F485570
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 914 | 283 | 1828 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10003505|Ga0157375_1000350513 |
| Length | 292 |
| Sequence | LFEHDAISLTFEIGNTQMATQTATLQTRPIPSSDGILLPAFTLWWREIVRFYRQRARVVGVIASPLLFWIVIGSGFGTSFRSGEGPGQDHYLDYFFPGALIMIVLFTAIFTMMSVIEDRKEGFLLSVLVAPVPRSAIVLGKVLGGTTLAAAQGLLFLVFAPFVGIHFHFIQFLLILSVVFLVSFALTALGFAIAWPMDSTQAFHGIINLFLIPLWLLSGALFPLNKAAHWLSMLMRINPLTYGVEALRTLLYPGSPSDFSLTESLATLVLFSLFMFAIAFVVANRRTTKPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 119 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 120 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 121 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 122 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.35 |
| Rhizosphere | 92.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157375_10003505 | 3300013308 | Bacteria | 13607 |
| 2 | LJNas_1000849 | 3300000546 | Bacteria | 5012 |
| 3 | JGI24743J22301_10000093 | 3300001991 | Bacteria | 8658 |
| 4 | JGI24748J21848_1003187 | 3300002074 | Bacteria | 1872 |
| 5 | JGI24034J26672_10001180 | 3300002239 | Bacteria | 3419 |
| 6 | JGI24751J29686_10000635 | 3300002459 | Bacteria | 9014 |
| 7 | Ga0065712_10114404 | 3300005290 | Bacteria | 1763 |
| 8 | Ga0065712_10141661 | 3300005290 | Bacteria | 1389 |
| 9 | Ga0070658_10319675 | 3300005327 | Bacteria | 1325 |
| 10 | Ga0070676_10005283 | 3300005328 | Bacteria | 6866 |
| 11 | Ga0070676_10041193 | 3300005328 | Unclassified | 2677 |
| 12 | Ga0070683_100001910 | 3300005329 | Bacteria | 16302 |
| 13 | Ga0070683_100022151 | 3300005329 | Bacteria | 5677 |
| 14 | Ga0070683_100061135 | 3300005329 | Bacteria | 3502 |
| 15 | Ga0070683_100104700 | 3300005329 | Bacteria | 2667 |
| 16 | Ga0070690_100003363 | 3300005330 | Bacteria | 8732 |
| 17 | Ga0070690_100070525 | 3300005330 | Unclassified | 2269 |
| 18 | Ga0070670_100001939 | 3300005331 | Bacteria | 16933 |
| 19 | Ga0070670_100006041 | 3300005331 | Bacteria | 10241 |
| 20 | Ga0070670_100216357 | 3300005331 | Unclassified | 1667 |
| 21 | Ga0068869_100001662 | 3300005334 | Bacteria | 13287 |
| 22 | Ga0068869_100028706 | 3300005334 | Bacteria | 3891 |
| 23 | Ga0070666_10008180 | 3300005335 | Bacteria | 6481 |
| 24 | Ga0070666_10090596 | 3300005335 | Bacteria | 2100 |
| 25 | Ga0070680_100030773 | 3300005336 | Bacteria | 4312 |
| 26 | Ga0070680_100067974 | 3300005336 | Bacteria | 2924 |
| 27 | Ga0070680_100089406 | 3300005336 | Bacteria | 2548 |
| 28 | Ga0070680_100109169 | 3300005336 | Bacteria | 2302 |
| 29 | Ga0070682_100003286 | 3300005337 | Bacteria | 8968 |
| 30 | Ga0070682_100051417 | 3300005337 | Bacteria | 2575 |
| 31 | Ga0070682_100105957 | 3300005337 | Bacteria | 1865 |
| 32 | Ga0068868_100000991 | 3300005338 | Bacteria | 19363 |
| 33 | Ga0068868_100001388 | 3300005338 | Bacteria | 16720 |
| 34 | Ga0068868_100026812 | 3300005338 | Bacteria | 4394 |
| 35 | Ga0068868_100059864 | 3300005338 | Bacteria | 3013 |
| 36 | Ga0068868_100082544 | 3300005338 | Bacteria | 2578 |
| 37 | Ga0068868_100217838 | 3300005338 | Bacteria | 1597 |
| 38 | Ga0070660_100006387 | 3300005339 | Bacteria | 8170 |
| 39 | Ga0070660_100038052 | 3300005339 | Bacteria | 3650 |
| 40 | Ga0070660_100342498 | 3300005339 | Bacteria | 1230 |
| 41 | Ga0070689_100001082 | 3300005340 | Bacteria | 17081 |
| 42 | Ga0070689_100058095 | 3300005340 | Bacteria | 3004 |
| 43 | Ga0070691_10075503 | 3300005341 | Unclassified | 1642 |
| 44 | Ga0070687_100006182 | 3300005343 | Bacteria | 4894 |
| 45 | Ga0070661_100009183 | 3300005344 | Bacteria | 6835 |
| 46 | Ga0070661_100009221 | 3300005344 | Bacteria | 6822 |
| 47 | Ga0070661_100013353 | 3300005344 | Bacteria | 5765 |
| 48 | Ga0070661_100354113 | 3300005344 | Bacteria | 1152 |
| 49 | Ga0070661_100385656 | 3300005344 | Bacteria | 1105 |
| 50 | Ga0070692_10097853 | 3300005345 | Bacteria | 1604 |
| 51 | Ga0070692_10182399 | 3300005345 | Unclassified | 1217 |
| 52 | Ga0070668_100004887 | 3300005347 | Bacteria | 9936 |
| 53 | Ga0070669_100001365 | 3300005353 | Bacteria | 17595 |
| 54 | Ga0070669_100136207 | 3300005353 | Bacteria | 1889 |
| 55 | Ga0070675_100167505 | 3300005354 | Unclassified | 1893 |
| 56 | Ga0070675_100274711 | 3300005354 | Bacteria | 1479 |
| 57 | Ga0070671_100153160 | 3300005355 | Bacteria | 1947 |
| 58 | Ga0070673_100009008 | 3300005364 | Bacteria | 6679 |
| 59 | Ga0070673_100209855 | 3300005364 | Bacteria | 1681 |
| 60 | Ga0070673_100334647 | 3300005364 | Bacteria | 1340 |
| 61 | Ga0070688_100000289 | 3300005365 | Bacteria | 25802 |
| 62 | Ga0070659_100002441 | 3300005366 | Bacteria | 13204 |
| 63 | Ga0070659_100017607 | 3300005366 | Bacteria | 5381 |
| 64 | Ga0070659_100102405 | 3300005366 | Bacteria | 2305 |
| 65 | Ga0070667_100060743 | 3300005367 | Bacteria | 3198 |
| 66 | Ga0070667_100160758 | 3300005367 | Unclassified | 1978 |
| 67 | Ga0070667_100338983 | 3300005367 | Unclassified | 1359 |
| 68 | Ga0070709_10002030 | 3300005434 | Bacteria | 10997 |
| 69 | Ga0070709_10079424 | 3300005434 | Bacteria | 2137 |
| 70 | Ga0070709_10180861 | 3300005434 | Unclassified | 1480 |
| 71 | Ga0070709_10189359 | 3300005434 | Bacteria | 1450 |
| 72 | Ga0070709_10243746 | 3300005434 | Unclassified | 1292 |
| 73 | Ga0070714_100001155 | 3300005435 | Bacteria | 19000 |
| 74 | Ga0070714_100002082 | 3300005435 | Bacteria | 14656 |
| 75 | Ga0070714_100007533 | 3300005435 | Bacteria | 8471 |
| 76 | Ga0070714_100068882 | 3300005435 | Unclassified | 3054 |
| 77 | Ga0070714_100070692 | 3300005435 | Bacteria | 3017 |
| 78 | Ga0070714_100140930 | 3300005435 | Bacteria | 2164 |
| 79 | Ga0070714_100151946 | 3300005435 | Bacteria | 2087 |
| 80 | Ga0070714_100215517 | 3300005435 | Unclassified | 1762 |
| 81 | Ga0070713_100000222 | 3300005436 | Bacteria | 37755 |
| 82 | Ga0070713_100001170 | 3300005436 | Bacteria | 16769 |
| 83 | Ga0070713_100003074 | 3300005436 | Bacteria | 10971 |
| 84 | Ga0070713_100008216 | 3300005436 | Bacteria | 7395 |
| 85 | Ga0070713_100013181 | 3300005436 | Bacteria | 6095 |
| 86 | Ga0070713_100036869 | 3300005436 | Bacteria | 3949 |
| 87 | Ga0070713_100053651 | 3300005436 | Bacteria | 3341 |
| 88 | Ga0070713_100068656 | 3300005436 | Bacteria | 2987 |
| 89 | Ga0070713_100086410 | 3300005436 | Unclassified | 2689 |
| 90 | Ga0070713_100115254 | 3300005436 | Unclassified | 2348 |
| 91 | Ga0070713_100128906 | 3300005436 | Bacteria | 2228 |
| 92 | Ga0070713_100252448 | 3300005436 | Bacteria | 1609 |
| 93 | Ga0070710_10064456 | 3300005437 | Bacteria | 2096 |
| 94 | Ga0070710_10115611 | 3300005437 | Unclassified | 1617 |
| 95 | Ga0070710_10160200 | 3300005437 | Bacteria | 1395 |
| 96 | Ga0070711_100003515 | 3300005439 | Bacteria | 9145 |
| 97 | Ga0070711_100006478 | 3300005439 | Bacteria | 7061 |
| 98 | Ga0070711_100008083 | 3300005439 | Bacteria | 6427 |
| 99 | Ga0070711_100046532 | 3300005439 | Bacteria | 2957 |
| 100 | Ga0070711_100290878 | 3300005439 | Unclassified | 1296 |
| 101 | Ga0070711_100555484 | 3300005439 | Bacteria | 953 |
| 102 | Ga0070708_100000263 | 3300005445 | Bacteria | 39351 |
| 103 | Ga0070708_100002193 | 3300005445 | Bacteria | 15093 |
| 104 | Ga0070708_100003924 | 3300005445 | Bacteria | 11681 |
| 105 | Ga0070708_100022080 | 3300005445 | Bacteria | 5394 |
| 106 | Ga0070708_100054662 | 3300005445 | Unclassified | 3547 |
| 107 | Ga0070708_100061202 | 3300005445 | Bacteria | 3363 |
| 108 | Ga0070708_100073804 | 3300005445 | Bacteria | 3076 |
| 109 | Ga0070708_100087773 | 3300005445 | Bacteria | 2827 |
| 110 | Ga0070708_100102864 | 3300005445 | Bacteria | 2618 |
| 111 | Ga0070708_100143700 | 3300005445 | Unclassified | 2214 |
| 112 | Ga0070708_100246442 | 3300005445 | Unclassified | 1678 |
| 113 | Ga0070708_100260683 | 3300005445 | Bacteria | 1629 |
| 114 | Ga0070663_100023409 | 3300005455 | Bacteria | 4140 |
| 115 | Ga0070663_100028694 | 3300005455 | Bacteria | 3792 |
| 116 | Ga0070678_100002783 | 3300005456 | Bacteria | 9666 |
| 117 | Ga0070678_100023075 | 3300005456 | Bacteria | 4139 |
| 118 | Ga0070662_100002426 | 3300005457 | Bacteria | 11463 |
| 119 | Ga0070662_100007363 | 3300005457 | Bacteria | 7131 |
| 120 | Ga0070662_100064072 | 3300005457 | Bacteria | 2690 |
| 121 | Ga0070681_10000091 | 3300005458 | Bacteria | 67429 |
| 122 | Ga0070681_10032433 | 3300005458 | Bacteria | 5242 |
| 123 | Ga0070681_10370703 | 3300005458 | Bacteria | 1342 |
| 124 | Ga0070681_10465894 | 3300005458 | Bacteria | 1176 |
| 125 | Ga0068867_100000749 | 3300005459 | Bacteria | 21787 |
| 126 | Ga0068867_100017844 | 3300005459 | Bacteria | 5040 |
| 127 | Ga0068867_100197187 | 3300005459 | Bacteria | 1610 |
| 128 | Ga0070685_10001601 | 3300005466 | Bacteria | 11932 |
| 129 | Ga0070706_100000869 | 3300005467 | Bacteria | 33228 |
| 130 | Ga0070706_100001289 | 3300005467 | Bacteria | 26742 |
| 131 | Ga0070706_100010747 | 3300005467 | Bacteria | 8495 |
| 132 | Ga0070706_100011557 | 3300005467 | Bacteria | 8202 |
| 133 | Ga0070706_100042587 | 3300005467 | Bacteria | 4195 |
| 134 | Ga0070706_100129894 | 3300005467 | Unclassified | 2351 |
| 135 | Ga0070706_100276923 | 3300005467 | Bacteria | 1566 |
| 136 | Ga0070706_100364583 | 3300005467 | Bacteria | 1346 |
| 137 | Ga0070707_100000557 | 3300005468 | Bacteria | 37459 |
| 138 | Ga0070707_100010726 | 3300005468 | Bacteria | 8534 |
| 139 | Ga0070707_100128409 | 3300005468 | Bacteria | 2464 |
| 140 | Ga0070707_100139063 | 3300005468 | Bacteria | 2363 |
| 141 | Ga0070707_100175140 | 3300005468 | Bacteria | 2091 |
| 142 | Ga0070707_100378333 | 3300005468 | Unclassified | 1376 |
| 143 | Ga0070707_100786964 | 3300005468 | Bacteria | 915 |
| 144 | Ga0070698_100000456 | 3300005471 | Bacteria | 43335 |
| 145 | Ga0070698_100001775 | 3300005471 | Bacteria | 24031 |
| 146 | Ga0070698_100226784 | 3300005471 | Bacteria | 1801 |
| 147 | Ga0070698_100401925 | 3300005471 | Bacteria | 1303 |
| 148 | Ga0070699_100000340 | 3300005518 | Bacteria | 45329 |
| 149 | Ga0070699_100001799 | 3300005518 | Bacteria | 19484 |
| 150 | Ga0070699_100011106 | 3300005518 | Bacteria | 7785 |
| 151 | Ga0070699_100044872 | 3300005518 | Bacteria | 3827 |
| 152 | Ga0070699_100068714 | 3300005518 | Bacteria | 3078 |
| 153 | Ga0070699_100488840 | 3300005518 | Unclassified | 1117 |
| 154 | Ga0070699_100509746 | 3300005518 | Unclassified | 1093 |
