 Ga0495643_0013197 Ga0495643_0013197_3045_3791 246
289 3300046522 Ga0495643_0138960 Ga0495643_0138960_334_1074 246
290 3300046523 Ga0495644_0040700 Ga0495644_0040700_801_1541 246
291 3300046524 Ga0495648_0023930 Ga0495648_0023930_213_953 246
292 3300046524 Ga0495648_0042816 Ga0495648_0042816_156_902 246
293 3300046524 Ga0495648_0052022 Ga0495648_0052022_128_868 246
294 3300046526 Ga0495666_0018108 Ga0495666_0018108_2724_3467 246
295 3300046528 Ga0495642_0001961 Ga0495642_0001961_7708_8454 246
296 3300046530 Ga0495654_0004364 Ga0495654_0004364_189_932 246
297 3300046530 Ga0495654_0018555 Ga0495654_0018555_320_1060 246
298 3300046530 Ga0495654_0062475 Ga0495654_0062475_186_932 246
299 3300046542 Ga0495597_0020438 Ga0495597_0020438_2228_2968 246
300 3300046542 Ga0495597_0034793 Ga0495597_0034793_131_877 246
301 3300046542 Ga0495597_0072666 Ga0495597_0072666_242_982 246
302 3300046557 Ga0495622_0120403 Ga0495622_0120403_265_1008 246
303 3300046642 Ga0495634_0004292 Ga0495634_0004292_7637_8377 246
304 3300046648 Ga0495611_0004182 Ga0495611_0004182_125_871 246
305 3300046664 Ga0495659_0007277 Ga0495659_0007277_2313_3056 246
306 3300046665 Ga0495661_0008122 Ga0495661_0008122_5615_6355 246
307 3300046691 Ga0495670_0037258 Ga0495670_0037258_1516_2256 246
308 3300046694 Ga0495649_0000362 Ga0495649_0000362_176_934 246
309 3300046694 Ga0495649_0028664 Ga0495649_0028664_191_934 246
310 3300046694 Ga0495649_0144841 Ga0495649_0144841_419_1159 246
311 3300046794 Ga0495589_0000971 Ga0495589_0000971_7725_8471 246
312 3300046794 Ga0495589_0023321 Ga0495589_0023321_2229_2972 246
313 3300046794 Ga0495589_0131950 Ga0495589_0131950_253_993 246
314 3300046810 Ga0495660_0155587 Ga0495660_0155587_232_972 246
315 3300046810 Ga0495660_0172805 Ga0495660_0172805_157_909 246
316 3300047315 Ga0495581_0028264 Ga0495581_0028264_2346_3089 246
317 3300047318 Ga0495636_0059909 Ga0495636_0059909_183_929 246
318 3300047320 Ga0495672_0006948 Ga0495672_0006948_7755_8501 246
319 3300047320 Ga0495672_0024737 Ga0495672_0024737_2996_3736 246
320 3300047320 Ga0495672_0059602 Ga0495672_0059602_1276_2019 246
321 3300047321 Ga0495676_0046217 Ga0495676_0046217_2100_2858 246
322 3300047323 Ga0495683_0000059 Ga0495683_0000059_42043_42801 246
323 3300047323 Ga0495683_0026532 Ga0495683_0026532_70_813 246
324 3300047443 Ga0495687_001577 Ga0495687_001577_18661_19401 246
325 3300047446 Ga0495679_005477 Ga0495679_005477_4735_5475 246
326 3300047446 Ga0495679_014703 Ga0495679_014703_141_881 246
327 3300047447 Ga0495685_040134 Ga0495685_040134_707_1453 246
328 3300047469 Ga0495673_0010953 Ga0495673_0010953_191_937 246
329 3300047470 Ga0495681_0041802 Ga0495681_0041802_140_880 246
330 3300047472 Ga0495686_0002054 Ga0495686_0002054_18974_19714 246
331 3300047673 Ga0495593_0156728 Ga0495593_0156728_233_976 246
332 3300048091 Ga0495626_0004511 Ga0495626_0004511_7598_8341 246
333 3300048091 Ga0495626_0005023 Ga0495626_0005023_5278_6018 246
334 3300048908 Ga0496105_0071156 Ga0496105_0071156_1893_2636 246
335 3300048909 Ga0496106_0300873 Ga0496106_0300873_362_1105 246
336 3300048910 Ga0496107_0064701 Ga0496107_0064701_160_903 246
337 3300048920 Ga0496117_0028050 Ga0496117_0028050_3552_4295 246
338 3300048920 Ga0496117_0131694 Ga0496117_0131694_561_1304 246
339 3300048921 Ga0496118_0031531 Ga0496118_0031531_3534_4277 246
340 3300048924 Ga0496121_0161060 Ga0496121_0161060_189_932 246
341 3300048925 Ga0496122_0014645 Ga0496122_0014645_173_916 246
342 3300048925 Ga0496122_0031501 Ga0496122_0031501_3553_4296 246
343 3300048926 Ga0496123_0028448 Ga0496123_0028448_3315_4058 246
344 3300048926 Ga0496123_0043667 Ga0496123_0043667_147_890 246
345 3300048927 Ga0496124_0443810 Ga0496124_0443810_74_817 246
346 3300048927 Ga0496124_0507218 Ga0496124_0507218_40_783 246
347 3300049459 Ga0495678_021670 Ga0495678_021670_246_986 246
348 3300049460 Ga0495682_0063736 Ga0495682_0063736_434_1177 246
349 3300049460 Ga0495682_0117754 Ga0495682_0117754_18_761 246
350 3300053125 Ga0500618_000733 Ga0500618_000733_11369_12127 246
351 3300002771 JGI25163J39215_1000402 JGI25163J39215_10004021 247
352 3300002772 JGI25164J39214_1000651 JGI25164J39214_100065112 247
353 3300003214 JGI25165J46597_1000152 JGI25165J46597_10001521 247
354 3300013102 Ga0157371_10006833 Ga0157371_100068331 247
355 3300014497 Ga0182008_10003572 Ga0182008_100035721 247
356 3300025207 Ga0209760_100329 Ga0209760_10032912 247
357 3300025231 Ga0207427_100001 Ga0207427_1000011162 247
358 3300025233 Ga0209437_100003 Ga0209437_100003210 247
359 3300025261 Ga0209233_1000007 Ga0209233_10000071162 247
360 3300025935 Ga0207709_10000516 Ga0207709_1000051617 247
361 3300046501 Ga0495607_0138634 Ga0495607_0138634_139_891 247
362 3300046519 Ga0495632_0020410 Ga0495632_0020410_502_1254 247
363 3300046520 Ga0495637_0000647 Ga0495637_0000647_23505_24257 247
364 3300046520 Ga0495637_0027011 Ga0495637_0027011_138_890 247
365 3300046694 Ga0495649_0000863 Ga0495649_0000863_23522_24274 247
366 3300046694 Ga0495649_0052565 Ga0495649_0052565_1296_2048 247
367 3300046794 Ga0495589_0122540 Ga0495589_0122540_141_893 247
368 3300046810 Ga0495660_0107169 Ga0495660_0107169_176_922 247