| 155 | Ga0070679_100007789 | 3300005530 | Bacteria | 10037 |
| 156 | Ga0070679_100114065 | 3300005530 | Bacteria | 2687 |
| 157 | Ga0070679_100207479 | 3300005530 | Bacteria | 1924 |
| 158 | Ga0070679_100252336 | 3300005530 | Bacteria | 1720 |
| 159 | Ga0070679_100351292 | 3300005530 | Unclassified | 1422 |
| 160 | Ga0070679_100353088 | 3300005530 | Bacteria | 1418 |
| 161 | Ga0070684_100001382 | 3300005535 | Bacteria | 17441 |
| 162 | Ga0070684_100007536 | 3300005535 | Bacteria | 8472 |
| 163 | Ga0070684_100042554 | 3300005535 | Bacteria | 3922 |
| 164 | Ga0070684_100043347 | 3300005535 | Bacteria | 3885 |
| 165 | Ga0070697_100000496 | 3300005536 | Bacteria | 29902 |
| 166 | Ga0070697_100000770 | 3300005536 | Bacteria | 23986 |
| 167 | Ga0070697_100001425 | 3300005536 | Bacteria | 18173 |
| 168 | Ga0070697_100003073 | 3300005536 | Bacteria | 12803 |
| 169 | Ga0070697_100012017 | 3300005536 | Bacteria | 6777 |
| 170 | Ga0070697_100045210 | 3300005536 | Bacteria | 3568 |
| 171 | Ga0070697_100133441 | 3300005536 | Unclassified | 2084 |
| 172 | Ga0070697_100210408 | 3300005536 | Bacteria | 1655 |
| 173 | Ga0070697_100298592 | 3300005536 | Bacteria | 1384 |
| 174 | Ga0068853_100004992 | 3300005539 | Bacteria | 10340 |
| 175 | Ga0068853_100028987 | 3300005539 | Unclassified | 4661 |
| 176 | Ga0068853_100054550 | 3300005539 | Bacteria | 3445 |
| 177 | Ga0068853_100318746 | 3300005539 | Bacteria | 1441 |
| 178 | Ga0070672_100002640 | 3300005543 | Bacteria | 11462 |
| 179 | Ga0070672_100239366 | 3300005543 | Bacteria | 1526 |
| 180 | Ga0070686_100002027 | 3300005544 | Bacteria | 11243 |
| 181 | Ga0070696_100094516 | 3300005546 | Bacteria | 2133 |
| 182 | Ga0070696_100206286 | 3300005546 | Bacteria | 1469 |
| 183 | Ga0070693_100024209 | 3300005547 | Bacteria | 3253 |
| 184 | Ga0070693_100394450 | 3300005547 | Bacteria | 958 |
| 185 | Ga0068855_100004016 | 3300005563 | Bacteria | 17972 |
| 186 | Ga0068855_100023553 | 3300005563 | Bacteria | 7372 |
| 187 | Ga0068855_100056359 | 3300005563 | Bacteria | 4612 |
| 188 | Ga0068855_100058865 | 3300005563 | Bacteria | 4497 |
| 189 | Ga0068855_100121688 | 3300005563 | Unclassified | 2987 |
| 190 | Ga0068855_100164357 | 3300005563 | Bacteria | 2517 |
| 191 | Ga0068855_100298188 | 3300005563 | Bacteria | 1786 |
| 192 | Ga0070664_100000782 | 3300005564 | Bacteria | 24526 |
| 193 | Ga0070664_100006830 | 3300005564 | Bacteria | 9204 |
| 194 | Ga0070664_100104985 | 3300005564 | Bacteria | 2460 |
| 195 | Ga0070664_100402222 | 3300005564 | Bacteria | 1252 |
| 196 | Ga0068857_100000994 | 3300005577 | Bacteria | 21786 |
| 197 | Ga0068857_100002750 | 3300005577 | Bacteria | 14452 |
| 198 | Ga0068857_100020575 | 3300005577 | Bacteria | 5806 |
| 199 | Ga0068857_100044015 | 3300005577 | Bacteria | 3959 |
| 200 | Ga0068857_100083866 | 3300005577 | Bacteria | 2848 |
| 201 | Ga0068857_100119691 | 3300005577 | Bacteria | 2370 |
| 202 | Ga0068857_100269395 | 3300005577 | Unclassified | 1565 |
| 203 | Ga0068854_100005734 | 3300005578 | Bacteria | 7852 |
| 204 | Ga0068854_100022513 | 3300005578 | Bacteria | 4295 |
| 205 | Ga0068854_100048663 | 3300005578 | Bacteria | 3025 |
| 206 | Ga0068854_100102988 | 3300005578 | Bacteria | 2142 |
| 207 | Ga0068854_100132729 | 3300005578 | Bacteria | 1903 |
| 208 | Ga0068854_100335920 | 3300005578 | Unclassified | 1232 |
| 209 | Ga0068856_100000107 | 3300005614 | Bacteria | 81707 |
| 210 | Ga0068856_100000900 | 3300005614 | Bacteria | 31839 |
| 211 | Ga0068856_100005519 | 3300005614 | Bacteria | 12457 |
| 212 | Ga0068856_100015999 | 3300005614 | Bacteria | 7251 |
| 213 | Ga0068856_100016530 | 3300005614 | Bacteria | 7141 |
| 214 | Ga0068856_100018327 | 3300005614 | Bacteria | 6786 |
| 215 | Ga0068856_100085984 | 3300005614 | Bacteria | 3124 |
| 216 | Ga0068856_100113969 | 3300005614 | Bacteria | 2702 |
| 217 | Ga0070702_100006493 | 3300005615 | Bacteria | 5541 |
| 218 | Ga0068852_100005202 | 3300005616 | Bacteria | 9279 |
| 219 | Ga0068852_100015752 | 3300005616 | Bacteria | 5877 |
| 220 | Ga0068852_100032958 | 3300005616 | Bacteria | 4296 |
| 221 | Ga0068859_100000573 | 3300005617 | Bacteria | 36716 |
| 222 | Ga0068859_100015671 | 3300005617 | Bacteria | 7617 |
| 223 | Ga0068859_100032315 | 3300005617 | Bacteria | 5257 |
| 224 | Ga0068859_100054585 | 3300005617 | Bacteria | 4019 |
| 225 | Ga0068864_100003555 | 3300005618 | Bacteria | 12884 |
| 226 | Ga0068864_100003567 | 3300005618 | Bacteria | 12861 |
| 227 | Ga0068864_100088024 | 3300005618 | Bacteria | 2735 |
| 228 | Ga0068864_100160380 | 3300005618 | Bacteria | 2044 |
| 229 | Ga0068866_10001464 | 3300005718 | Bacteria | 10084 |
| 230 | Ga0068866_10011000 | 3300005718 | Bacteria | 3897 |
| 231 | Ga0068866_10038699 | 3300005718 | Unclassified | 2350 |
| 232 | Ga0068861_100002752 | 3300005719 | Bacteria | 11529 |
| 233 | Ga0068851_10018270 | 3300005834 | Bacteria | 3377 |
| 234 | Ga0068851_10082837 | 3300005834 | Bacteria | 1678 |
| 235 | Ga0068851_10129774 | 3300005834 | Unclassified | 1362 |
| 236 | Ga0068870_10000606 | 3300005840 | Bacteria | 13652 |
| 237 | Ga0068863_100010061 | 3300005841 | Bacteria | 9204 |
| 238 | Ga0068863_100021802 | 3300005841 | Bacteria | 6114 |
| 239 | Ga0068863_100057211 | 3300005841 | Unclassified | 3691 |
| 240 | Ga0068863_100167105 | 3300005841 | Bacteria | 2110 |
| 241 | Ga0068863_100337974 | 3300005841 | Bacteria | 1465 |
| 242 | Ga0068863_100424874 | 3300005841 | Bacteria | 1302 |
| 243 | Ga0068863_100468282 | 3300005841 | Bacteria | 1238 |
| 244 | Ga0068858_100000597 | 3300005842 | Bacteria | 37673 |
| 245 | Ga0068858_100009222 | 3300005842 | Bacteria | 9421 |
| 246 | Ga0068858_100032751 | 3300005842 | Bacteria | 4827 |
| 247 | Ga0068858_100039198 | 3300005842 | Bacteria | 4394 |
| 248 | Ga0068858_100062713 | 3300005842 | Bacteria | 3437 |
| 249 | Ga0068858_100257833 | 3300005842 | Bacteria | 1657 |
| 250 | Ga0068860_100020205 | 3300005843 | Bacteria | 6455 |
| 251 | Ga0068860_100047365 | 3300005843 | Unclassified | 4098 |
| 252 | Ga0068860_100054771 | 3300005843 | Bacteria | 3791 |
| 253 | Ga0068860_100055729 | 3300005843 | Bacteria | 3758 |
| 254 | Ga0068860_100142719 | 3300005843 | Bacteria | 2303 |
| 255 | Ga0068862_100012134 | 3300005844 | Bacteria | 7121 |
| 256 | Ga0068862_100082071 | 3300005844 | Unclassified | 2797 |
| 257 | Ga0068862_100150397 | 3300005844 | Unclassified | 2072 |
| 258 | Ga0081455_10102597 | 3300005937 | Bacteria | 2293 |
| 259 | Ga0081540_1050975 | 3300005983 | Bacteria | 2050 |
| 260 | Ga0070717_10002245 | 3300006028 | Bacteria | 13546 |
| 261 | Ga0070717_10004396 | 3300006028 | Bacteria | 10172 |
| 262 | Ga0070717_10004694 | 3300006028 | Bacteria | 9925 |
| 263 | Ga0070717_10007223 | 3300006028 | Bacteria | 8240 |
| 264 | Ga0070717_10023317 | 3300006028 | Bacteria | 4902 |
| 265 | Ga0070717_10028895 | 3300006028 | Bacteria | 4443 |
| 266 | Ga0070717_10065542 | 3300006028 | Bacteria | 3020 |
| 267 | Ga0070717_10091269 | 3300006028 | Bacteria | 2572 |
| 268 | Ga0070717_10117094 | 3300006028 | Bacteria | 2278 |
| 269 | Ga0070717_10132277 | 3300006028 | Bacteria | 2146 |
| 270 | Ga0070717_10210346 | 3300006028 | Bacteria | 1707 |
| 271 | Ga0070717_10243636 | 3300006028 | Bacteria | 1586 |
| 272 | Ga0070717_10271666 | 3300006028 | Unclassified | 1502 |
| 273 | Ga0070717_10316548 | 3300006028 | Bacteria | 1390 |
| 274 | Ga0070715_10030332 | 3300006163 | Bacteria | 2185 |
| 275 | Ga0070716_100006587 | 3300006173 | Bacteria | 5677 |
| 276 | Ga0070716_100046064 | 3300006173 | Bacteria | 2452 |
| 277 | Ga0070716_100075005 | 3300006173 | Bacteria | 2000 |
| 278 | Ga0070716_100157069 | 3300006173 | Bacteria | 1470 |
| 279 | Ga0070716_100226974 | 3300006173 | Unclassified | 1258 |
| 280 | Ga0070712_100000056 | 3300006175 | Bacteria | 56756 |
| 281 | Ga0070712_100000321 | 3300006175 | Bacteria | 27066 |
| 282 | Ga0070712_100000550 | 3300006175 | Bacteria | 21698 |
| 283 | Ga0070712_100000969 | 3300006175 | Bacteria | 17281 |
| 284 | Ga0070712_100006585 | 3300006175 | Bacteria | 7215 |
| 285 | Ga0070712_100012730 | 3300006175 | Bacteria | 5355 |
| 286 | Ga0070712_100059359 | 3300006175 | Bacteria | 2694 |
| 287 | Ga0070712_100093546 | 3300006175 | Bacteria | 2207 |
| 288 | Ga0070712_100124608 | 3300006175 | Bacteria | 1944 |
| 289 | Ga0097621_100007807 | 3300006237 | Bacteria | 7677 |
| 290 | Ga0097621_100013116 | 3300006237 | Bacteria | 6164 |
| 291 | Ga0097621_100022304 | 3300006237 | Unclassified | 4913 |
| 292 | Ga0097621_100038974 | 3300006237 | Bacteria | 3815 |
| 293 | Ga0097621_100223983 | 3300006237 | Bacteria | 1640 |
| 294 | Ga0097621_100374458 | 3300006237 | Bacteria | 1271 |
| 295 | Ga0097621_100378294 | 3300006237 | Bacteria | 1264 |
| 296 | Ga0068871_100000231 | 3300006358 | Bacteria | 39603 |
| 297 | Ga0068871_100000801 | 3300006358 | Bacteria | 21126 |
| 298 | Ga0068871_100023652 | 3300006358 | Bacteria | 4756 |
| 299 | Ga0068871_100030754 | 3300006358 | Bacteria | 4231 |
| 300 | Ga0068871_100047582 | 3300006358 | Bacteria | 3459 |
| 301 | Ga0068871_100061868 | 3300006358 | Bacteria | 3059 |
| 302 | Ga0075433_10080428 | 3300006852 | Unclassified | 2873 |
| 303 | Ga0075434_100000416 | 3300006871 | Bacteria | 31534 |
| 304 | Ga0075434_100002666 | 3300006871 | Bacteria | 15766 |
| 305 | Ga0075434_100075214 | 3300006871 | Bacteria | 3371 |
| 306 | Ga0075434_100375302 | 3300006871 | Bacteria | 1443 |
| 307 | Ga0075434_100437324 | 3300006871 | Bacteria | 1329 |
| 308 | Ga0068865_100011689 | 3300006881 | Bacteria | 5500 |
| 309 | Ga0068865_100024800 | 3300006881 | Bacteria | 3939 |
| 310 | Ga0068865_100223208 | 3300006881 | Bacteria | 1474 |
| 311 | Ga0075436_100000451 | 3300006914 | Bacteria | 26434 |
| 312 | Ga0075436_100006264 | 3300006914 | Bacteria | 8150 |
| 313 | Ga0075436_100061734 | 3300006914 | Bacteria | 2590 |
| 314 | Ga0075436_100063044 | 3300006914 | Unclassified | 2562 |
| 315 | Ga0097620_100000573 | 3300006931 | Bacteria | 36716 |
| 316 | Ga0097620_100015671 | 3300006931 | Bacteria | 7617 |
| 317 | Ga0097620_100032313 | 3300006931 | Bacteria | 5257 |
| 318 | Ga0097620_100054586 | 3300006931 | Bacteria | 4019 |
| 319 | Ga0075435_100018943 | 3300007076 | Bacteria | 5246 |
| 320 | Ga0075435_100098623 | 3300007076 | Unclassified | 2419 |
| 321 | Ga0075435_100317973 | 3300007076 | Bacteria | 1332 |