369 3300047469 Ga0495673_0004837 Ga0495673_0004837_7133_7879 247
370 3300048919 Ga0496116_0000185 Ga0496116_0000185_205_975 247
371 3300048924 Ga0496121_0012336 Ga0496121_0012336_185_955 247
372 3300048926 Ga0496123_0001153 Ga0496123_0001153_157_927 247
373 2162886007 SwRhRL2b_contig_3738944 SwRhRL2b_0468.00007430 248
374 3300003781 Ga0055536_1003264 Ga0055536_10032641 248
375 3300003781 Ga0055536_1003804 Ga0055536_10038041 248
376 3300003791 Ga0055530_10000107 Ga0055530_100001071 248
377 3300003791 Ga0055530_10006058 Ga0055530_100060584 248
378 3300003792 Ga0055540_1000140 Ga0055540_10001401 248
379 3300003792 Ga0055540_1000323 Ga0055540_10003231 248
380 3300003794 Ga0055531_10000268 Ga0055531_1000026818 248
381 3300005288 Ga0065714_10003425 Ga0065714_100034254 248
382 3300005288 Ga0065714_10086723 Ga0065714_100867233 248
383 3300005289 Ga0065704_10001803 Ga0065704_100018035 248
384 3300005548 Ga0070665_100287467 Ga0070665_1002874672 248
385 3300006051 Ga0075364_10221082 Ga0075364_102210821 248
386 3300006051 Ga0075364_10345553 Ga0075364_103455532 248
387 3300006058 Ga0075432_10015300 Ga0075432_100153005 248
388 3300006946 Ga0079104_1030844 Ga0079104_10308442 248
389 3300009011 Ga0105251_10023283 Ga0105251_100232831 248
390 3300009011 Ga0105251_10023306 Ga0105251_100233062 248
391 3300009036 Ga0105244_10193799 Ga0105244_101937991 248
392 3300009092 Ga0105250_10016238 Ga0105250_100162381 248
393 3300009092 Ga0105250_10089685 Ga0105250_100896851 248
394 3300009148 Ga0105243_10000621 Ga0105243_1000062121 248
395 3300011119 Ga0105246_10000624 Ga0105246_100006246 248
396 3300012498 Ga0157345_1000090 Ga0157345_100009015 248
397 3300013100 Ga0157373_10255153 Ga0157373_102551531 248
398 3300013102 Ga0157371_10031229 Ga0157371_100312293 248
399 3300013104 Ga0157370_10057465 Ga0157370_100574652 248
400 3300013104 Ga0157370_10149575 Ga0157370_101495751 248
401 3300013104 Ga0157370_10184307 Ga0157370_101843072 248
402 3300013105 Ga0157369_10068703 Ga0157369_100687033 248
403 3300013105 Ga0157369_10298841 Ga0157369_102988411 248
404 3300013105 Ga0157369_10508280 Ga0157369_105082801 248
405 3300013306 Ga0163162_10090674 Ga0163162_100906742 248
406 3300013306 Ga0163162_10535971 Ga0163162_105359712 248
407 3300013308 Ga0157375_10208547 Ga0157375_102085472 248
408 3300014497 Ga0182008_10116086 Ga0182008_101160861 248
409 3300015261 Ga0182006_1004941 Ga0182006_10049415 248
410 3300015265 Ga0182005_1013705 Ga0182005_10137052 248
411 3300017792 Ga0163161_10094288 Ga0163161_100942881 248
412 3300017792 Ga0163161_10305827 Ga0163161_103058271 248
413 3300017792 Ga0163161_10471049 Ga0163161_104710491 248
414 3300025291 Ga0209675_1007408 Ga0209675_10074081 248
415 3300025292 Ga0209676_1000055 Ga0209676_100005554 248
416 3300025292 Ga0209676_1000127 Ga0209676_100012782 248
417 3300025298 Ga0209050_1000009 Ga0209050_1000009494 248
418 3300025298 Ga0209050_1000120 Ga0209050_100012096 248
419 3300025303 Ga0209051_1000008 Ga0209051_1000008251 248
420 3300025303 Ga0209051_1000083 Ga0209051_1000083139 248
421 3300025304 Ga0209257_1000463 Ga0209257_10004632 248
422 3300025304 Ga0209257_1011451 Ga0209257_10114514 248
423 3300025711 Ga0207696_1003882 Ga0207696_10038822 248
424 3300025711 Ga0207696_1004450 Ga0207696_10044504 248
425 3300025711 Ga0207696_1019209 Ga0207696_10192092 248
426 3300025728 Ga0207655_1000187 Ga0207655_100018768 248
427 3300025728 Ga0207655_1001660 Ga0207655_10016602 248
428 3300025728 Ga0207655_1035671 Ga0207655_10356712 248
429 3300025735 Ga0207713_1006066 Ga0207713_10060661 248
430 3300025735 Ga0207713_1006144 Ga0207713_10061441 248
431 3300025923 Ga0207681_10014425 Ga0207681_100144252 248
432 3300025935 Ga0207709_10000236 Ga0207709_1000023621 248
433 3300027907 Ga0207428_10084799 Ga0207428_100847994 248
434 3300030735 Ga0316178_1110600 Ga0316178_11106002 248
435 3300031548 Ga0307408_100050349 Ga0307408_1000503491 248
436 3300031548 Ga0307408_100093337 Ga0307408_1000933372 248
437 3300031548 Ga0307408_100540722 Ga0307408_1005407221 248
438 3300031901 Ga0307406_10558817 Ga0307406_105588171 248
439 3300031911 Ga0307412_10061299 Ga0307412_100612991 248
440 3300031995 Ga0307409_100523887 Ga0307409_1005238871 248
441 3300032004 Ga0307414_10517488 Ga0307414_105174882 248
442 3300033180 Ga0307510_10005771 Ga0307510_1000577114 248
443 3300033180 Ga0307510_10286553 Ga0307510_102865531 248
444 3300041411 Ga0439466_0094208 Ga0439466_0094208_16_765 248
445 3300042004 Ga0439445_0070051 Ga0439445_0070051_80_844 248
446 3300042010 Ga0439452_000461 Ga0439452_000461_14338_15087 248
447 3300042115 Ga0450911_000800 Ga0450911_000800_192_941 248
448 3300042130 Ga0450892_005700 Ga0450892_005700_177_926 248
449 3300042137 Ga0450902_017113 Ga0450902_017113_257_1006 248
450 3300042145 Ga0450906_000874 Ga0450906_000874_188_937 248
451 3300042531 Ga0450918_031293 Ga0450918_031293_142_891 248
452 3300046452 Ga0495617_022210 Ga0495617_022210_34_783 248
453 3300046453 Ga0495627_004891 Ga0495627_004891_258_1007 248
454 3300046453 Ga0495627_007136 Ga0495627_007136_3486_4235 248
455 3300046453 Ga0495627_011989 Ga0495627_011989_58_807 248
456 3300046457 Ga0495590_0015304 Ga0495590_0015304_36_812 248
457 3300046457 Ga0495590_0024494 Ga0495590_0024494_521_1270 248
458 3300046458 Ga0495591_002320 Ga0495591_002320_6514_7263 248
459 3300046458 Ga0495591_011988 Ga0495591_011988_2311_3057 248
460 3300046458 Ga0495591_025727 Ga0495591_025727_304_1074 248
461 3300046458 Ga0495591_053154 Ga0495591_053154_256_1005 248
462 3300046460 Ga0495638_0014617 Ga0495638_0014617_583_1332 248
463 3300046460 Ga0495638_0295459 Ga0495638_0295459_84_836 248
464 3300046471 Ga0495650_0017635 Ga0495650_0017635_2601_3350 248
465 3300046471 Ga0495650_0019735 Ga0495650_0019735_2396_3145 248
466 3300046471 Ga0495650_0099130 Ga0495650_0099130_31_780 248
467 3300046474 Ga0495605_0013841 Ga0495605_0013841_3505_4254 248
468 3300046475 Ga0495639_0002710 Ga0495639_0002710_13_759 248
469 3300046491 Ga0495584_0075065 Ga0495584_0075065_192_950 248
470 3300046491 Ga0495584_0078833 Ga0495584_0078833_758_1507 248
471 3300046492 Ga0495585_0019087 Ga0495585_0019087_3150_3899 248
472 3300046492 Ga0495585_0132077 Ga0495585_0132077_529_1278 248
473 3300046492 Ga0495585_0151538 Ga0495585_0151538_296_1045 248
474 3300046492 Ga0495585_0238793 Ga0495585_0238793_87_836 248
475 3300046499 Ga0495594_0242992 Ga0495594_0242992_19_768 248
476 3300046500 Ga0495596_0015937 Ga0495596_0015937_2263_3012 248
477 3300046501 Ga0495607_0011355 Ga0495607_0011355_4604_5353 248
478 3300046501 Ga0495607_0187586 Ga0495607_0187586_204_953 248
479 3300046501 Ga0495607_0198386 Ga0495607_0198386_133_882 248
480 3300046506 Ga0495583_0008133 Ga0495583_0008133_1681_2430 248
481 3300046507 Ga0495606_0021735 Ga0495606_0021735_501_1250 248
482 3300046507 Ga0495606_0079333 Ga0495606_0079333_192_941 248
483 3300046507 Ga0495606_0317319 Ga0495606_0317319_31_780 248
484 3300046507 Ga0495606_0324668 Ga0495606_0324668_15_764 248
485 3300046512 Ga0495610_0002656 Ga0495610_0002656_13746_14495 248
486 3300046512 Ga0495610_0016019 Ga0495610_0016019_3523_4281 248
487 3300046512 Ga0495610_0029967 Ga0495610_0029967_604_1362 248
488 3300046512 Ga0495610_0062367 Ga0495610_0062367_874_1632 248
489 3300046512 Ga0495610_0130686 Ga0495610_0130686_75_824 248
490 3300046513 Ga0495616_0035753 Ga0495616_0035753_1624_2373 248
491 3300046513 Ga0495616_0071221 Ga0495616_0071221_852_1601 248
492 3300046513 Ga0495616_0092287 Ga0495616_0092287_376_1125 248
493 3300046515 Ga0495620_0000886 Ga0495620_0000886_3984_4733 248
494 3300046515 Ga0495620_0088577 Ga0495620_0088577_68_817 248
495 3300046518 Ga0495631_0006495 Ga0495631_0006495_5109_5858 248
496 3300046519 Ga0495632_0053918 Ga0495632_0053918_534_1283 248
497 3300046520 Ga0495637_0005757 Ga0495637_0005757_4990_5748 248
498 3300046520 Ga0495637_0069277 Ga0495637_0069277_509_1258 248
499 3300046520 Ga0495637_0084276 Ga0495637_0084276_325_1074 248
500 3300046523 Ga0495644_0020831 Ga0495644_0020831_196_954 248
501 3300046524 Ga0495648_0007322 Ga0495648_0007322_4024_4794 248
502 3300046524 Ga0495648_0044816 Ga0495648_0044816_1936_2685 248
503 3300046524 Ga0495648_0122344 Ga0495648_0122344_169_918 248
504 3300046524 Ga0495648_0169890 Ga0495648_0169890_103_852 248
505 3300046524 Ga0495648_0192276 Ga0495648_0192276_195_944 248
506 3300046530 Ga0495654_0013188 Ga0495654_0013188_3531_4283 248
507 3300046530 Ga0495654_0055180 Ga0495654_0055180_965_1714 248
508 3300046530 Ga0495654_0056619 Ga0495654_0056619_189_935 248
509 3300046530 Ga0495654_0113676 Ga0495654_0113676_153_902 248
510 3300046530 Ga0495654_0120424 Ga0495654_0120424_293_1042 248
511 3300046530 Ga0495654_0125910 Ga0495654_0125910_153_902 248
512 3300046530 Ga0495654_0132667 Ga0495654_0132667_115_864 248
513 3300046530 Ga0495654_0163526 Ga0495654_0163526_64_813 248
514 3300046538 Ga0495609_0005814 Ga0495609_0005814_4811_5560 248
515 3300046538 Ga0495609_0020173 Ga0495609_0020173_25_774 248
516 3300046538 Ga0495609_0020292 Ga0495609_0020292_2154_2903 248
517 3300046538 Ga0495609_0158763 Ga0495609_0158763_45_791 248
518 3300046538 Ga0495609_0187977 Ga0495609_0187977_66_815 248
519 3300046542 Ga0495597_0001496 Ga0495597_0001496_152_901 248
520 3300046542 Ga0495597_0006668 Ga0495597_0006668_193_942 248
521 3300046557 Ga0495622_0031617 Ga0495622_0031617_354_1100 248
522 3300046557 Ga0495622_0109680 Ga0495622_0109680_311_1060 248
523 3300046558 Ga0495633_0009286 Ga0495633_0009286_4512_5261 248
524 3300046648 Ga0495611_0001350 Ga0495611_0001350_5129_5878 248
525 3300046660 Ga0495625_0021737 Ga0495625_0021737_3974_4723 248
526 3300046660 Ga0495625_0026076 Ga0495625_0026076_3571_4320 248
527 3300046665 Ga0495661_0115392 Ga0495661_0115392_20_769 248
528 3300046691 Ga0495670_0009112 Ga0495670_0009112_3955_4704 248
529 3300046691 Ga0495670_0014350 Ga0495670_0014350_198_944 248
530 3300046691 Ga0495670_0261081 Ga0495670_0261081_118_876 248
531 3300046692 Ga0495671_0016070 Ga0495671_0016070_155_913 248
532 3300046692 Ga0495671_0021151 Ga0495671_0021151_2472_3221 248
533 3300046692 Ga0495671_0080828 Ga0495671_0080828_195_941 248
534 3300046692 Ga0495671_0169251 Ga0495671_0169251_22_771 248
535 3300046692 Ga0495671_0205597 Ga0495671_0205597_150_899 248
536 3300046692 Ga0495671_0219822 Ga0495671_0219822_68_817 248