| 322 | Ga0105251_10106009 | 3300009011 | Bacteria | 1283 |
| 323 | Ga0105240_10010408 | 3300009093 | Bacteria | 13071 |
| 324 | Ga0105240_10022299 | 3300009093 | Bacteria | 8399 |
| 325 | Ga0105240_10067816 | 3300009093 | Bacteria | 4421 |
| 326 | Ga0105240_10067976 | 3300009093 | Bacteria | 4415 |
| 327 | Ga0105240_10108380 | 3300009093 | Bacteria | 3365 |
| 328 | Ga0105240_10207523 | 3300009093 | Bacteria | 2292 |
| 329 | Ga0105240_10217910 | 3300009093 | Unclassified | 2225 |
| 330 | Ga0105240_10255755 | 3300009093 | Bacteria | 2023 |
| 331 | Ga0105240_10364637 | 3300009093 | Bacteria | 1635 |
| 332 | Ga0105240_10589274 | 3300009093 | Unclassified | 1225 |
| 333 | Ga0105240_10783170 | 3300009093 | Bacteria | 1034 |
| 334 | Ga0105245_10002797 | 3300009098 | Bacteria | 15694 |
| 335 | Ga0105245_10068422 | 3300009098 | Bacteria | 3217 |
| 336 | Ga0105245_10132404 | 3300009098 | Bacteria | 2340 |
| 337 | Ga0105245_10321209 | 3300009098 | Bacteria | 1525 |
| 338 | Ga0105247_10001769 | 3300009101 | Bacteria | 15200 |
| 339 | Ga0105247_10013079 | 3300009101 | Bacteria | 4977 |
| 340 | Ga0105247_10078385 | 3300009101 | Unclassified | 2078 |
| 341 | Ga0105247_10121480 | 3300009101 | Bacteria | 1693 |
| 342 | Ga0114129_10308529 | 3300009147 | Bacteria | 2107 |
| 343 | Ga0114129_10483618 | 3300009147 | Bacteria | 1619 |
| 344 | Ga0105243_10122132 | 3300009148 | Unclassified | 2198 |
| 345 | Ga0105241_10006514 | 3300009174 | Bacteria | 8607 |
| 346 | Ga0105241_10011553 | 3300009174 | Bacteria | 6474 |
| 347 | Ga0105241_10011918 | 3300009174 | Bacteria | 6387 |
| 348 | Ga0105241_10015255 | 3300009174 | Bacteria | 5626 |
| 349 | Ga0105241_10091233 | 3300009174 | Unclassified | 2403 |
| 350 | Ga0105241_10151018 | 3300009174 | Bacteria | 1900 |
| 351 | Ga0105241_10187045 | 3300009174 | Bacteria | 1722 |
| 352 | Ga0105241_10258223 | 3300009174 | Bacteria | 1480 |
| 353 | Ga0105242_10005432 | 3300009176 | Bacteria | 9856 |
| 354 | Ga0105242_10071023 | 3300009176 | Bacteria | 2888 |
| 355 | Ga0105242_10098205 | 3300009176 | Unclassified | 2477 |
| 356 | Ga0105242_10116161 | 3300009176 | Bacteria | 2289 |
| 357 | Ga0105248_10006081 | 3300009177 | Bacteria | 13248 |
| 358 | Ga0105248_10033583 | 3300009177 | Bacteria | 5732 |
| 359 | Ga0105248_10068327 | 3300009177 | Bacteria | 3990 |
| 360 | Ga0105248_10102641 | 3300009177 | Bacteria | 3223 |
| 361 | Ga0105248_10390370 | 3300009177 | Bacteria | 1567 |
| 362 | Ga0105248_10793638 | 3300009177 | Bacteria | 1069 |
| 363 | Ga0105237_10020363 | 3300009545 | Bacteria | 6841 |
| 364 | Ga0105237_10027226 | 3300009545 | Bacteria | 5838 |
| 365 | Ga0105237_10114417 | 3300009545 | Bacteria | 2690 |
| 366 | Ga0105237_10201447 | 3300009545 | Bacteria | 1991 |
| 367 | Ga0105237_10238445 | 3300009545 | Bacteria | 1820 |
| 368 | Ga0105238_10022710 | 3300009551 | Bacteria | 6394 |
| 369 | Ga0105238_10023137 | 3300009551 | Bacteria | 6336 |
| 370 | Ga0105238_10089695 | 3300009551 | Bacteria | 3062 |
| 371 | Ga0105238_10134056 | 3300009551 | Bacteria | 2455 |
| 372 | Ga0105238_10140412 | 3300009551 | Bacteria | 2393 |
| 373 | Ga0105238_10155261 | 3300009551 | Bacteria | 2264 |
| 374 | Ga0105238_10240384 | 3300009551 | Bacteria | 1788 |
| 375 | Ga0105249_10004117 | 3300009553 | Bacteria | 12556 |
| 376 | Ga0105249_10032008 | 3300009553 | Bacteria | 4757 |
| 377 | Ga0099796_10071648 | 3300010159 | Unclassified | 1252 |
| 378 | Ga0105239_10004431 | 3300010375 | Bacteria | 16792 |
| 379 | Ga0105239_10014150 | 3300010375 | Bacteria | 8852 |
| 380 | Ga0105239_10033827 | 3300010375 | Bacteria | 5611 |
| 381 | Ga0105239_10073681 | 3300010375 | Bacteria | 3753 |
| 382 | Ga0105239_10135233 | 3300010375 | Bacteria | 2744 |
| 383 | Ga0105239_10576771 | 3300010375 | Unclassified | 1282 |
| 384 | Ga0105239_10623364 | 3300010375 | Bacteria | 1231 |
| 385 | Ga0105246_10002416 | 3300011119 | Bacteria | 11268 |
| 386 | Ga0105246_10037404 | 3300011119 | Unclassified | 3258 |
| 387 | Ga0105246_10137306 | 3300011119 | Bacteria | 1834 |
| 388 | Ga0157373_10001041 | 3300013100 | Bacteria | 21375 |
| 389 | Ga0157373_10036749 | 3300013100 | Bacteria | 3513 |
| 390 | Ga0157373_10071872 | 3300013100 | Bacteria | 2443 |
| 391 | Ga0157373_10123708 | 3300013100 | Unclassified | 1819 |
| 392 | Ga0157373_10145969 | 3300013100 | Bacteria | 1664 |
| 393 | Ga0157371_10005311 | 3300013102 | Bacteria | 10903 |
| 394 | Ga0157371_10011857 | 3300013102 | Bacteria | 6690 |
| 395 | Ga0157371_10027814 | 3300013102 | Bacteria | 4098 |
| 396 | Ga0157370_10077936 | 3300013104 | Unclassified | 3121 |
| 397 | Ga0157370_10104957 | 3300013104 | Bacteria | 2645 |
| 398 | Ga0157370_10129021 | 3300013104 | Bacteria | 2359 |
| 399 | Ga0157370_10158132 | 3300013104 | Unclassified | 2108 |
| 400 | Ga0157370_10180456 | 3300013104 | Unclassified | 1962 |
| 401 | Ga0157370_10347078 | 3300013104 | Bacteria | 1368 |
| 402 | Ga0157369_10001478 | 3300013105 | Bacteria | 28808 |
| 403 | Ga0157369_10008130 | 3300013105 | Bacteria | 12028 |
| 404 | Ga0157369_10042110 | 3300013105 | Bacteria | 4982 |
| 405 | Ga0157369_10042263 | 3300013105 | Bacteria | 4973 |
| 406 | Ga0157369_10047069 | 3300013105 | Bacteria | 4685 |
| 407 | Ga0157369_10053909 | 3300013105 | Bacteria | 4343 |
| 408 | Ga0157369_10082514 | 3300013105 | Bacteria | 3439 |
| 409 | Ga0157369_10101196 | 3300013105 | Bacteria | 3071 |
| 410 | Ga0157369_10111785 | 3300013105 | Bacteria | 2903 |
| 411 | Ga0157369_10602100 | 3300013105 | Bacteria | 1134 |
| 412 | Ga0157374_10000567 | 3300013296 | Bacteria | 32753 |
| 413 | Ga0157374_10001092 | 3300013296 | Bacteria | 23356 |
| 414 | Ga0157374_10002984 | 3300013296 | Bacteria | 14164 |
| 415 | Ga0157374_10008704 | 3300013296 | Bacteria | 8680 |
| 416 | Ga0157374_10043895 | 3300013296 | Bacteria | 4130 |
| 417 | Ga0157374_10111210 | 3300013296 | Bacteria | 2635 |
| 418 | Ga0157374_10125363 | 3300013296 | Bacteria | 2482 |
| 419 | Ga0157374_10154667 | 3300013296 | Bacteria | 2231 |
| 420 | Ga0157378_10000104 | 3300013297 | Bacteria | 80068 |
| 421 | Ga0157378_10000151 | 3300013297 | Bacteria | 65215 |
| 422 | Ga0157378_10000686 | 3300013297 | Bacteria | 31832 |
| 423 | Ga0157378_10040368 | 3300013297 | Bacteria | 4138 |
| 424 | Ga0157378_10067348 | 3300013297 | Bacteria | 3208 |
| 425 | Ga0157378_10128829 | 3300013297 | Bacteria | 2340 |
| 426 | Ga0157378_10262763 | 3300013297 | Bacteria | 1657 |
| 427 | Ga0163162_10002065 | 3300013306 | Bacteria | 18873 |
| 428 | Ga0163162_10019988 | 3300013306 | Bacteria | 6577 |
| 429 | Ga0163162_10179078 | 3300013306 | Bacteria | 2246 |
| 430 | Ga0163162_10425636 | 3300013306 | Bacteria | 1460 |
| 431 | Ga0163162_10623645 | 3300013306 | Bacteria | 1203 |
| 432 | Ga0163162_10674784 | 3300013306 | Unclassified | 1156 |
| 433 | Ga0157372_10000242 | 3300013307 | Bacteria | 60460 |
| 434 | Ga0157372_10001206 | 3300013307 | Bacteria | 27941 |
| 435 | Ga0157372_10021173 | 3300013307 | Bacteria | 7024 |
| 436 | Ga0157372_10028555 | 3300013307 | Bacteria | 6089 |
| 437 | Ga0157372_10033716 | 3300013307 | Bacteria | 5626 |
| 438 | Ga0157372_10048057 | 3300013307 | Unclassified | 4743 |
| 439 | Ga0157372_10071446 | 3300013307 | Bacteria | 3908 |
| 440 | Ga0157372_10207642 | 3300013307 | Bacteria | 2269 |
| 441 | Ga0157372_10410757 | 3300013307 | Unclassified | 1577 |
| 442 | Ga0157372_10517586 | 3300013307 | Bacteria | 1391 |
| 443 | Ga0157372_10679332 | 3300013307 | Bacteria | 1198 |
| 444 | Ga0157375_10214888 | 3300013308 | Unclassified | 2081 |
| 445 | Ga0157375_10275025 | 3300013308 | Unclassified | 1846 |
| 446 | Ga0163163_10000958 | 3300014325 | Bacteria | 24503 |
| 447 | Ga0163163_10038041 | 3300014325 | Bacteria | 4685 |
| 448 | Ga0163163_10123035 | 3300014325 | Bacteria | 2629 |
| 449 | Ga0163163_10186870 | 3300014325 | Bacteria | 2120 |
| 450 | Ga0163163_10213891 | 3300014325 | Unclassified | 1977 |
| 451 | Ga0163163_10229886 | 3300014325 | Unclassified | 1904 |
| 452 | Ga0182008_10006892 | 3300014497 | Bacteria | 6315 |
| 453 | Ga0157377_10000467 | 3300014745 | Bacteria | 17434 |
| 454 | Ga0157377_10086543 | 3300014745 | Bacteria | 1842 |
| 455 | Ga0157379_10015074 | 3300014968 | Bacteria | 6780 |
| 456 | Ga0157379_10016233 | 3300014968 | Bacteria | 6552 |
| 457 | Ga0157379_10037518 | 3300014968 | Bacteria | 4322 |
| 458 | Ga0157379_10460502 | 3300014968 | Bacteria | 1175 |
| 459 | Ga0157376_10006340 | 3300014969 | Bacteria | 8355 |
| 460 | Ga0157376_10040819 | 3300014969 | Bacteria | 3795 |
| 461 | Ga0157376_10236564 | 3300014969 | Bacteria | 1699 |
| 462 | Ga0182006_1018783 | 3300015261 | Bacteria | 2916 |
| 463 | Ga0182007_10021918 | 3300015262 | Bacteria | 2262 |
| 464 | Ga0182005_1009501 | 3300015265 | Bacteria | 2829 |
| 465 | Ga0213873_10020417 | 3300021358 | Bacteria | 1547 |
| 466 | Ga0213874_10004832 | 3300021377 | Bacteria | 3108 |
| 467 | Ga0213874_10008783 | 3300021377 | Unclassified | 2475 |
| 468 | Ga0224569_100235 | 3300022732 | Bacteria | 4574 |
| 469 | Ga0224572_1020124 | 3300024225 | Unclassified | 1282 |
| 470 | Ga0228598_1000123 | 3300024227 | Bacteria | 13117 |
| 471 | Ga0228598_1012618 | 3300024227 | Bacteria | 1678 |
| 472 | Ga0207697_10002916 | 3300025315 | Bacteria | 8654 |
| 473 | Ga0207656_10044557 | 3300025321 | Bacteria | 1895 |
| 474 | Ga0207682_10003786 | 3300025893 | Bacteria | 6496 |
| 475 | Ga0207692_10005206 | 3300025898 | Bacteria | 5192 |
| 476 | Ga0207692_10102007 | 3300025898 | Bacteria | 1577 |
| 477 | Ga0207692_10121944 | 3300025898 | Bacteria | 1461 |
| 478 | Ga0207642_10027052 | 3300025899 | Bacteria | 2343 |
| 479 | Ga0207642_10031016 | 3300025899 | Bacteria | 2235 |
| 480 | Ga0207642_10078826 | 3300025899 | Bacteria | 1593 |
| 481 | Ga0207710_10003898 | 3300025900 | Bacteria | 6589 |
| 482 | Ga0207710_10124601 | 3300025900 | Bacteria | 1233 |
| 483 | Ga0207688_10000372 | 3300025901 | Bacteria | 20907 |
| 484 | Ga0207680_10013123 | 3300025903 | Bacteria | 4245 |
| 485 | Ga0207680_10041482 | 3300025903 | Bacteria | 2685 |
| 486 | Ga0207647_10007186 | 3300025904 | Bacteria | 8069 |
| 487 | Ga0207647_10025887 | 3300025904 | Bacteria | 3846 |
| 488 | Ga0207699_10002709 | 3300025906 | Bacteria | 8378 |
| 489 | Ga0207699_10027886 | 3300025906 | Bacteria | 3132 |
| 490 | Ga0207699_10051162 | 3300025906 | Bacteria | 2440 |