537 3300046692 Ga0495671_0245003 Ga0495671_0245003_73_822 248
538 3300046694 Ga0495649_0009474 Ga0495649_0009474_1180_1929 248
539 3300046694 Ga0495649_0015710 Ga0495649_0015710_102_851 248
540 3300046694 Ga0495649_0157928 Ga0495649_0157928_149_898 248
541 3300046794 Ga0495589_0011311 Ga0495589_0011311_146_895 248
542 3300046794 Ga0495589_0102954 Ga0495589_0102954_176_925 248
543 3300046810 Ga0495660_0005512 Ga0495660_0005512_6661_7410 248
544 3300046810 Ga0495660_0037217 Ga0495660_0037217_1773_2519 248
545 3300046810 Ga0495660_0161019 Ga0495660_0161019_322_1071 248
546 3300046810 Ga0495660_0189342 Ga0495660_0189342_86_835 248
547 3300046810 Ga0495660_0217860 Ga0495660_0217860_125_874 248
548 3300047320 Ga0495672_0029445 Ga0495672_0029445_2403_3152 248
549 3300047321 Ga0495676_0032623 Ga0495676_0032623_3576_4325 248
550 3300047323 Ga0495683_0224293 Ga0495683_0224293_71_820 248
551 3300047446 Ga0495679_007095 Ga0495679_007095_37_786 248
552 3300047446 Ga0495679_007390 Ga0495679_007390_393_1142 248
553 3300047469 Ga0495673_0012910 Ga0495673_0012910_134_883 248
554 3300047469 Ga0495673_0031324 Ga0495673_0031324_137_886 248
555 3300047469 Ga0495673_0128975 Ga0495673_0128975_174_923 248
556 3300047470 Ga0495681_0013637 Ga0495681_0013637_145_903 248
557 3300047470 Ga0495681_0014807 Ga0495681_0014807_2308_3066 248
558 3300047470 Ga0495681_0022139 Ga0495681_0022139_267_1016 248
559 3300047470 Ga0495681_0024532 Ga0495681_0024532_144_893 248
560 3300047470 Ga0495681_0072022 Ga0495681_0072022_307_1056 248
561 3300047470 Ga0495681_0113620 Ga0495681_0113620_252_1001 248
562 3300047472 Ga0495686_0020607 Ga0495686_0020607_142_891 248
563 3300048091 Ga0495626_0032043 Ga0495626_0032043_1645_2394 248
564 3300048091 Ga0495626_0035698 Ga0495626_0035698_73_822 248
565 3300048091 Ga0495626_0145687 Ga0495626_0145687_76_825 248
566 3300048091 Ga0495626_0158951 Ga0495626_0158951_49_798 248
567 3300048091 Ga0495626_0169337 Ga0495626_0169337_112_861 248
568 3300048917 Ga0496114_0773212 Ga0496114_0773212_70_816 248
569 3300048919 Ga0496116_0001926 Ga0496116_0001926_5507_6256 248
570 3300048924 Ga0496121_0221769 Ga0496121_0221769_404_1150 248
571 3300048928 Ga0496125_0354368 Ga0496125_0354368_29_775 248
572 3300049459 Ga0495678_008494 Ga0495678_008494_4131_4880 248
573 3300049459 Ga0495678_025790 Ga0495678_025790_1637_2386 248
574 3300049459 Ga0495678_055082 Ga0495678_055082_686_1435 248
575 3300049459 Ga0495678_079818 Ga0495678_079818_306_1055 248
576 3300049460 Ga0495682_0071410 Ga0495682_0071410_464_1213 248
577 3300050491 nmdc:mga00v17_353056_c1 nmdc:mga00v17_353056_c1_170_919 248
578 iso_pu_bacteria 3007861166 3007862915 248
579 2124908027 MRS2a_Contig_82 MRS2a_00674360 249
580 3300003791 Ga0055530_10000226 Ga0055530_1000022621 249
581 3300003792 Ga0055540_1000074 Ga0055540_100007486 249
582 3300005288 Ga0065714_10000356 Ga0065714_100003562 249
583 3300005288 Ga0065714_10015992 Ga0065714_100159921 249
584 3300005288 Ga0065714_10071744 Ga0065714_100717443 249
585 3300005288 Ga0065714_10153857 Ga0065714_101538571 249
586 3300005290 Ga0065712_10003055 Ga0065712_100030554 249
587 3300006051 Ga0075364_10229294 Ga0075364_102292941 249
588 3300006051 Ga0075364_10300126 Ga0075364_103001261 249
589 3300006051 Ga0075364_10331679 Ga0075364_103316791 249
590 3300006058 Ga0075432_10008955 Ga0075432_100089551 249
591 3300006058 Ga0075432_10082655 Ga0075432_100826552 249
592 3300006058 Ga0075432_10085376 Ga0075432_100853762 249
593 3300006058 Ga0075432_10107075 Ga0075432_101070751 249
594 3300006186 Ga0075369_10049562 Ga0075369_100495622 249
595 3300006946 Ga0079104_1000684 Ga0079104_10006848 249
596 3300006946 Ga0079104_1001184 Ga0079104_10011842 249
597 3300006948 Ga0099826_10007191 Ga0099826_100071912 249
598 3300009011 Ga0105251_10007337 Ga0105251_100073371 249
599 3300009036 Ga0105244_10112796 Ga0105244_101127961 249
600 3300009036 Ga0105244_10137863 Ga0105244_101378632 249
601 3300009036 Ga0105244_10182905 Ga0105244_101829051 249
602 3300009148 Ga0105243_10045724 Ga0105243_100457243 249
603 3300013100 Ga0157373_10000806 Ga0157373_1000080618 249
604 3300013104 Ga0157370_10062766 Ga0157370_100627661 249
605 3300013105 Ga0157369_10429392 Ga0157369_104293922 249
606 3300014497 Ga0182008_10157454 Ga0182008_101574541 249
607 3300014497 Ga0182008_10229346 Ga0182008_102293461 249
608 3300015261 Ga0182006_1020734 Ga0182006_10207342 249
609 3300015261 Ga0182006_1033357 Ga0182006_10333572 249
610 3300017792 Ga0163161_10005503 Ga0163161_100055036 249
611 3300017792 Ga0163161_10075482 Ga0163161_100754822 249
612 3300025292 Ga0209676_1000021 Ga0209676_1000021470 249
613 3300025298 Ga0209050_1000162 Ga0209050_1000162127 249
614 3300025298 Ga0209050_1001848 Ga0209050_10018482 249
615 3300025303 Ga0209051_1000121 Ga0209051_100012125 249
616 3300025303 Ga0209051_1019512 Ga0209051_10195122 249
617 3300025711 Ga0207696_1055476 Ga0207696_10554761 249
618 3300025711 Ga0207696_1056796 Ga0207696_10567961 249
619 3300025728 Ga0207655_1084513 Ga0207655_10845131 249
620 3300025735 Ga0207713_1005042 Ga0207713_10050425 249
621 3300025735 Ga0207713_1011352 Ga0207713_10113526 249
622 3300025735 Ga0207713_1098403 Ga0207713_10984031 249
623 3300027111 Ga0209281_1000011 Ga0209281_100001136 249
624 3300027111 Ga0209281_1000090 Ga0209281_1000090130 249
625 3300027666 Ga0209282_1061890 Ga0209282_10618902 249
626 3300027907 Ga0207428_10076781 Ga0207428_100767812 249
627 3300027907 Ga0207428_10139226 Ga0207428_101392262 249
628 3300027907 Ga0207428_10365225 Ga0207428_103652251 249
629 3300027907 Ga0207428_10371819 Ga0207428_103718192 249
630 3300030731 Ga0316177_1188831 Ga0316177_11888312 249
631 3300030744 Ga0316181_1236466 Ga0316181_12364662 249
632 3300031548 Ga0307408_100001387 Ga0307408_1000013871 249
633 3300031731 Ga0307405_10039162 Ga0307405_100391622 249
634 3300031901 Ga0307406_10153599 Ga0307406_101535991 249
635 3300031901 Ga0307406_10475873 Ga0307406_104758731 249
636 3300031903 Ga0307407_10027776 Ga0307407_100277762 249
637 3300031911 Ga0307412_10047326 Ga0307412_100473262 249
638 3300031911 Ga0307412_10051434 Ga0307412_100514342 249
639 3300031911 Ga0307412_10051435 Ga0307412_100514352 249
640 3300031995 Ga0307409_100067120 Ga0307409_1000671201 249
641 3300032004 Ga0307414_10139572 Ga0307414_101395722 249
642 3300032004 Ga0307414_10230573 Ga0307414_102305731 249
643 3300032004 Ga0307414_10411800 Ga0307414_104118001 249
644 3300032004 Ga0307414_10437021 Ga0307414_104370211 249
645 3300032005 Ga0307411_10053396 Ga0307411_100533962 249
646 3300032005 Ga0307411_10121545 Ga0307411_101215451 249
647 3300041405 Ga0439438_005868 Ga0439438_005868_3499_4296 249
648 3300041405 Ga0439438_008843 Ga0439438_008843_521_1288 249
649 3300041405 Ga0439438_010742 Ga0439438_010742_1950_2711 249
650 3300041405 Ga0439438_021597 Ga0439438_021597_39_788 249
651 3300041405 Ga0439438_046932 Ga0439438_046932_152_949 249
652 3300041407 Ga0439447_003278 Ga0439447_003278_4971_5720 249
653 3300041407 Ga0439447_008945 Ga0439447_008945_190_942 249
654 3300041407 Ga0439447_011825 Ga0439447_011825_110_862 249
655 3300041407 Ga0439447_032245 Ga0439447_032245_437_1198 249
656 3300041407 Ga0439447_048983 Ga0439447_048983_133_900 249
657 3300041411 Ga0439466_0002381 Ga0439466_0002381_203_976 249
658 3300041411 Ga0439466_0002915 Ga0439466_0002915_187_939 249
659 3300041411 Ga0439466_0013887 Ga0439466_0013887_170_922 249
660 3300041411 Ga0439466_0048085 Ga0439466_0048085_59_811 249
661 3300041411 Ga0439466_0087033 Ga0439466_0087033_194_943 249
662 3300041997 Ga0439431_0004512 Ga0439431_0004512_2103_2870 249
663 3300042004 Ga0439445_0025577 Ga0439445_0025577_550_1317 249
664 3300042006 Ga0439432_010586 Ga0439432_010586_2351_3118 249
665 3300042006 Ga0439432_012462 Ga0439432_012462_205_1002 249
666 3300042006 Ga0439432_032134 Ga0439432_032134_785_1537 249
667 3300042006 Ga0439432_080669 Ga0439432_080669_58_807 249
668 3300042009 Ga0439451_003578 Ga0439451_003578_167_916 249
669 3300042010 Ga0439452_008775 Ga0439452_008775_260_1027 249
670 3300042010 Ga0439452_029884 Ga0439452_029884_187_984 249
671 3300042010 Ga0439452_037747 Ga0439452_037747_135_887 249
672 3300042013 Ga0439456_007086 Ga0439456_007086_813_1610 249
673 3300042016 Ga0439463_000613 Ga0439463_000613_8967_9740 249
674 3300042121 Ga0450919_006006 Ga0450919_006006_524_1321 249
675 3300042122 Ga0450920_006111 Ga0450920_006111_1197_1994 249
676 3300042124 Ga0450922_003469 Ga0450922_003469_497_1294 249
677 3300042125 Ga0450923_044108 Ga0450923_044108_131_928 249
678 3300042137 Ga0450902_005851 Ga0450902_005851_907_1671 249
679 3300042142 Ga0450905_001215 Ga0450905_001215_192_956 249
680 3300042142 Ga0450905_020724 Ga0450905_020724_104_853 249
681 3300042145 Ga0450906_015557 Ga0450906_015557_161_958 249
682 3300042146 Ga0450907_000151 Ga0450907_000151_18204_18953 249
683 3300042146 Ga0450907_002221 Ga0450907_002221_1514_2311 249
684 3300042147 Ga0450910_000958 Ga0450910_000958_1142_1939 249
685 3300042147 Ga0450910_002447 Ga0450910_002447_78_845 249
686 3300042156 Ga0439446_0010903 Ga0439446_0010903_1523_2272 249
687 3300042185 Ga0450909_000347 Ga0450909_000347_931_1680 249
688 3300042185 Ga0450909_002287 Ga0450909_002287_1938_2699 249
689 3300042435 Ga0439434_0035662 Ga0439434_0035662_682_1431 249
690 3300042461 Ga0439460_0003624 Ga0439460_0003624_125_922 249
691 3300042531 Ga0450918_023632 Ga0450918_023632_158_955 249
692 3300042993 Ga0439440_0010877 Ga0439440_0010877_956_1729 249
693 3300042993 Ga0439440_0047396 Ga0439440_0047396_142_891 249
694 3300046452 Ga0495617_021982 Ga0495617_021982_148_900 249
695 3300046452 Ga0495617_050041 Ga0495617_050041_422_1171 249
696 3300046452 Ga0495617_054640 Ga0495617_054640_242_1039 249
697 3300046453 Ga0495627_000501 Ga0495627_000501_4017_4769 249
698 3300046455 Ga0495603_0033952 Ga0495603_0033952_1941_2705 249
699 3300046455 Ga0495603_0157778 Ga0495603_0157778_59_808 249
700 3300046457 Ga0495590_0000444 Ga0495590_0000444_158_955 249
701 3300046457 Ga0495590_0010739 Ga0495590_0010739_2520_3272 249
702 3300046457 Ga0495590_0071147 Ga0495590_0071147_287_1039 249
703 3300046457 Ga0495590_0120221 Ga0495590_0120221_115_864 249
704 3300046458 Ga0495591_000310 Ga0495591_000310_2870_3622 249
705 3300046458 Ga0495591_013860 Ga0495591_013860_624_1421 249