| 491 | Ga0207699_10293990 | 3300025906 | Bacteria | 1132 |
| 492 | Ga0207645_10000051 | 3300025907 | Bacteria | 84255 |
| 493 | Ga0207645_10022895 | 3300025907 | Bacteria | 4060 |
| 494 | Ga0207643_10000079 | 3300025908 | Bacteria | 63366 |
| 495 | Ga0207705_10030843 | 3300025909 | Unclassified | 3826 |
| 496 | Ga0207684_10000311 | 3300025910 | Bacteria | 69074 |
| 497 | Ga0207684_10001754 | 3300025910 | Bacteria | 22933 |
| 498 | Ga0207684_10013315 | 3300025910 | Bacteria | 7115 |
| 499 | Ga0207684_10016755 | 3300025910 | Bacteria | 6292 |
| 500 | Ga0207654_10004043 | 3300025911 | Bacteria | 7383 |
| 501 | Ga0207654_10009332 | 3300025911 | Bacteria | 4980 |
| 502 | Ga0207654_10014943 | 3300025911 | Bacteria | 4019 |
| 503 | Ga0207654_10023432 | 3300025911 | Bacteria | 3307 |
| 504 | Ga0207707_10000127 | 3300025912 | Bacteria | 78669 |
| 505 | Ga0207707_10013860 | 3300025912 | Bacteria | 7030 |
| 506 | Ga0207707_10053101 | 3300025912 | Bacteria | 3527 |
| 507 | Ga0207707_10074436 | 3300025912 | Bacteria | 2962 |
| 508 | Ga0207695_10011737 | 3300025913 | Bacteria | 10580 |
| 509 | Ga0207695_10028217 | 3300025913 | Bacteria | 6230 |
| 510 | Ga0207695_10034398 | 3300025913 | Bacteria | 5512 |
| 511 | Ga0207695_10092563 | 3300025913 | Bacteria | 3033 |
| 512 | Ga0207695_10170732 | 3300025913 | Bacteria | 2100 |
| 513 | Ga0207671_10036278 | 3300025914 | Bacteria | 3656 |
| 514 | Ga0207671_10052188 | 3300025914 | Bacteria | 3030 |
| 515 | Ga0207671_10247140 | 3300025914 | Unclassified | 1402 |
| 516 | Ga0207671_10261186 | 3300025914 | Unclassified | 1363 |
| 517 | Ga0207693_10000119 | 3300025915 | Bacteria | 69804 |
| 518 | Ga0207693_10000362 | 3300025915 | Bacteria | 41574 |
| 519 | Ga0207693_10000457 | 3300025915 | Bacteria | 37236 |
| 520 | Ga0207693_10002950 | 3300025915 | Bacteria | 14728 |
| 521 | Ga0207693_10004359 | 3300025915 | Bacteria | 11968 |
| 522 | Ga0207693_10016269 | 3300025915 | Bacteria | 5947 |
| 523 | Ga0207693_10026570 | 3300025915 | Bacteria | 4580 |
| 524 | Ga0207693_10029207 | 3300025915 | Bacteria | 4357 |
| 525 | Ga0207693_10137434 | 3300025915 | Bacteria | 1922 |
| 526 | Ga0207663_10002106 | 3300025916 | Bacteria | 9481 |
| 527 | Ga0207663_10004317 | 3300025916 | Bacteria | 7055 |
| 528 | Ga0207663_10007244 | 3300025916 | Bacteria | 5742 |
| 529 | Ga0207663_10008816 | 3300025916 | Bacteria | 5301 |
| 530 | Ga0207663_10208298 | 3300025916 | Bacteria | 1415 |
| 531 | Ga0207663_10381026 | 3300025916 | Unclassified | 1074 |
| 532 | Ga0207660_10103759 | 3300025917 | Bacteria | 2128 |
| 533 | Ga0207662_10023390 | 3300025918 | Unclassified | 3550 |
| 534 | Ga0207657_10000246 | 3300025919 | Bacteria | 57698 |
| 535 | Ga0207657_10000292 | 3300025919 | Bacteria | 53366 |
| 536 | Ga0207657_10001266 | 3300025919 | Bacteria | 26953 |
| 537 | Ga0207657_10314117 | 3300025919 | Bacteria | 1240 |
| 538 | Ga0207649_10000242 | 3300025920 | Bacteria | 44166 |
| 539 | Ga0207649_10011296 | 3300025920 | Bacteria | 4921 |
| 540 | Ga0207652_10021090 | 3300025921 | Bacteria | 5375 |
| 541 | Ga0207652_10052352 | 3300025921 | Bacteria | 3503 |
| 542 | Ga0207652_10062363 | 3300025921 | Bacteria | 3221 |
| 543 | Ga0207652_10070448 | 3300025921 | Bacteria | 3037 |
| 544 | Ga0207652_10071878 | 3300025921 | Bacteria | 3007 |
| 545 | Ga0207652_10368458 | 3300025921 | Unclassified | 1297 |
| 546 | Ga0207646_10000565 | 3300025922 | Bacteria | 48737 |
| 547 | Ga0207646_10002216 | 3300025922 | Bacteria | 23136 |
| 548 | Ga0207646_10106702 | 3300025922 | Bacteria | 2512 |
| 549 | Ga0207646_10111939 | 3300025922 | Bacteria | 2450 |
| 550 | Ga0207646_10623807 | 3300025922 | Bacteria | 967 |
| 551 | Ga0207681_10046219 | 3300025923 | Bacteria | 2927 |
| 552 | Ga0207694_10001306 | 3300025924 | Bacteria | 21454 |
| 553 | Ga0207694_10137574 | 3300025924 | Bacteria | 1963 |
| 554 | Ga0207694_10140319 | 3300025924 | Bacteria | 1943 |
| 555 | Ga0207694_10154911 | 3300025924 | Bacteria | 1847 |
| 556 | Ga0207694_10558443 | 3300025924 | Unclassified | 961 |
| 557 | Ga0207650_10000090 | 3300025925 | Bacteria | 118973 |
| 558 | Ga0207650_10007969 | 3300025925 | Bacteria | 7222 |
| 559 | Ga0207659_10002035 | 3300025926 | Bacteria | 11997 |
| 560 | Ga0207687_10004238 | 3300025927 | Bacteria | 9587 |
| 561 | Ga0207687_10011229 | 3300025927 | Bacteria | 5850 |
| 562 | Ga0207687_10148099 | 3300025927 | Bacteria | 1788 |
| 563 | Ga0207687_10271631 | 3300025927 | Bacteria | 1356 |
| 564 | Ga0207687_10663359 | 3300025927 | Bacteria | 883 |
| 565 | Ga0207700_10000528 | 3300025928 | Bacteria | 22511 |
| 566 | Ga0207700_10002119 | 3300025928 | Bacteria | 11337 |
| 567 | Ga0207700_10003068 | 3300025928 | Bacteria | 9645 |
| 568 | Ga0207700_10008312 | 3300025928 | Bacteria | 6419 |
| 569 | Ga0207700_10030361 | 3300025928 | Unclassified | 3827 |
| 570 | Ga0207700_10052588 | 3300025928 | Bacteria | 3046 |
| 571 | Ga0207700_10057649 | 3300025928 | Bacteria | 2930 |
| 572 | Ga0207700_10092278 | 3300025928 | Bacteria | 2394 |
| 573 | Ga0207664_10000165 | 3300025929 | Bacteria | 53011 |
| 574 | Ga0207664_10004851 | 3300025929 | Bacteria | 9146 |
| 575 | Ga0207664_10081835 | 3300025929 | Bacteria | 2629 |
| 576 | Ga0207664_10170502 | 3300025929 | Bacteria | 1862 |
| 577 | Ga0207664_10251504 | 3300025929 | Bacteria | 1542 |
| 578 | Ga0207664_10455318 | 3300025929 | Unclassified | 1142 |
| 579 | Ga0207644_10002582 | 3300025931 | Bacteria | 11652 |
| 580 | Ga0207644_10599867 | 3300025931 | Bacteria | 914 |
| 581 | Ga0207690_10003087 | 3300025932 | Bacteria | 10034 |
| 582 | Ga0207690_10010651 | 3300025932 | Bacteria | 5478 |
| 583 | Ga0207690_10203468 | 3300025932 | Unclassified | 1505 |
| 584 | Ga0207706_10000139 | 3300025933 | Bacteria | 79096 |
| 585 | Ga0207706_10000640 | 3300025933 | Bacteria | 37158 |
| 586 | Ga0207706_10079906 | 3300025933 | Bacteria | 2876 |
| 587 | Ga0207686_10035211 | 3300025934 | Bacteria | 3003 |
| 588 | Ga0207686_10089477 | 3300025934 | Bacteria | 2029 |
| 589 | Ga0207686_10090666 | 3300025934 | Unclassified | 2017 |
| 590 | Ga0207709_10171480 | 3300025935 | Unclassified | 1523 |
| 591 | Ga0207670_10001693 | 3300025936 | Bacteria | 11493 |
| 592 | Ga0207704_10012294 | 3300025938 | Bacteria | 4247 |
| 593 | Ga0207704_10223177 | 3300025938 | Bacteria | 1396 |
| 594 | Ga0207704_10447185 | 3300025938 | Bacteria | 1030 |
| 595 | Ga0207665_10002897 | 3300025939 | Bacteria | 11511 |
| 596 | Ga0207665_10024039 | 3300025939 | Bacteria | 4015 |
| 597 | Ga0207665_10028063 | 3300025939 | Bacteria | 3718 |
| 598 | Ga0207665_10070289 | 3300025939 | Archaea | 2388 |
| 599 | Ga0207665_10257129 | 3300025939 | Bacteria | 1292 |
| 600 | Ga0207665_10307124 | 3300025939 | Bacteria | 1187 |
| 601 | Ga0207691_10001343 | 3300025940 | Bacteria | 24540 |
| 602 | Ga0207711_10002838 | 3300025941 | Bacteria | 15224 |
| 603 | Ga0207711_10011787 | 3300025941 | Bacteria | 7263 |
| 604 | Ga0207689_10000304 | 3300025942 | Bacteria | 45071 |
| 605 | Ga0207689_10001053 | 3300025942 | Bacteria | 26527 |
| 606 | Ga0207689_10039634 | 3300025942 | Bacteria | 3900 |
| 607 | Ga0207661_10000583 | 3300025944 | Bacteria | 23334 |
| 608 | Ga0207661_10023933 | 3300025944 | Bacteria | 4621 |
| 609 | Ga0207661_10185193 | 3300025944 | Unclassified | 1821 |
| 610 | Ga0207661_10440149 | 3300025944 | Bacteria | 1186 |
| 611 | Ga0207679_10000184 | 3300025945 | Bacteria | 51157 |
| 612 | Ga0207679_10005367 | 3300025945 | Bacteria | 8036 |
| 613 | Ga0207679_10027166 | 3300025945 | Bacteria | 3955 |
| 614 | Ga0207679_10040898 | 3300025945 | Bacteria | 3321 |
| 615 | Ga0207667_10004029 | 3300025949 | Bacteria | 18047 |
| 616 | Ga0207667_10020400 | 3300025949 | Bacteria | 7371 |
| 617 | Ga0207667_10071649 | 3300025949 | Bacteria | 3603 |
| 618 | Ga0207667_10103960 | 3300025949 | Bacteria | 2929 |
| 619 | Ga0207667_10107244 | 3300025949 | Bacteria | 2881 |
| 620 | Ga0207667_10311841 | 3300025949 | Bacteria | 1607 |
| 621 | Ga0207667_10528456 | 3300025949 | Unclassified | 1195 |
| 622 | Ga0207651_10002456 | 3300025960 | Bacteria | 8859 |
| 623 | Ga0207651_10107201 | 3300025960 | Bacteria | 2088 |
| 624 | Ga0207651_10281777 | 3300025960 | Bacteria | 1374 |
| 625 | Ga0207712_10023786 | 3300025961 | Bacteria | 4048 |
| 626 | Ga0207712_10024542 | 3300025961 | Bacteria | 3995 |
| 627 | Ga0207712_10119906 | 3300025961 | Bacteria | 1988 |
| 628 | Ga0207640_10015374 | 3300025981 | Bacteria | 4429 |
| 629 | Ga0207640_10036120 | 3300025981 | Bacteria | 3099 |
| 630 | Ga0207640_10036188 | 3300025981 | Bacteria | 3097 |
| 631 | Ga0207640_10078421 | 3300025981 | Unclassified | 2248 |
| 632 | Ga0207658_10001983 | 3300025986 | Bacteria | 15269 |
| 633 | Ga0207658_10041406 | 3300025986 | Bacteria | 3335 |
| 634 | Ga0207677_10005049 | 3300026023 | Bacteria | 7132 |
| 635 | Ga0207677_10006393 | 3300026023 | Bacteria | 6462 |
| 636 | Ga0207677_10057478 | 3300026023 | Bacteria | 2671 |
| 637 | Ga0207677_10459496 | 3300026023 | Unclassified | 1093 |
| 638 | Ga0207703_10001863 | 3300026035 | Bacteria | 18753 |
| 639 | Ga0207703_10005260 | 3300026035 | Bacteria | 10438 |
| 640 | Ga0207703_10012716 | 3300026035 | Bacteria | 6562 |
| 641 | Ga0207703_10034192 | 3300026035 | Bacteria | 4033 |
| 642 | Ga0207703_10448356 | 3300026035 | Bacteria | 1205 |
| 643 | Ga0207639_10046457 | 3300026041 | Bacteria | 3276 |
| 644 | Ga0207639_10223963 | 3300026041 | Bacteria | 1626 |
| 645 | Ga0207678_10000204 | 3300026067 | Bacteria | 52306 |
| 646 | Ga0207678_10004676 | 3300026067 | Bacteria | 12295 |
| 647 | Ga0207702_10000704 | 3300026078 | Bacteria | 35989 |
| 648 | Ga0207702_10005927 | 3300026078 | Bacteria | 10617 |
| 649 | Ga0207702_10014881 | 3300026078 | Bacteria | 6453 |
| 650 | Ga0207702_10015530 | 3300026078 | Bacteria | 6303 |
| 651 | Ga0207702_10016745 | 3300026078 | Bacteria | 6067 |
| 652 | Ga0207702_10028337 | 3300026078 | Bacteria | 4655 |
| 653 | Ga0207702_10145508 | 3300026078 | Bacteria | 2150 |
| 654 | Ga0207702_10155741 | 3300026078 | Bacteria | 2083 |
| 655 | Ga0207702_10181513 | 3300026078 | Bacteria | 1938 |
| 656 | Ga0207641_10000894 | 3300026088 | Bacteria | 31042 |
| 657 | Ga0207641_10026028 | 3300026088 | Bacteria | 4827 |
| 658 | Ga0207641_10035294 | 3300026088 | Bacteria | 4165 |
| 659 | Ga0207641_10078652 | 3300026088 | Unclassified | 2857 |
| 660 | Ga0207641_10283961 | 3300026088 | Bacteria | 1558 |
| 661 | Ga0207648_10000757 | 3300026089 | Bacteria | 36296 |
| 662 | Ga0207648_10003612 | 3300026089 | Bacteria | 16172 |
| 663 | Ga0207648_10294286 | 3300026089 | Bacteria | 1454 |
| 664 | Ga0207648_10357029 | 3300026089 | Bacteria | 1318 |
| 665 | Ga0207676_10000113 | 3300026095 | Bacteria | 73022 |
| 666 | Ga0207676_10004935 | 3300026095 | Bacteria | 9456 |
| 667 | Ga0207676_10114539 | 3300026095 | Bacteria | 2262 |
| 668 | Ga0207674_10000076 | 3300026116 | Bacteria | 104404 |
| 669 | Ga0207674_10008255 | 3300026116 | Bacteria | 12057 |
| 670 | Ga0207674_10009505 | 3300026116 | Bacteria | 11102 |
| 671 | Ga0207674_10017787 | 3300026116 | Bacteria | 7749 |
| 672 | Ga0207674_10049003 | 3300026116 | Bacteria | 4322 |
| 673 | Ga0207675_100008819 | 3300026118 | Bacteria | 9464 |
| 674 | Ga0207675_100112550 | 3300026118 | Unclassified | 2569 |
| 675 | Ga0207675_100252047 | 3300026118 | Bacteria | 1709 |
| 676 | Ga0207683_10001129 | 3300026121 | Bacteria | 24286 |
| 677 | Ga0207683_10317610 | 3300026121 | Bacteria | 1426 |
| 678 | Ga0207698_10044147 | 3300026142 | Bacteria | 3346 |
| 679 | Ga0207698_10190368 | 3300026142 | Bacteria | 1827 |
| 680 | Ga0265356_1000298 | 3300028017 | Bacteria | 9271 |
| 681 | Ga0268266_10005373 | 3300028379 | Bacteria | 11969 |
| 682 | Ga0268265_10002144 | 3300028380 | Bacteria | 15280 |
| 683 | Ga0268265_10063459 | 3300028380 | Unclassified | 2842 |
| 684 | Ga0268265_10079197 | 3300028380 | Unclassified | 2587 |
| 685 | Ga0268264_10016388 | 3300028381 | Bacteria | 6066 |
| 686 | Ga0268264_10016978 | 3300028381 | Bacteria | 5960 |
| 687 | Ga0268264_10075570 | 3300028381 | Bacteria | 2865 |
| 688 | Ga0265338_10000750 | 3300028800 | Bacteria | 55295 |
| 689 | Ga0265338_10005847 | 3300028800 | Bacteria | 15876 |
| 690 | Ga0265338_10055749 | 3300028800 | Unclassified | 3513 |
| 691 | Ga0265338_10098810 | 3300028800 | Bacteria | 2386 |
| 692 | Ga0265338_10149453 | 3300028800 | Bacteria | 1817 |
| 693 | Ga0265762_1000030 | 3300030760 | Bacteria | 15999 |
| 694 | Ga0265762_1000238 | 3300030760 | Bacteria | 8907 |
| 695 | Ga0265760_10001710 | 3300031090 | Bacteria | 6454 |
| 696 | Ga0265760_10003216 | 3300031090 | Bacteria | 4783 |
| 697 | Ga0265760_10007818 | 3300031090 | Bacteria | 3054 |
| 698 | Ga0265332_10145196 | 3300031238 | Bacteria | 993 |
| 699 | Ga0265328_10022041 | 3300031239 | Bacteria | 2427 |
| 700 | Ga0265328_10056880 | 3300031239 | Unclassified | 1435 |
| 701 | Ga0265325_10032315 | 3300031241 | Bacteria | 2794 |
| 702 | Ga0265325_10072788 | 3300031241 | Bacteria | 1721 |
| 703 | Ga0265325_10081413 | 3300031241 | Bacteria | 1609 |
| 704 | Ga0265340_10008487 | 3300031247 | Bacteria | 5544 |
| 705 | Ga0265340_10015846 | 3300031247 | Bacteria | 3911 |
| 706 | Ga0265340_10024956 | 3300031247 | Unclassified | 3032 |
| 707 | Ga0265339_10004196 | 3300031249 | Bacteria | 9880 |
| 708 | Ga0265339_10014860 | 3300031249 | Bacteria | 4682 |
| 709 | Ga0265339_10034652 | 3300031249 | Bacteria | 2835 |
| 710 | Ga0265339_10096303 | 3300031249 | Bacteria | 1545 |
| 711 | Ga0265339_10141199 | 3300031249 | Unclassified | 1225 |
| 712 | Ga0265327_10032110 | 3300031251 | Bacteria | 2942 |
| 713 | Ga0265316_10010624 | 3300031344 | Bacteria | 8375 |
| 714 | Ga0265316_10010927 | 3300031344 | Bacteria | 8242 |
| 715 | Ga0265316_10014931 | 3300031344 | Bacteria | 6811 |
| 716 | Ga0265316_10086374 | 3300031344 | Unclassified | 2398 |
| 717 | Ga0265316_10298086 | 3300031344 | Bacteria | 1175 |
| 718 | Ga0265316_10348815 | 3300031344 | Bacteria | 1072 |
| 719 | Ga0307408_100009058 | 3300031548 | Bacteria | 6574 |
| 720 | Ga0265313_10035068 | 3300031595 | Bacteria | 2530 |
| 721 | Ga0265314_10031361 | 3300031711 | Bacteria | 3925 |
| 722 | Ga0265314_10079739 | 3300031711 | Bacteria | 2163 |
| 723 | Ga0265314_10123316 | 3300031711 | Unclassified | 1627 |
| 724 | Ga0265342_10057462 | 3300031712 | Unclassified | 2303 |
| 725 | Ga0307405_10026721 | 3300031731 | Bacteria | 3335 |
| 726 | Ga0307405_10060022 | 3300031731 | Bacteria | 2399 |
| 727 | Ga0307410_10007103 | 3300031852 | Bacteria | 6107 |
| 728 | Ga0307410_10108380 | 3300031852 | Bacteria | 2005 |
| 729 | Ga0307407_10057069 | 3300031903 | Unclassified | 2264 |
| 730 | Ga0307409_100001571 | 3300031995 | Bacteria | 11371 |
| 731 | Ga0307409_100060913 | 3300031995 | Bacteria | 2946 |
| 732 | Ga0307416_100043835 | 3300032002 | Bacteria | 3507 |
| 733 | Ga0307411_10023898 | 3300032005 | Bacteria | 3632 |
| 734 | Ga0307415_100002646 | 3300032126 | Bacteria | 8933 |
| 735 | Ga0316212_1005580 | 3300033547 | Bacteria | 1827 |
| 736 | Ga0373926_0028490 | 3300035083 | Archaea | 1960 |
| 737 | Ga0373926_0088761 | 3300035083 | Bacteria | 1148 |
| 738 | Ga0373928_0011668 | 3300035084 | Bacteria | 1744 |
| 739 | Ga0373934_0040916 | 3300035086 | Unclassified | 1829 |
| 740 | Ga0373949_0045606 | 3300035090 | Unclassified | 1090 |
| 741 | Ga0373936_0027518 | 3300035113 | Unclassified | 2230 |
| 742 | Ga0373945_0046101 | 3300035116 | Bacteria | 1590 |
| 743 | Ga0373943_0013463 | 3300035170 | Bacteria | 3695 |
| 744 | Ga0373943_0085500 | 3300035170 | Bacteria | 1625 |
| 745 | Ga0373946_0079993 | 3300035171 | Bacteria | 1429 |
| 746 | Ga0373931_0115290 | 3300035691 | Unclassified | 1529 |
| 747 | Ga0373935_0008799 | 3300035692 | Bacteria | 6046 |
| 748 | Ga0373935_0010017 | 3300035692 | Bacteria | 5679 |
| 749 | Ga0373935_0017021 | 3300035692 | Bacteria | 4404 |
| 750 | Ga0373935_0034720 | 3300035692 | Bacteria | 3145 |
| 751 | Ga0373927_0000234 | 3300035695 | Bacteria | 43438 |
| 752 | Ga0373927_0016852 | 3300035695 | Unclassified | 4818 |
| 753 | Ga0373927_0027365 | 3300035695 | Bacteria | 3723 |
| 754 | Ga0373927_0095825 | 3300035695 | Bacteria | 1929 |
| 755 | Ga0373927_0109457 | 3300035695 | Bacteria | 1800 |
| 756 | Ga0373927_0126907 | 3300035695 | Unclassified | 1666 |
| 757 | Ga0373927_0143288 | 3300035695 | Bacteria | 1564 |
| 758 | Ga0373933_0055424 | 3300035724 | Bacteria | 2378 |
| 759 | Ga0373947_0025855 | 3300035725 | Bacteria | 3425 |
| 760 | Ga0373947_0057018 | 3300035725 | Bacteria | 2362 |
| 761 | Ga0373947_0129275 | 3300035725 | Bacteria | 1611 |
| 762 | Ga0373947_0229671 | 3300035725 | Bacteria | 1222 |
| 763 | Ga0373937_0000596 | 3300036401 | Bacteria | 31987 |
| 764 | Ga0373937_0024205 | 3300036401 | Bacteria | 5473 |
| 765 | Ga0373937_0033409 | 3300036401 | Bacteria | 4672 |
| 766 | Ga0373937_0035986 | 3300036401 | Bacteria | 4510 |
| 767 | Ga0373937_0053014 | 3300036401 | Bacteria | 3720 |
| 768 | Ga0373937_0259428 | 3300036401 | Unclassified | 1639 |
| 769 | Ga0373925_0000227 | 3300037068 | Bacteria | 60089 |
| 770 | Ga0373925_0001086 | 3300037068 | Bacteria | 24439 |
| 771 | Ga0373925_0002762 | 3300037068 | Bacteria | 13893 |
| 772 | Ga0373925_0037329 | 3300037068 | Bacteria | 3587 |
| 773 | Ga0373925_0129281 | 3300037068 | Bacteria | 1968 |
| 774 | Ga0373925_0276718 | 3300037068 | Bacteria | 1351 |
| 775 | Ga0395898_0163122 | 3300037466 | Bacteria | 2132 |
| 776 | Ga0395898_0337093 | 3300037466 | Bacteria | 1438 |
| 777 | Ga0395905_0071991 | 3300037471 | Bacteria | 3241 |
| 778 | Ga0436365_0696718 | 3300039437 | Unclassified | 2177 |
| 779 | Ga0436360_0051252 | 3300039438 | Bacteria | 3043 |
| 780 | Ga0436363_0131185 | 3300039450 | Unclassified | 2496 |
| 781 | Ga0436363_0265047 | 3300039450 | Bacteria | 11625 |
| 782 | Ga0436363_1291424 | 3300039450 | Unclassified | 1559 |
| 783 | Ga0436362_0848211 | 3300039453 | Bacteria | 15307 |
| 784 | Ga0466963_0001890 | 3300044694 | Bacteria | 11437 |
| 785 | Ga0466964_0039615 | 3300044706 | Bacteria | 1900 |
| 786 | Ga0451576_0279170 | 3300045051 | Bacteria | 1747 |
| 787 | Ga0451576_0541994 | 3300045051 | Bacteria | 1222 |
| 788 | Ga0466958_0109890 | 3300045836 | Bacteria | 1721 |
| 789 | Ga0466967_0004535 | 3300045976 | Bacteria | 9396 |
| 790 | Ga0466967_0014796 | 3300045976 | Bacteria | 6095 |
| 791 | Ga0466967_0020702 | 3300045976 | Bacteria | 5325 |
| 792 | Ga0466967_0032045 | 3300045976 | Bacteria | 4434 |
| 793 | Ga0466967_0035164 | 3300045976 | Bacteria | 4261 |
| 794 | Ga0466967_0049777 | 3300045976 | Bacteria | 3667 |
| 795 | Ga0466967_0248782 | 3300045976 | Unclassified | 1697 |
| 796 | Ga0495653_0140819 | 3300046463 | Unclassified | 1697 |
| 797 | Ga0495580_0005751 | 3300046472 | Bacteria | 10184 |
| 798 | Ga0495580_0008637 | 3300046472 | Bacteria | 8080 |
| 799 | Ga0495580_0012343 | 3300046472 | Bacteria | 6555 |
| 800 | Ga0495580_0015718 | 3300046472 | Bacteria | 5703 |
| 801 | Ga0495580_0037477 | 3300046472 | Bacteria | 3480 |
| 802 | Ga0495580_0166087 | 3300046472 | Bacteria | 1527 |
| 803 | Ga0495580_0176228 | 3300046472 | Bacteria | 1477 |
| 804 | Ga0495580_0200031 | 3300046472 | Bacteria | 1377 |
| 805 | Ga0495580_0234470 | 3300046472 | Bacteria | 1259 |
| 806 | Ga0495580_0268783 | 3300046472 | Unclassified | 1165 |
| 807 | Ga0495582_0001766 | 3300046473 | Bacteria | 12202 |
| 808 | Ga0495582_0031347 | 3300046473 | Unclassified | 2922 |
| 809 | Ga0495582_0081946 | 3300046473 | Archaea | 1792 |
| 810 | Ga0495639_0056561 | 3300046475 | Bacteria | 1791 |
| 811 | Ga0495639_0075273 | 3300046475 | Bacteria | 1565 |
| 812 | Ga0495664_0061642 | 3300046477 | Bacteria | 2233 |
| 813 | Ga0495628_0018123 | 3300046516 | Bacteria | 5839 |
| 814 | Ga0495630_0156140 | 3300046517 | Bacteria | 1737 |
| 815 | Ga0495630_0208437 | 3300046517 | Unclassified | 1492 |
| 816 | Ga0495642_0176289 | 3300046528 | Unclassified | 930 |
| 817 | Ga0495665_0010815 | 3300046531 | Unclassified | 4938 |
| 818 | Ga0495665_0114191 | 3300046531 | Unclassified | 1415 |
| 819 | Ga0495635_0096577 | 3300046663 | Unclassified | 2020 |
| 820 | Ga0495635_0305274 | 3300046663 | Bacteria | 1067 |
| 821 | Ga0495657_0226724 | 3300046675 | Archaea | 1131 |
| 822 | Ga0495623_0024206 | 3300046679 | Bacteria | 3916 |
| 823 | Ga0495623_0034506 | 3300046679 | Bacteria | 3244 |
| 824 | Ga0495623_0083416 | 3300046679 | Unclassified | 1974 |
| 825 | Ga0495658_0054459 | 3300046683 | Unclassified | 2276 |
| 826 | Ga0495669_0085856 | 3300046684 | Bacteria | 1449 |
| 827 | Ga0495674_0033176 | 3300047319 | Bacteria | 4679 |
| 828 | Ga0495676_0144491 | 3300047321 | Unclassified | 1701 |
| 829 | Ga0495676_0157824 | 3300047321 | Bacteria | 1608 |