706 3300046458 Ga0495591_026036 Ga0495591_026036_149_901 249
707 3300046458 Ga0495591_055677 Ga0495591_055677_145_942 249
708 3300046459 Ga0495629_0303747 Ga0495629_0303747_146_910 249
709 3300046460 Ga0495638_0000726 Ga0495638_0000726_167_919 249
710 3300046460 Ga0495638_0071323 Ga0495638_0071323_106_858 249
711 3300046460 Ga0495638_0103144 Ga0495638_0103144_908_1660 249
712 3300046460 Ga0495638_0165282 Ga0495638_0165282_145_942 249
713 3300046460 Ga0495638_0184338 Ga0495638_0184338_148_900 249
714 3300046460 Ga0495638_0203726 Ga0495638_0203726_128_925 249
715 3300046460 Ga0495638_0273617 Ga0495638_0273617_21_773 249
716 3300046463 Ga0495653_0000981 Ga0495653_0000981_20996_21760 249
717 3300046471 Ga0495650_0021292 Ga0495650_0021292_2208_2957 249
718 3300046471 Ga0495650_0143395 Ga0495650_0143395_20_769 249
719 3300046473 Ga0495582_0256750 Ga0495582_0256750_187_951 249
720 3300046474 Ga0495605_0005109 Ga0495605_0005109_4576_5373 249
721 3300046474 Ga0495605_0151554 Ga0495605_0151554_182_931 249
722 3300046475 Ga0495639_0212922 Ga0495639_0212922_143_892 249
723 3300046491 Ga0495584_0003891 Ga0495584_0003891_7118_7870 249
724 3300046491 Ga0495584_0159510 Ga0495584_0159510_318_1115 249
725 3300046491 Ga0495584_0165371 Ga0495584_0165371_233_985 249
726 3300046492 Ga0495585_0004299 Ga0495585_0004299_6267_7016 249
727 3300046492 Ga0495585_0004885 Ga0495585_0004885_414_1163 249
728 3300046492 Ga0495585_0031340 Ga0495585_0031340_2122_2874 249
729 3300046492 Ga0495585_0076873 Ga0495585_0076873_936_1688 249
730 3300046492 Ga0495585_0184474 Ga0495585_0184474_266_1015 249
731 3300046499 Ga0495594_0037719 Ga0495594_0037719_1471_2220 249
732 3300046499 Ga0495594_0223584 Ga0495594_0223584_114_878 249
733 3300046500 Ga0495596_0001042 Ga0495596_0001042_230_982 249
734 3300046501 Ga0495607_0001014 Ga0495607_0001014_24944_25696 249
735 3300046501 Ga0495607_0004187 Ga0495607_0004187_5523_6272 249
736 3300046501 Ga0495607_0034029 Ga0495607_0034029_2264_3016 249
737 3300046501 Ga0495607_0153866 Ga0495607_0153866_288_1040 249
738 3300046506 Ga0495583_0078339 Ga0495583_0078339_456_1253 249
739 3300046506 Ga0495583_0135209 Ga0495583_0135209_209_961 249
740 3300046507 Ga0495606_0007627 Ga0495606_0007627_5006_5803 249
741 3300046512 Ga0495610_0015687 Ga0495610_0015687_3468_4220 249
742 3300046512 Ga0495610_0122729 Ga0495610_0122729_167_964 249
743 3300046513 Ga0495616_0004514 Ga0495616_0004514_258_1007 249
744 3300046513 Ga0495616_0058775 Ga0495616_0058775_148_900 249
745 3300046513 Ga0495616_0134655 Ga0495616_0134655_230_982 249
746 3300046513 Ga0495616_0192194 Ga0495616_0192194_91_840 249
747 3300046515 Ga0495620_0006213 Ga0495620_0006213_5644_6393 249
748 3300046515 Ga0495620_0047635 Ga0495620_0047635_921_1673 249
749 3300046515 Ga0495620_0079070 Ga0495620_0079070_349_1146 249
750 3300046516 Ga0495628_0164408 Ga0495628_0164408_60_809 249
751 3300046516 Ga0495628_0281280 Ga0495628_0281280_448_1212 249
752 3300046517 Ga0495630_0006130 Ga0495630_0006130_6369_7121 249
753 3300046517 Ga0495630_0227449 Ga0495630_0227449_148_912 249
754 3300046518 Ga0495631_0029801 Ga0495631_0029801_1641_2393 249
755 3300046518 Ga0495631_0129494 Ga0495631_0129494_152_949 249
756 3300046519 Ga0495632_0005193 Ga0495632_0005193_197_946 249
757 3300046519 Ga0495632_0023643 Ga0495632_0023643_1455_2207 249
758 3300046519 Ga0495632_0169804 Ga0495632_0169804_32_784 249
759 3300046520 Ga0495637_0004677 Ga0495637_0004677_172_921 249
760 3300046520 Ga0495637_0095567 Ga0495637_0095567_235_987 249
761 3300046520 Ga0495637_0104989 Ga0495637_0104989_151_948 249
762 3300046520 Ga0495637_0127049 Ga0495637_0127049_51_848 249
763 3300046522 Ga0495643_0138169 Ga0495643_0138169_445_1197 249
764 3300046522 Ga0495643_0170009 Ga0495643_0170009_150_947 249
765 3300046522 Ga0495643_0175774 Ga0495643_0175774_198_947 249
766 3300046522 Ga0495643_0201981 Ga0495643_0201981_84_836 249
767 3300046523 Ga0495644_0000518 Ga0495644_0000518_139_891 249
768 3300046523 Ga0495644_0065118 Ga0495644_0065118_305_1054 249
769 3300046524 Ga0495648_0039349 Ga0495648_0039349_452_1249 249
770 3300046524 Ga0495648_0087341 Ga0495648_0087341_153_950 249
771 3300046524 Ga0495648_0093438 Ga0495648_0093438_198_947 249
772 3300046524 Ga0495648_0132351 Ga0495648_0132351_103_852 249
773 3300046526 Ga0495666_0000114 Ga0495666_0000114_172_924 249
774 3300046526 Ga0495666_0005803 Ga0495666_0005803_731_1480 249
775 3300046526 Ga0495666_0158496 Ga0495666_0158496_99_848 249
776 3300046528 Ga0495642_0000256 Ga0495642_0000256_13279_14076 249
777 3300046528 Ga0495642_0001924 Ga0495642_0001924_418_1167 249
778 3300046529 Ga0495652_0159388 Ga0495652_0159388_77_826 249
779 3300046530 Ga0495654_0000675 Ga0495654_0000675_26009_26761 249
780 3300046530 Ga0495654_0016816 Ga0495654_0016816_2875_3672 249
781 3300046530 Ga0495654_0053440 Ga0495654_0053440_713_1510 249
782 3300046530 Ga0495654_0055402 Ga0495654_0055402_1020_1772 249
783 3300046530 Ga0495654_0131226 Ga0495654_0131226_158_955 249
784 3300046535 Ga0495586_0130120 Ga0495586_0130120_30_782 249
785 3300046536 Ga0495587_0001129 Ga0495587_0001129_2565_3314 249
786 3300046536 Ga0495587_0119116 Ga0495587_0119116_328_1092 249
787 3300046538 Ga0495609_0010504 Ga0495609_0010504_1482_2231 249
788 3300046538 Ga0495609_0061220 Ga0495609_0061220_730_1479 249
789 3300046538 Ga0495609_0142489 Ga0495609_0142489_164_961 249
790 3300046538 Ga0495609_0151171 Ga0495609_0151171_159_956 249
791 3300046542 Ga0495597_0021884 Ga0495597_0021884_106_858 249
792 3300046542 Ga0495597_0040074 Ga0495597_0040074_969_1718 249
793 3300046542 Ga0495597_0134508 Ga0495597_0134508_101_898 249
794 3300046542 Ga0495597_0137719 Ga0495597_0137719_165_917 249
795 3300046542 Ga0495597_0148816 Ga0495597_0148816_126_878 249
796 3300046542 Ga0495597_0158069 Ga0495597_0158069_154_906 249
797 3300046557 Ga0495622_0007834 Ga0495622_0007834_1489_2238 249
798 3300046557 Ga0495622_0036173 Ga0495622_0036173_196_960 249
799 3300046557 Ga0495622_0076568 Ga0495622_0076568_737_1501 249
800 3300046615 Ga0495656_0013418 Ga0495656_0013418_199_948 249
801 3300046615 Ga0495656_0029010 Ga0495656_0029010_180_932 249
802 3300046648 Ga0495611_0015137 Ga0495611_0015137_168_920 249
803 3300046660 Ga0495625_0019950 Ga0495625_0019950_1946_2743 249
804 3300046660 Ga0495625_0047322 Ga0495625_0047322_96_845 249
805 3300046660 Ga0495625_0054775 Ga0495625_0054775_167_916 249
806 3300046660 Ga0495625_0223795 Ga0495625_0223795_146_898 249
807 3300046660 Ga0495625_0282297 Ga0495625_0282297_116_868 249
808 3300046663 Ga0495635_0005820 Ga0495635_0005820_7342_8091 249
809 3300046663 Ga0495635_0077281 Ga0495635_0077281_1085_1849 249
810 3300046665 Ga0495661_0033879 Ga0495661_0033879_193_942 249
811 3300046665 Ga0495661_0130687 Ga0495661_0130687_143_895 249
812 3300046674 Ga0495588_0046233 Ga0495588_0046233_1322_2086 249
813 3300046674 Ga0495588_0051756 Ga0495588_0051756_507_1256 249
814 3300046674 Ga0495588_0057212 Ga0495588_0057212_1031_1828 249
815 3300046674 Ga0495588_0064191 Ga0495588_0064191_991_1788 249
816 3300046674 Ga0495588_0258297 Ga0495588_0258297_131_895 249
817 3300046675 Ga0495657_0161249 Ga0495657_0161249_157_909 249
818 3300046679 Ga0495623_0007410 Ga0495623_0007410_153_902 249
819 3300046679 Ga0495623_0086609 Ga0495623_0086609_1009_1761 249
820 3300046680 Ga0495646_0175756 Ga0495646_0175756_84_848 249
821 3300046684 Ga0495669_0009322 Ga0495669_0009322_200_949 249
822 3300046684 Ga0495669_0121681 Ga0495669_0121681_256_1053 249
823 3300046689 Ga0495613_0114061 Ga0495613_0114061_389_1138 249
824 3300046689 Ga0495613_0126856 Ga0495613_0126856_860_1624 249
825 3300046691 Ga0495670_0041843 Ga0495670_0041843_165_917 249
826 3300046691 Ga0495670_0243071 Ga0495670_0243071_68_862 249
827 3300046692 Ga0495671_0016364 Ga0495671_0016364_148_900 249
828 3300046692 Ga0495671_0017017 Ga0495671_0017017_447_1199 249
829 3300046692 Ga0495671_0025622 Ga0495671_0025622_2123_2917 249
830 3300046692 Ga0495671_0027539 Ga0495671_0027539_68_820 249
831 3300046692 Ga0495671_0047865 Ga0495671_0047865_153_950 249
832 3300046692 Ga0495671_0117619 Ga0495671_0117619_368_1117 249
833 3300046692 Ga0495671_0153819 Ga0495671_0153819_161_958 249
834 3300046694 Ga0495649_0000791 Ga0495649_0000791_24623_25375 249
835 3300046694 Ga0495649_0034874 Ga0495649_0034874_171_968 249
836 3300046694 Ga0495649_0040778 Ga0495649_0040778_1577_2374 249
837 3300046694 Ga0495649_0088253 Ga0495649_0088253_730_1482 249
838 3300046694 Ga0495649_0280801 Ga0495649_0280801_70_819 249
839 3300046794 Ga0495589_0012629 Ga0495589_0012629_185_934 249
840 3300046794 Ga0495589_0019829 Ga0495589_0019829_484_1233 249
841 3300046794 Ga0495589_0085384 Ga0495589_0085384_159_956 249
842 3300046794 Ga0495589_0115874 Ga0495589_0115874_169_966 249
843 3300046794 Ga0495589_0154313 Ga0495589_0154313_172_924 249
844 3300046810 Ga0495660_0008773 Ga0495660_0008773_4223_4972 249
845 3300046810 Ga0495660_0177302 Ga0495660_0177302_134_886 249
846 3300046810 Ga0495660_0185727 Ga0495660_0185727_58_810 249
847 3300047315 Ga0495581_0077264 Ga0495581_0077264_989_1753 249
848 3300047317 Ga0495604_0030547 Ga0495604_0030547_169_921 249
849 3300047317 Ga0495604_0247182 Ga0495604_0247182_399_1163 249
850 3300047319 Ga0495674_0032971 Ga0495674_0032971_175_924 249
851 3300047320 Ga0495672_0000643 Ga0495672_0000643_35505_36299 249
852 3300047320 Ga0495672_0005579 Ga0495672_0005579_469_1266 249
853 3300047320 Ga0495672_0043701 Ga0495672_0043701_1748_2545 249
854 3300047320 Ga0495672_0058428 Ga0495672_0058428_1358_2110 249
855 3300047320 Ga0495672_0081514 Ga0495672_0081514_857_1654 249
856 3300047320 Ga0495672_0160049 Ga0495672_0160049_305_1054 249
857 3300047320 Ga0495672_0160064 Ga0495672_0160064_168_965 249
858 3300047322 Ga0495680_0014684 Ga0495680_0014684_4720_5484 249
859 3300047322 Ga0495680_0053148 Ga0495680_0053148_475_1224 249
860 3300047322 Ga0495680_0122266 Ga0495680_0122266_486_1238 249
861 3300047323 Ga0495683_0004238 Ga0495683_0004238_7243_7992 249
862 3300047323 Ga0495683_0006877 Ga0495683_0006877_2054_2851 249
863 3300047323 Ga0495683_0044768 Ga0495683_0044768_166_918 249
864 3300047323 Ga0495683_0134288 Ga0495683_0134288_259_1011 249
865 3300047323 Ga0495683_0156820 Ga0495683_0156820_123_920 249
866 3300047443 Ga0495687_011984 Ga0495687_011984_1868_2665 249