| 830 | Ga0495593_0142438 | 3300047673 | Bacteria | 1214 |
| 831 | Ga0495602_0055511 | 3300048088 | Bacteria | 3488 |
| 832 | Ga0495602_0135117 | 3300048088 | Bacteria | 1961 |
| 833 | Ga0495602_0269147 | 3300048088 | Bacteria | 1260 |
| 834 | Ga0495614_0041711 | 3300048089 | Archaea | 1969 |
| 835 | Ga0496100_0003857 | 3300048903 | Bacteria | 7862 |
| 836 | Ga0496100_0130159 | 3300048903 | Bacteria | 1772 |
| 837 | Ga0496100_0214169 | 3300048903 | Unclassified | 1411 |
| 838 | Ga0496101_0003461 | 3300048904 | Bacteria | 9848 |
| 839 | Ga0496101_0382047 | 3300048904 | Unclassified | 1108 |
| 840 | Ga0496102_0000537 | 3300048905 | Bacteria | 40994 |
| 841 | Ga0496102_0103108 | 3300048905 | Bacteria | 2653 |
| 842 | Ga0496102_0195843 | 3300048905 | Bacteria | 1904 |
| 843 | Ga0496102_0272738 | 3300048905 | Unclassified | 1595 |
| 844 | Ga0496103_0010438 | 3300048906 | Bacteria | 5496 |
| 845 | Ga0496103_0011600 | 3300048906 | Bacteria | 5225 |
| 846 | Ga0496103_0053924 | 3300048906 | Unclassified | 2492 |
| 847 | Ga0496104_0035988 | 3300048907 | Bacteria | 4625 |
| 848 | Ga0496104_0036653 | 3300048907 | Unclassified | 4585 |
| 849 | Ga0496104_0050923 | 3300048907 | Bacteria | 3907 |
| 850 | Ga0496104_0227846 | 3300048907 | Bacteria | 1776 |
| 851 | Ga0496104_0653712 | 3300048907 | Bacteria | 960 |
| 852 | Ga0496105_0031508 | 3300048908 | Unclassified | 4347 |
| 853 | Ga0496105_0110162 | 3300048908 | Bacteria | 2273 |
| 854 | Ga0496105_0139926 | 3300048908 | Bacteria | 1993 |
| 855 | Ga0496105_0249987 | 3300048908 | Unclassified | 1437 |
| 856 | Ga0496106_0062827 | 3300048909 | Unclassified | 2821 |
| 857 | Ga0496106_0097339 | 3300048909 | Unclassified | 2278 |
| 858 | Ga0496106_0113740 | 3300048909 | Bacteria | 2110 |
| 859 | Ga0496107_0052486 | 3300048910 | Bacteria | 2941 |
| 860 | Ga0496107_0140506 | 3300048910 | Unclassified | 1785 |
| 861 | Ga0496108_0002118 | 3300048911 | Bacteria | 15901 |
| 862 | Ga0496108_0035693 | 3300048911 | Bacteria | 4134 |
| 863 | Ga0496108_0094357 | 3300048911 | Unclassified | 2547 |
| 864 | Ga0496109_0000008 | 3300048912 | Bacteria | 245809 |
| 865 | Ga0496109_0039890 | 3300048912 | Bacteria | 4251 |
| 866 | Ga0496109_0184031 | 3300048912 | Bacteria | 1963 |
| 867 | Ga0496109_0195916 | 3300048912 | Bacteria | 1899 |
| 868 | Ga0496109_0209122 | 3300048912 | Unclassified | 1835 |
| 869 | Ga0496110_0051224 | 3300048913 | Bacteria | 3628 |
| 870 | Ga0496110_0094519 | 3300048913 | Bacteria | 2677 |
| 871 | Ga0496110_0129613 | 3300048913 | Bacteria | 2277 |
| 872 | Ga0496111_0014712 | 3300048914 | Bacteria | 5352 |
| 873 | Ga0496112_0000334 | 3300048915 | Bacteria | 30562 |
| 874 | Ga0496112_0001099 | 3300048915 | Bacteria | 20026 |
| 875 | Ga0496112_0005467 | 3300048915 | Bacteria | 10996 |
| 876 | Ga0496112_0013062 | 3300048915 | Bacteria | 7661 |
| 877 | Ga0496112_0037620 | 3300048915 | Bacteria | 4723 |
| 878 | Ga0496112_0041732 | 3300048915 | Bacteria | 4489 |
| 879 | Ga0496112_0050195 | 3300048915 | Bacteria | 4090 |
| 880 | Ga0496112_0082762 | 3300048915 | Bacteria | 3174 |
| 881 | Ga0496112_0141816 | 3300048915 | Unclassified | 2372 |
| 882 | Ga0496112_0328175 | 3300048915 | Unclassified | 1474 |
| 883 | Ga0496112_0433018 | 3300048915 | Bacteria | 1253 |
| 884 | Ga0496112_0445385 | 3300048915 | Unclassified | 1233 |
| 885 | Ga0496113_0000238 | 3300048916 | Bacteria | 25957 |
| 886 | Ga0496113_0005618 | 3300048916 | Bacteria | 7846 |
| 887 | Ga0496113_0113103 | 3300048916 | Bacteria | 2115 |
| 888 | Ga0496114_0028113 | 3300048917 | Bacteria | 4612 |
| 889 | Ga0496114_0126229 | 3300048917 | Bacteria | 2206 |
| 890 | Ga0496115_0004624 | 3300048918 | Bacteria | 9960 |
| 891 | Ga0496115_0016349 | 3300048918 | Bacteria | 5648 |
| 892 | Ga0496115_0070340 | 3300048918 | Bacteria | 2837 |
| 893 | Ga0501073_0038132 | 3300049589 | Unclassified | 3411 |
| 894 | Ga0501245_025829 | 3300049708 | Unclassified | 946 |
| 895 | Ga0501083_0255154 | 3300049744 | Bacteria | 1141 |
| 896 | nmdc:mga05p37_104900_c1 | 3300050507 | Bacteria | 3477 |
| 897 | nmdc:mga05p37_318014_c1 | 3300050507 | Unclassified | 1843 |
| 898 | nmdc:mga0n895_50045_c1 | 3300050512 | Bacteria | 4096 |
| 899 | nmdc:mga0n895_634_c1 | 3300050512 | Bacteria | 24414 |
| 900 | nmdc:mga0n895_85268_c1 | 3300050512 | Bacteria | 3153 |
| 901 | nmdc:mga0rr50_297315_c1 | 3300050513 | Unclassified | 1350 |
| 902 | nmdc:mga0rr50_34917_c1 | 3300050513 | Unclassified | 3606 |
| 903 | nmdc:mga0rr50_370252_c1 | 3300050513 | Unclassified | 1207 |
| 904 | nmdc:mga0rr50_66550_c1 | 3300050513 | Bacteria | 2734 |
| 905 | nmdc:mga0rr50_85082_c1 | 3300050513 | Unclassified | 2450 |
| 906 | nmdc:mga08x19_10856_c1 | 3300050514 | Bacteria | 5478 |
| 907 | nmdc:mga08x19_158610_c1 | 3300050514 | Unclassified | 1536 |
| 908 | nmdc:mga08x19_18527_c1 | 3300050514 | Unclassified | 4267 |
| 909 | nmdc:mga08x19_233356_c1 | 3300050514 | Bacteria | 1267 |
| 910 | nmdc:mga08x19_6888_c1 | 3300050514 | Bacteria | 6749 |
| 911 | nmdc:mga0a205_365708_c1 | 3300050515 | Bacteria | 1309 |
| 912 | Ga0495619_0071569 | 3300053085 | Unclassified | 2321 |
| 913 | Ga0501084_0199022 | 3300054114 | Bacteria | 1690 |
| 914 | Ga0587091_015504 | 3300059511 | Unclassified | 1259 |
| 915 | Ga0157375_10003505 | |||
| 916 | LJNas_1000849 | |||
| 917 | JGI24743J22301_10000093 | |||
| 918 | JGI24748J21848_1003187 | |||
| 919 | JGI24034J26672_10001180 | |||
| 920 | JGI24751J29686_10000635 | |||
| 921 | Ga0065712_10114404 | |||
| 922 | Ga0065712_10141661 | |||
| 923 | Ga0070658_10319675 | |||
| 924 | Ga0070676_10005283 | |||
| 925 | Ga0070676_10041193 | |||
| 926 | Ga0070683_100001910 | |||
| 927 | Ga0070683_100022151 | |||
| 928 | Ga0070683_100061135 | |||
| 929 | Ga0070683_100104700 | |||
| 930 | Ga0070690_100003363 | |||
| 931 | Ga0070690_100070525 | |||
| 932 | Ga0070670_100001939 | |||
| 933 | Ga0070670_100006041 | |||
| 934 | Ga0070670_100216357 | |||
| 935 | Ga0068869_100001662 | |||
| 936 | Ga0068869_100028706 | |||
| 937 | Ga0070666_10008180 | |||
| 938 | Ga0070666_10090596 | |||
| 939 | Ga0070680_100030773 | |||
| 940 | Ga0070680_100067974 | |||
| 941 | Ga0070680_100089406 | |||
| 942 | Ga0070680_100109169 | |||
| 943 | Ga0070682_100003286 | |||
| 944 | Ga0070682_100051417 | |||
| 945 | Ga0070682_100105957 | |||
| 946 | Ga0068868_100000991 | |||
| 947 | Ga0068868_100001388 | |||
| 948 | Ga0068868_100026812 | |||
| 949 | Ga0068868_100059864 | |||
| 950 | Ga0068868_100082544 | |||
| 951 | Ga0068868_100217838 | |||
| 952 | Ga0070660_100006387 | |||
| 953 | Ga0070660_100038052 | |||
| 954 | Ga0070660_100342498 | |||
| 955 | Ga0070689_100001082 | |||
| 956 | Ga0070689_100058095 | |||
| 957 | Ga0070691_10075503 | |||
| 958 | Ga0070687_100006182 | |||
| 959 | Ga0070661_100009183 | |||
| 960 | Ga0070661_100009221 | |||
| 961 | Ga0070661_100013353 | |||
| 962 | Ga0070661_100354113 | |||
| 963 | Ga0070661_100385656 | |||
| 964 | Ga0070692_10097853 | |||
| 965 | Ga0070692_10182399 | |||
| 966 | Ga0070668_100004887 | |||
| 967 | Ga0070669_100001365 | |||
| 968 | Ga0070669_100136207 | |||
| 969 | Ga0070675_100167505 | |||
| 970 | Ga0070675_100274711 | |||
| 971 | Ga0070671_100153160 | |||
| 972 | Ga0070673_100009008 | |||
| 973 | Ga0070673_100209855 | |||
| 974 | Ga0070673_100334647 | |||
| 975 | Ga0070688_100000289 | |||
| 976 | Ga0070659_100002441 | |||
| 977 | Ga0070659_100017607 | |||
| 978 | Ga0070659_100102405 | |||
| 979 | Ga0070667_100060743 | |||
| 980 | Ga0070667_100160758 | |||
| 981 | Ga0070667_100338983 | |||
| 982 | Ga0070709_10002030 | |||
| 983 | Ga0070709_10079424 | |||
| 984 | Ga0070709_10180861 | |||
| 985 | Ga0070709_10189359 | |||
| 986 | Ga0070709_10243746 | |||
| 987 | Ga0070714_100001155 | |||
| 988 | Ga0070714_100002082 | |||
| 989 | Ga0070714_100007533 | |||
| 990 | Ga0070714_100068882 | |||
| 991 | Ga0070714_100070692 | |||
| 992 | Ga0070714_100140930 | |||
| 993 | Ga0070714_100151946 | |||
| 994 | Ga0070714_100215517 | |||
| 995 | Ga0070713_100000222 | |||
| 996 | Ga0070713_100001170 | |||
| 997 | Ga0070713_100003074 | |||
| 998 | Ga0070713_100008216 | |||
| 999 | Ga0070713_100013181 | |||
| 1000 | Ga0070713_100036869 | |||
| 1001 | Ga0070713_100053651 | |||
| 1002 | Ga0070713_100068656 | |||
| 1003 | Ga0070713_100086410 | |||
| 1004 | Ga0070713_100115254 | |||
| 1005 | Ga0070713_100128906 | |||
| 1006 | Ga0070713_100252448 | |||
| 1007 | Ga0070710_10064456 | |||
| 1008 | Ga0070710_10115611 | |||
| 1009 | Ga0070710_10160200 | |||
| 1010 | Ga0070711_100003515 | |||
| 1011 | Ga0070711_100006478 | |||
| 1012 | Ga0070711_100008083 | |||
| 1013 | Ga0070711_100046532 | |||
| 1014 | Ga0070711_100290878 | |||
| 1015 | Ga0070711_100555484 | |||
| 1016 | Ga0070708_100000263 | |||
| 1017 | Ga0070708_100002193 | |||
| 1018 | Ga0070708_100003924 | |||
| 1019 | Ga0070708_100022080 | |||
| 1020 | Ga0070708_100054662 | |||
| 1021 | Ga0070708_100061202 | |||
| 1022 | Ga0070708_100073804 | |||
| 1023 | Ga0070708_100087773 | |||
| 1024 | Ga0070708_100102864 | |||
| 1025 | Ga0070708_100143700 | |||
| 1026 | Ga0070708_100246442 | |||
| 1027 | Ga0070708_100260683 | |||
| 1028 | Ga0070663_100023409 | |||
| 1029 | Ga0070663_100028694 | |||
| 1030 | Ga0070678_100002783 | |||
| 1031 | Ga0070678_100023075 | |||
| 1032 | Ga0070662_100002426 | |||
| 1033 | Ga0070662_100007363 | |||
| 1034 | Ga0070662_100064072 | |||
| 1035 | Ga0070681_10000091 | |||
| 1036 | Ga0070681_10032433 | |||
| 1037 | Ga0070681_10370703 | |||
| 1038 | Ga0070681_10465894 | |||
| 1039 | Ga0068867_100000749 | |||
| 1040 | Ga0068867_100017844 | |||
| 1041 | Ga0068867_100197187 | |||
| 1042 | Ga0070685_10001601 | |||
| 1043 | Ga0070706_100000869 | |||
| 1044 | Ga0070706_100001289 | |||
| 1045 | Ga0070706_100010747 | |||
| 1046 | Ga0070706_100011557 | |||
| 1047 | Ga0070706_100042587 | |||
| 1048 | Ga0070706_100129894 | |||
| 1049 | Ga0070706_100276923 | |||
| 1050 | Ga0070706_100364583 | |||
| 1051 | Ga0070707_100000557 | |||
| 1052 | Ga0070707_100010726 | |||
| 1053 | Ga0070707_100128409 | |||
| 1054 | Ga0070707_100139063 | |||
| 1055 | Ga0070707_100175140 | |||
| 1056 | Ga0070707_100378333 | |||
| 1057 | Ga0070707_100786964 | |||
| 1058 | Ga0070698_100000456 | |||
| 1059 | Ga0070698_100001775 | |||
| 1060 | Ga0070698_100226784 | |||
| 1061 | Ga0070698_100401925 | |||
| 1062 | Ga0070699_100000340 | |||
| 1063 | Ga0070699_100001799 | |||
| 1064 | Ga0070699_100011106 | |||
| 1065 | Ga0070699_100044872 | |||
| 1066 | Ga0070699_100068714 | |||
| 1067 | Ga0070699_100488840 | |||
| 1068 | Ga0070699_100509746 | |||
| 1069 | Ga0070679_100007789 | |||
| 1070 | Ga0070679_100114065 | |||
| 1071 | Ga0070679_100207479 | |||
| 1072 | Ga0070679_100252336 | |||
| 1073 | Ga0070679_100351292 | |||
| 1074 | Ga0070679_100353088 | |||
| 1075 | Ga0070684_100001382 | |||
| 1076 | Ga0070684_100007536 | |||
| 1077 | Ga0070684_100042554 | |||
| 1078 | Ga0070684_100043347 | |||
| 1079 | Ga0070697_100000496 | |||
| 1080 | Ga0070697_100000770 | |||
| 1081 | Ga0070697_100001425 | |||
| 1082 | Ga0070697_100003073 | |||
| 1083 | Ga0070697_100012017 | |||
| 1084 | Ga0070697_100045210 | |||
| 1085 | Ga0070697_100133441 | |||
| 1086 | Ga0070697_100210408 | |||
| 1087 | Ga0070697_100298592 | |||
| 1088 | Ga0068853_100004992 | |||
| 1089 | Ga0068853_100028987 | |||
| 1090 | Ga0068853_100054550 | |||
| 1091 | Ga0068853_100318746 | |||
| 1092 | Ga0070672_100002640 | |||
| 1093 | Ga0070672_100239366 | |||
| 1094 | Ga0070686_100002027 | |||
| 1095 | Ga0070696_100094516 | |||
| 1096 | Ga0070696_100206286 | |||
| 1097 | Ga0070693_100024209 | |||
| 1098 | Ga0070693_100394450 | |||
| 1099 | Ga0068855_100004016 | |||
| 1100 | Ga0068855_100023553 | |||
| 1101 | Ga0068855_100056359 | |||
| 1102 | Ga0068855_100058865 | |||
| 1103 | Ga0068855_100121688 | |||
| 1104 | Ga0068855_100164357 | |||
| 1105 | Ga0068855_100298188 | |||
| 1106 | Ga0070664_100000782 | |||
| 1107 | Ga0070664_100006830 | |||
| 1108 | Ga0070664_100104985 | |||
| 1109 | Ga0070664_100402222 | |||
| 1110 | Ga0068857_100000994 | |||
| 1111 | Ga0068857_100002750 | |||
| 1112 | Ga0068857_100020575 | |||
| 1113 | Ga0068857_100044015 | |||
| 1114 | Ga0068857_100083866 | |||
| 1115 | Ga0068857_100119691 | |||
| 1116 | Ga0068857_100269395 | |||
| 1117 | Ga0068854_100005734 | |||
| 1118 | Ga0068854_100022513 | |||
| 1119 | Ga0068854_100048663 | |||
| 1120 | Ga0068854_100102988 | |||
| 1121 | Ga0068854_100132729 | |||
| 1122 | Ga0068854_100335920 | |||
| 1123 | Ga0068856_100000107 | |||
| 1124 | Ga0068856_100000900 | |||
| 1125 | Ga0068856_100005519 | |||
| 1126 | Ga0068856_100015999 | |||
| 1127 | Ga0068856_100016530 | |||
| 1128 | Ga0068856_100018327 | |||
| 1129 | Ga0068856_100085984 | |||
| 1130 | Ga0068856_100113969 | |||
| 1131 | Ga0070702_100006493 | |||
| 1132 | Ga0068852_100005202 | |||
| 1133 | Ga0068852_100015752 | |||
| 1134 | Ga0068852_100032958 | |||
| 1135 | Ga0068859_100000573 | |||
| 1136 | Ga0068859_100015671 | |||
| 1137 | Ga0068859_100032315 | |||
| 1138 | Ga0068859_100054585 | |||
| 1139 | Ga0068864_100003555 | |||
| 1140 | Ga0068864_100003567 | |||
| 1141 | Ga0068864_100088024 | |||
| 1142 | Ga0068864_100160380 | |||
| 1143 | Ga0068866_10001464 | |||
| 1144 | Ga0068866_10011000 | |||
| 1145 | Ga0068866_10038699 | |||
| 1146 | Ga0068861_100002752 | |||
| 1147 | Ga0068851_10018270 | |||
| 1148 | Ga0068851_10082837 | |||
| 1149 | Ga0068851_10129774 | |||
| 1150 | Ga0068870_10000606 | |||
| 1151 | Ga0068863_100010061 | |||
| 1152 | Ga0068863_100021802 | |||
| 1153 | Ga0068863_100057211 | |||
| 1154 | Ga0068863_100167105 | |||
| 1155 | Ga0068863_100337974 | |||
| 1156 | Ga0068863_100424874 | |||
| 1157 | Ga0068863_100468282 | |||
| 1158 | Ga0068858_100000597 | |||
| 1159 | Ga0068858_100009222 | |||
| 1160 | Ga0068858_100032751 | |||
| 1161 | Ga0068858_100039198 | |||
| 1162 | Ga0068858_100062713 | |||
| 1163 | Ga0068858_100257833 | |||
| 1164 | Ga0068860_100020205 | |||
| 1165 | Ga0068860_100047365 | |||
| 1166 | Ga0068860_100054771 | |||
| 1167 | Ga0068860_100055729 | |||
| 1168 | Ga0068860_100142719 | |||
| 1169 | Ga0068862_100012134 | |||
| 1170 | Ga0068862_100082071 | |||
| 1171 | Ga0068862_100150397 | |||
| 1172 | Ga0081455_10102597 | |||
| 1173 | Ga0081540_1050975 | |||
| 1174 | Ga0070717_10002245 | |||
| 1175 | Ga0070717_10004396 | |||
| 1176 | Ga0070717_10004694 | |||
| 1177 | Ga0070717_10007223 | |||
| 1178 | Ga0070717_10023317 | |||
| 1179 | Ga0070717_10028895 | |||
| 1180 | Ga0070717_10065542 | |||
| 1181 | Ga0070717_10091269 | |||
| 1182 | Ga0070717_10117094 | |||
| 1183 | Ga0070717_10132277 | |||
| 1184 | Ga0070717_10210346 | |||
| 1185 | Ga0070717_10243636 | |||
| 1186 | Ga0070717_10271666 | |||
| 1187 | Ga0070717_10316548 | |||
| 1188 | Ga0070715_10030332 | |||
| 1189 | Ga0070716_100006587 | |||
| 1190 | Ga0070716_100046064 | |||
| 1191 | Ga0070716_100075005 | |||
| 1192 | Ga0070716_100157069 | |||
| 1193 | Ga0070716_100226974 | |||
| 1194 | Ga0070712_100000056 | |||
| 1195 | Ga0070712_100000321 | |||
| 1196 | Ga0070712_100000550 | |||
| 1197 | Ga0070712_100000969 | |||
| 1198 | Ga0070712_100006585 | |||
| 1199 | Ga0070712_100012730 | |||
| 1200 | Ga0070712_100059359 | |||
| 1201 | Ga0070712_100093546 | |||
| 1202 | Ga0070712_100124608 | |||
| 1203 | Ga0097621_100007807 | |||
| 1204 | Ga0097621_100013116 | |||
| 1205 | Ga0097621_100022304 | |||
| 1206 | Ga0097621_100038974 | |||
| 1207 | Ga0097621_100223983 | |||
| 1208 | Ga0097621_100374458 | |||
| 1209 | Ga0097621_100378294 | |||
| 1210 | Ga0068871_100000231 | |||
| 1211 | Ga0068871_100000801 | |||
| 1212 | Ga0068871_100023652 | |||
| 1213 | Ga0068871_100030754 | |||
| 1214 | Ga0068871_100047582 | |||
| 1215 | Ga0068871_100061868 | |||
| 1216 | Ga0075433_10080428 | |||
| 1217 | Ga0075434_100000416 | |||
| 1218 | Ga0075434_100002666 | |||
| 1219 | Ga0075434_100075214 | |||
| 1220 | Ga0075434_100375302 | |||
| 1221 | Ga0075434_100437324 | |||
| 1222 | Ga0068865_100011689 | |||
| 1223 | Ga0068865_100024800 | |||
| 1224 | Ga0068865_100223208 | |||
| 1225 | Ga0075436_100000451 | |||
| 1226 | Ga0075436_100006264 | |||
| 1227 | Ga0075436_100061734 | |||
| 1228 | Ga0075436_100063044 | |||
| 1229 | Ga0097620_100000573 | |||
| 1230 | Ga0097620_100015671 | |||
| 1231 | Ga0097620_100032313 | |||
| 1232 | Ga0097620_100054586 | |||
| 1233 | Ga0075435_100018943 | |||
| 1234 | Ga0075435_100098623 | |||
| 1235 | Ga0075435_100317973 | |||
| 1236 | Ga0105251_10106009 | |||
| 1237 | Ga0105240_10010408 | |||
| 1238 | Ga0105240_10022299 | |||
| 1239 | Ga0105240_10067816 | |||
| 1240 | Ga0105240_10067976 | |||
| 1241 | Ga0105240_10108380 | |||
| 1242 | Ga0105240_10207523 | |||
| 1243 | Ga0105240_10217910 | |||
| 1244 | Ga0105240_10255755 | |||
| 1245 | Ga0105240_10364637 | |||
| 1246 | Ga0105240_10589274 | |||
| 1247 | Ga0105240_10783170 | |||
| 1248 | Ga0105245_10002797 | |||
| 1249 | Ga0105245_10068422 | |||
| 1250 | Ga0105245_10132404 | |||
| 1251 | Ga0105245_10321209 | |||
| 1252 | Ga0105247_10001769 | |||
| 1253 | Ga0105247_10013079 | |||
| 1254 | Ga0105247_10078385 | |||
| 1255 | Ga0105247_10121480 | |||
| 1256 | Ga0114129_10308529 | |||
| 1257 | Ga0114129_10483618 | |||
| 1258 | Ga0105243_10122132 | |||
| 1259 | Ga0105241_10006514 | |||
| 1260 | Ga0105241_10011553 | |||
| 1261 | Ga0105241_10011918 | |||
| 1262 | Ga0105241_10015255 | |||
| 1263 | Ga0105241_10091233 | |||
| 1264 | Ga0105241_10151018 | |||
| 1265 | Ga0105241_10187045 | |||
| 1266 | Ga0105241_10258223 | |||
| 1267 | Ga0105242_10005432 | |||
| 1268 | Ga0105242_10071023 | |||
| 1269 | Ga0105242_10098205 | |||
| 1270 | Ga0105242_10116161 | |||
| 1271 | Ga0105248_10006081 | |||
| 1272 | Ga0105248_10033583 | |||
| 1273 | Ga0105248_10068327 | |||
| 1274 | Ga0105248_10102641 | |||
| 1275 | Ga0105248_10390370 | |||
| 1276 | Ga0105248_10793638 | |||
| 1277 | Ga0105237_10020363 | |||
| 1278 | Ga0105237_10027226 | |||
| 1279 | Ga0105237_10114417 | |||
| 1280 | Ga0105237_10201447 | |||
| 1281 | Ga0105237_10238445 | |||
| 1282 | Ga0105238_10022710 | |||
| 1283 | Ga0105238_10023137 | |||
| 1284 | Ga0105238_10089695 | |||
| 1285 | Ga0105238_10134056 | |||
| 1286 | Ga0105238_10140412 | |||
| 1287 | Ga0105238_10155261 | |||
| 1288 | Ga0105238_10240384 | |||
| 1289 | Ga0105249_10004117 | |||
| 1290 | Ga0105249_10032008 | |||
| 1291 | Ga0099796_10071648 | |||
| 1292 | Ga0105239_10004431 | |||
| 1293 | Ga0105239_10014150 | |||
| 1294 | Ga0105239_10033827 | |||
| 1295 | Ga0105239_10073681 | |||
| 1296 | Ga0105239_10135233 | |||
| 1297 | Ga0105239_10576771 | |||
| 1298 | Ga0105239_10623364 | |||
| 1299 | Ga0105246_10002416 | |||
| 1300 | Ga0105246_10037404 | |||
| 1301 | Ga0105246_10137306 | |||
| 1302 | Ga0157373_10001041 | |||
| 1303 | Ga0157373_10036749 | |||
| 1304 | Ga0157373_10071872 | |||
| 1305 | Ga0157373_10123708 | |||
| 1306 | Ga0157373_10145969 | |||
| 1307 | Ga0157371_10005311 | |||
| 1308 | Ga0157371_10011857 | |||
| 1309 | Ga0157371_10027814 | |||
| 1310 | Ga0157370_10077936 | |||
| 1311 | Ga0157370_10104957 | |||
| 1312 | Ga0157370_10129021 | |||
| 1313 | Ga0157370_10158132 | |||
| 1314 | Ga0157370_10180456 | |||
| 1315 | Ga0157370_10347078 | |||
| 1316 | Ga0157369_10001478 | |||
| 1317 | Ga0157369_10008130 | |||
| 1318 | Ga0157369_10042110 | |||
| 1319 | Ga0157369_10042263 | |||
| 1320 | Ga0157369_10047069 | |||
| 1321 | Ga0157369_10053909 | |||
| 1322 | Ga0157369_10082514 | |||
| 1323 | Ga0157369_10101196 | |||
| 1324 | Ga0157369_10111785 | |||
| 1325 | Ga0157369_10602100 | |||
| 1326 | Ga0157374_10000567 | |||
| 1327 | Ga0157374_10001092 | |||
| 1328 | Ga0157374_10002984 | |||
| 1329 | Ga0157374_10008704 | |||
| 1330 | Ga0157374_10043895 | |||
| 1331 | Ga0157374_10111210 | |||
| 1332 | Ga0157374_10125363 | |||
| 1333 | Ga0157374_10154667 | |||
| 1334 | Ga0157378_10000104 | |||
| 1335 | Ga0157378_10000151 | |||
| 1336 | Ga0157378_10000686 | |||
| 1337 | Ga0157378_10040368 | |||
| 1338 | Ga0157378_10067348 | |||
| 1339 | Ga0157378_10128829 | |||
| 1340 | Ga0157378_10262763 | |||
| 1341 | Ga0163162_10002065 | |||
| 1342 | Ga0163162_10019988 | |||
| 1343 | Ga0163162_10179078 | |||
| 1344 | Ga0163162_10425636 | |||
| 1345 | Ga0163162_10623645 | |||
| 1346 | Ga0163162_10674784 | |||
| 1347 | Ga0157372_10000242 | |||
| 1348 | Ga0157372_10001206 | |||
| 1349 | Ga0157372_10021173 | |||
| 1350 | Ga0157372_10028555 | |||
| 1351 | Ga0157372_10033716 | |||
| 1352 | Ga0157372_10048057 | |||
| 1353 | Ga0157372_10071446 | |||
| 1354 | Ga0157372_10207642 | |||
| 1355 | Ga0157372_10410757 | |||
| 1356 | Ga0157372_10517586 | |||
| 1357 | Ga0157372_10679332 | |||