867 3300047444 Ga0495675_0030531 Ga0495675_0030531_97_861 249
868 3300047444 Ga0495675_0069529 Ga0495675_0069529_1290_2039 249
869 3300047444 Ga0495675_0355014 Ga0495675_0355014_47_796 249
870 3300047445 Ga0495677_0013934 Ga0495677_0013934_1614_2363 249
871 3300047446 Ga0495679_040239 Ga0495679_040239_511_1260 249
872 3300047469 Ga0495673_0016156 Ga0495673_0016156_165_962 249
873 3300047469 Ga0495673_0027144 Ga0495673_0027144_175_927 249
874 3300047469 Ga0495673_0040956 Ga0495673_0040956_1137_1934 249
875 3300047469 Ga0495673_0042318 Ga0495673_0042318_52_804 249
876 3300047469 Ga0495673_0076074 Ga0495673_0076074_536_1285 249
877 3300047469 Ga0495673_0107347 Ga0495673_0107347_139_891 249
878 3300047470 Ga0495681_0000622 Ga0495681_0000622_148_900 249
879 3300047470 Ga0495681_0003351 Ga0495681_0003351_148_900 249
880 3300047470 Ga0495681_0014558 Ga0495681_0014558_171_968 249
881 3300047470 Ga0495681_0014875 Ga0495681_0014875_3470_4267 249
882 3300047470 Ga0495681_0044169 Ga0495681_0044169_83_835 249
883 3300047470 Ga0495681_0161373 Ga0495681_0161373_15_764 249
884 3300047471 Ga0495684_0183410 Ga0495684_0183410_175_927 249
885 3300047472 Ga0495686_0040950 Ga0495686_0040950_1859_2611 249
886 3300047472 Ga0495686_0115217 Ga0495686_0115217_629_1426 249
887 3300047673 Ga0495593_0030725 Ga0495593_0030725_1998_2750 249
888 3300047673 Ga0495593_0072051 Ga0495593_0072051_920_1684 249
889 3300048088 Ga0495602_0296126 Ga0495602_0296126_163_912 249
890 3300048091 Ga0495626_0001185 Ga0495626_0001185_154_951 249
891 3300048091 Ga0495626_0006732 Ga0495626_0006732_677_1474 249
892 3300048091 Ga0495626_0028025 Ga0495626_0028025_1919_2668 249
893 3300048091 Ga0495626_0118956 Ga0495626_0118956_66_815 249
894 3300048091 Ga0495626_0162779 Ga0495626_0162779_10_762 249
895 3300048905 Ga0496102_0008223 Ga0496102_0008223_8003_8752 249
896 3300048905 Ga0496102_0501401 Ga0496102_0501401_123_920 249
897 3300048906 Ga0496103_0004516 Ga0496103_0004516_175_924 249
898 3300048909 Ga0496106_0065512 Ga0496106_0065512_139_888 249
899 3300048913 Ga0496110_0038310 Ga0496110_0038310_41_793 249
900 3300048920 Ga0496117_0038629 Ga0496117_0038629_2775_3524 249
901 3300048921 Ga0496118_0015212 Ga0496118_0015212_354_1103 249
902 3300048921 Ga0496118_0192862 Ga0496118_0192862_117_914 249
903 3300048921 Ga0496118_0286299 Ga0496118_0286299_94_843 249
904 3300048924 Ga0496121_0064935 Ga0496121_0064935_1286_2035 249
905 3300048927 Ga0496124_0001273 Ga0496124_0001273_31606_32358 249
906 3300048927 Ga0496124_0038917 Ga0496124_0038917_3093_3890 249
907 3300048928 Ga0496125_0041347 Ga0496125_0041347_2659_3453 249
908 3300048929 Ga0496126_0050497 Ga0496126_0050497_525_1274 249
909 3300049459 Ga0495678_001039 Ga0495678_001039_123_875 249
910 3300049459 Ga0495678_018634 Ga0495678_018634_165_917 249
911 3300049459 Ga0495678_094446 Ga0495678_094446_159_956 249
912 3300049460 Ga0495682_0005294 Ga0495682_0005294_329_1126 249
913 3300049460 Ga0495682_0018954 Ga0495682_0018954_22_819 249
914 3300049460 Ga0495682_0029747 Ga0495682_0029747_487_1236 249
915 3300049665 Ga0501227_015242 Ga0501227_015242_843_1610 249
916 3300049766 Ga0501269_005693 Ga0501269_005693_611_1378 249
917 3300049853 Ga0501226_006650 Ga0501226_006650_482_1249 249
918 3300050489 nmdc:mga03683_19680_c1 nmdc:mga03683_19680_c1_1637_2434 249
919 3300050491 nmdc:mga00v17_241278_c1 nmdc:mga00v17_241278_c1_247_1044 249
920 3300050491 nmdc:mga00v17_242512_c1 nmdc:mga00v17_242512_c1_144_941 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

18

240

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pyy-assembly1.cif.gz_C crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate 0.827 21 241
2pyy-assembly1.cif.gz_C crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate 0.8235 21 241
1ii5-assembly1.cif.gz_A crystal structure of the glur0 ligand binding core complex with l-glutamate 0.8104 17 240
1ii5-assembly1.cif.gz_A crystal structure of the glur0 ligand binding core complex with l-glutamate 0.8072 17 240
6a8s-assembly1.cif.gz_B crystal structure of the putative amino acid-binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with cysteine 0.8022 20 238
ID Description Score Start End Superfamily
4q0cD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8396 21 105 3.40.190.10
af_P0AEQ3_26_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8239 22 84 3.40.190.10
2pyyC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8135 21 241 3.40.190.10
2pyyC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8074 21 241 3.40.190.10
3kzgC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8062 21 105 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Q9XRM6-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9558 14 238 GO:0030313
AF-A0A2W1MFK1-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9338 1 238
AF-A0A653YD17-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9322 1 238 GO:0030313
AF-A0A1Q9XRM6-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9316 14 238 GO:0030313
AF-A0A836NT00-F1-model_v4 deleted 0.9228 8 106

Feature Viewer

pLDDT pTM Quality
89 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map