| 1358 | Ga0157375_10214888 | |||
| 1359 | Ga0157375_10275025 | |||
| 1360 | Ga0163163_10000958 | |||
| 1361 | Ga0163163_10038041 | |||
| 1362 | Ga0163163_10123035 | |||
| 1363 | Ga0163163_10186870 | |||
| 1364 | Ga0163163_10213891 | |||
| 1365 | Ga0163163_10229886 | |||
| 1366 | Ga0182008_10006892 | |||
| 1367 | Ga0157377_10000467 | |||
| 1368 | Ga0157377_10086543 | |||
| 1369 | Ga0157379_10015074 | |||
| 1370 | Ga0157379_10016233 | |||
| 1371 | Ga0157379_10037518 | |||
| 1372 | Ga0157379_10460502 | |||
| 1373 | Ga0157376_10006340 | |||
| 1374 | Ga0157376_10040819 | |||
| 1375 | Ga0157376_10236564 | |||
| 1376 | Ga0182006_1018783 | |||
| 1377 | Ga0182007_10021918 | |||
| 1378 | Ga0182005_1009501 | |||
| 1379 | Ga0213873_10020417 | |||
| 1380 | Ga0213874_10004832 | |||
| 1381 | Ga0213874_10008783 | |||
| 1382 | Ga0224569_100235 | |||
| 1383 | Ga0224572_1020124 | |||
| 1384 | Ga0228598_1000123 | |||
| 1385 | Ga0228598_1012618 | |||
| 1386 | Ga0207697_10002916 | |||
| 1387 | Ga0207656_10044557 | |||
| 1388 | Ga0207682_10003786 | |||
| 1389 | Ga0207692_10005206 | |||
| 1390 | Ga0207692_10102007 | |||
| 1391 | Ga0207692_10121944 | |||
| 1392 | Ga0207642_10027052 | |||
| 1393 | Ga0207642_10031016 | |||
| 1394 | Ga0207642_10078826 | |||
| 1395 | Ga0207710_10003898 | |||
| 1396 | Ga0207710_10124601 | |||
| 1397 | Ga0207688_10000372 | |||
| 1398 | Ga0207680_10013123 | |||
| 1399 | Ga0207680_10041482 | |||
| 1400 | Ga0207647_10007186 | |||
| 1401 | Ga0207647_10025887 | |||
| 1402 | Ga0207699_10002709 | |||
| 1403 | Ga0207699_10027886 | |||
| 1404 | Ga0207699_10051162 | |||
| 1405 | Ga0207699_10293990 | |||
| 1406 | Ga0207645_10000051 | |||
| 1407 | Ga0207645_10022895 | |||
| 1408 | Ga0207643_10000079 | |||
| 1409 | Ga0207705_10030843 | |||
| 1410 | Ga0207684_10000311 | |||
| 1411 | Ga0207684_10001754 | |||
| 1412 | Ga0207684_10013315 | |||
| 1413 | Ga0207684_10016755 | |||
| 1414 | Ga0207654_10004043 | |||
| 1415 | Ga0207654_10009332 | |||
| 1416 | Ga0207654_10014943 | |||
| 1417 | Ga0207654_10023432 | |||
| 1418 | Ga0207707_10000127 | |||
| 1419 | Ga0207707_10013860 | |||
| 1420 | Ga0207707_10053101 | |||
| 1421 | Ga0207707_10074436 | |||
| 1422 | Ga0207695_10011737 | |||
| 1423 | Ga0207695_10028217 | |||
| 1424 | Ga0207695_10034398 | |||
| 1425 | Ga0207695_10092563 | |||
| 1426 | Ga0207695_10170732 | |||
| 1427 | Ga0207671_10036278 | |||
| 1428 | Ga0207671_10052188 | |||
| 1429 | Ga0207671_10247140 | |||
| 1430 | Ga0207671_10261186 | |||
| 1431 | Ga0207693_10000119 | |||
| 1432 | Ga0207693_10000362 | |||
| 1433 | Ga0207693_10000457 | |||
| 1434 | Ga0207693_10002950 | |||
| 1435 | Ga0207693_10004359 | |||
| 1436 | Ga0207693_10016269 | |||
| 1437 | Ga0207693_10026570 | |||
| 1438 | Ga0207693_10029207 | |||
| 1439 | Ga0207693_10137434 | |||
| 1440 | Ga0207663_10002106 | |||
| 1441 | Ga0207663_10004317 | |||
| 1442 | Ga0207663_10007244 | |||
| 1443 | Ga0207663_10008816 | |||
| 1444 | Ga0207663_10208298 | |||
| 1445 | Ga0207663_10381026 | |||
| 1446 | Ga0207660_10103759 | |||
| 1447 | Ga0207662_10023390 | |||
| 1448 | Ga0207657_10000246 | |||
| 1449 | Ga0207657_10000292 | |||
| 1450 | Ga0207657_10001266 | |||
| 1451 | Ga0207657_10314117 | |||
| 1452 | Ga0207649_10000242 | |||
| 1453 | Ga0207649_10011296 | |||
| 1454 | Ga0207652_10021090 | |||
| 1455 | Ga0207652_10052352 | |||
| 1456 | Ga0207652_10062363 | |||
| 1457 | Ga0207652_10070448 | |||
| 1458 | Ga0207652_10071878 | |||
| 1459 | Ga0207652_10368458 | |||
| 1460 | Ga0207646_10000565 | |||
| 1461 | Ga0207646_10002216 | |||
| 1462 | Ga0207646_10106702 | |||
| 1463 | Ga0207646_10111939 | |||
| 1464 | Ga0207646_10623807 | |||
| 1465 | Ga0207681_10046219 | |||
| 1466 | Ga0207694_10001306 | |||
| 1467 | Ga0207694_10137574 | |||
| 1468 | Ga0207694_10140319 | |||
| 1469 | Ga0207694_10154911 | |||
| 1470 | Ga0207694_10558443 | |||
| 1471 | Ga0207650_10000090 | |||
| 1472 | Ga0207650_10007969 | |||
| 1473 | Ga0207659_10002035 | |||
| 1474 | Ga0207687_10004238 | |||
| 1475 | Ga0207687_10011229 | |||
| 1476 | Ga0207687_10148099 | |||
| 1477 | Ga0207687_10271631 | |||
| 1478 | Ga0207687_10663359 | |||
| 1479 | Ga0207700_10000528 | |||
| 1480 | Ga0207700_10002119 | |||
| 1481 | Ga0207700_10003068 | |||
| 1482 | Ga0207700_10008312 | |||
| 1483 | Ga0207700_10030361 | |||
| 1484 | Ga0207700_10052588 | |||
| 1485 | Ga0207700_10057649 | |||
| 1486 | Ga0207700_10092278 | |||
| 1487 | Ga0207664_10000165 | |||
| 1488 | Ga0207664_10004851 | |||
| 1489 | Ga0207664_10081835 | |||
| 1490 | Ga0207664_10170502 | |||
| 1491 | Ga0207664_10251504 | |||
| 1492 | Ga0207664_10455318 | |||
| 1493 | Ga0207644_10002582 | |||
| 1494 | Ga0207644_10599867 | |||
| 1495 | Ga0207690_10003087 | |||
| 1496 | Ga0207690_10010651 | |||
| 1497 | Ga0207690_10203468 | |||
| 1498 | Ga0207706_10000139 | |||
| 1499 | Ga0207706_10000640 | |||
| 1500 | Ga0207706_10079906 | |||
| 1501 | Ga0207686_10035211 | |||
| 1502 | Ga0207686_10089477 | |||
| 1503 | Ga0207686_10090666 | |||
| 1504 | Ga0207709_10171480 | |||
| 1505 | Ga0207670_10001693 | |||
| 1506 | Ga0207704_10012294 | |||
| 1507 | Ga0207704_10223177 | |||
| 1508 | Ga0207704_10447185 | |||
| 1509 | Ga0207665_10002897 | |||
| 1510 | Ga0207665_10024039 | |||
| 1511 | Ga0207665_10028063 | |||
| 1512 | Ga0207665_10070289 | |||
| 1513 | Ga0207665_10257129 | |||
| 1514 | Ga0207665_10307124 | |||
| 1515 | Ga0207691_10001343 | |||
| 1516 | Ga0207711_10002838 | |||
| 1517 | Ga0207711_10011787 | |||
| 1518 | Ga0207689_10000304 | |||
| 1519 | Ga0207689_10001053 | |||
| 1520 | Ga0207689_10039634 | |||
| 1521 | Ga0207661_10000583 | |||
| 1522 | Ga0207661_10023933 | |||
| 1523 | Ga0207661_10185193 | |||
| 1524 | Ga0207661_10440149 | |||
| 1525 | Ga0207679_10000184 | |||
| 1526 | Ga0207679_10005367 | |||
| 1527 | Ga0207679_10027166 | |||
| 1528 | Ga0207679_10040898 | |||
| 1529 | Ga0207667_10004029 | |||
| 1530 | Ga0207667_10020400 | |||
| 1531 | Ga0207667_10071649 | |||
| 1532 | Ga0207667_10103960 | |||
| 1533 | Ga0207667_10107244 | |||
| 1534 | Ga0207667_10311841 | |||
| 1535 | Ga0207667_10528456 | |||
| 1536 | Ga0207651_10002456 | |||
| 1537 | Ga0207651_10107201 | |||
| 1538 | Ga0207651_10281777 | |||
| 1539 | Ga0207712_10023786 | |||
| 1540 | Ga0207712_10024542 | |||
| 1541 | Ga0207712_10119906 | |||
| 1542 | Ga0207640_10015374 | |||
| 1543 | Ga0207640_10036120 | |||
| 1544 | Ga0207640_10036188 | |||
| 1545 | Ga0207640_10078421 | |||
| 1546 | Ga0207658_10001983 | |||
| 1547 | Ga0207658_10041406 | |||
| 1548 | Ga0207677_10005049 | |||
| 1549 | Ga0207677_10006393 | |||
| 1550 | Ga0207677_10057478 | |||
| 1551 | Ga0207677_10459496 | |||
| 1552 | Ga0207703_10001863 | |||
| 1553 | Ga0207703_10005260 | |||
| 1554 | Ga0207703_10012716 | |||
| 1555 | Ga0207703_10034192 | |||
| 1556 | Ga0207703_10448356 | |||
| 1557 | Ga0207639_10046457 | |||
| 1558 | Ga0207639_10223963 | |||
| 1559 | Ga0207678_10000204 | |||
| 1560 | Ga0207678_10004676 | |||
| 1561 | Ga0207702_10000704 | |||
| 1562 | Ga0207702_10005927 | |||
| 1563 | Ga0207702_10014881 | |||
| 1564 | Ga0207702_10015530 | |||
| 1565 | Ga0207702_10016745 | |||
| 1566 | Ga0207702_10028337 | |||
| 1567 | Ga0207702_10145508 | |||
| 1568 | Ga0207702_10155741 | |||
| 1569 | Ga0207702_10181513 | |||
| 1570 | Ga0207641_10000894 | |||
| 1571 | Ga0207641_10026028 | |||
| 1572 | Ga0207641_10035294 | |||
| 1573 | Ga0207641_10078652 | |||
| 1574 | Ga0207641_10283961 | |||
| 1575 | Ga0207648_10000757 | |||
| 1576 | Ga0207648_10003612 | |||
| 1577 | Ga0207648_10294286 | |||
| 1578 | Ga0207648_10357029 | |||
| 1579 | Ga0207676_10000113 | |||
| 1580 | Ga0207676_10004935 | |||
| 1581 | Ga0207676_10114539 | |||
| 1582 | Ga0207674_10000076 | |||
| 1583 | Ga0207674_10008255 | |||
| 1584 | Ga0207674_10009505 | |||
| 1585 | Ga0207674_10017787 | |||
| 1586 | Ga0207674_10049003 | |||
| 1587 | Ga0207675_100008819 | |||
| 1588 | Ga0207675_100112550 | |||
| 1589 | Ga0207675_100252047 | |||
| 1590 | Ga0207683_10001129 | |||
| 1591 | Ga0207683_10317610 | |||
| 1592 | Ga0207698_10044147 | |||
| 1593 | Ga0207698_10190368 | |||
| 1594 | Ga0265356_1000298 | |||
| 1595 | Ga0268266_10005373 | |||
| 1596 | Ga0268265_10002144 | |||
| 1597 | Ga0268265_10063459 | |||
| 1598 | Ga0268265_10079197 | |||
| 1599 | Ga0268264_10016388 | |||
| 1600 | Ga0268264_10016978 | |||
| 1601 | Ga0268264_10075570 | |||
| 1602 | Ga0265338_10000750 | |||
| 1603 | Ga0265338_10005847 | |||
| 1604 | Ga0265338_10055749 | |||
| 1605 | Ga0265338_10098810 | |||
| 1606 | Ga0265338_10149453 | |||
| 1607 | Ga0265762_1000030 | |||
| 1608 | Ga0265762_1000238 | |||
| 1609 | Ga0265760_10001710 | |||
| 1610 | Ga0265760_10003216 | |||
| 1611 | Ga0265760_10007818 | |||
| 1612 | Ga0265332_10145196 | |||
| 1613 | Ga0265328_10022041 | |||
| 1614 | Ga0265328_10056880 | |||
| 1615 | Ga0265325_10032315 | |||
| 1616 | Ga0265325_10072788 | |||
| 1617 | Ga0265325_10081413 | |||
| 1618 | Ga0265340_10008487 | |||
| 1619 | Ga0265340_10015846 | |||
| 1620 | Ga0265340_10024956 | |||
| 1621 | Ga0265339_10004196 | |||
| 1622 | Ga0265339_10014860 | |||
| 1623 | Ga0265339_10034652 | |||
| 1624 | Ga0265339_10096303 | |||
| 1625 | Ga0265339_10141199 | |||
| 1626 | Ga0265327_10032110 | |||
| 1627 | Ga0265316_10010624 | |||
| 1628 | Ga0265316_10010927 | |||
| 1629 | Ga0265316_10014931 | |||
| 1630 | Ga0265316_10086374 | |||
| 1631 | Ga0265316_10298086 | |||
| 1632 | Ga0265316_10348815 | |||
| 1633 | Ga0307408_100009058 | |||
| 1634 | Ga0265313_10035068 | |||
| 1635 | Ga0265314_10031361 | |||
| 1636 | Ga0265314_10079739 | |||
| 1637 | Ga0265314_10123316 | |||
| 1638 | Ga0265342_10057462 | |||
| 1639 | Ga0307405_10026721 | |||
| 1640 | Ga0307405_10060022 | |||
| 1641 | Ga0307410_10007103 | |||
| 1642 | Ga0307410_10108380 | |||
| 1643 | Ga0307407_10057069 | |||
| 1644 | Ga0307409_100001571 | |||
| 1645 | Ga0307409_100060913 | |||
| 1646 | Ga0307416_100043835 | |||
| 1647 | Ga0307411_10023898 | |||
| 1648 | Ga0307415_100002646 | |||
| 1649 | Ga0316212_1005580 | |||
| 1650 | Ga0373926_0028490 | |||
| 1651 | Ga0373926_0088761 | |||
| 1652 | Ga0373928_0011668 | |||
| 1653 | Ga0373934_0040916 | |||
| 1654 | Ga0373949_0045606 | |||
| 1655 | Ga0373936_0027518 | |||
| 1656 | Ga0373945_0046101 | |||
| 1657 | Ga0373943_0013463 | |||
| 1658 | Ga0373943_0085500 | |||
| 1659 | Ga0373946_0079993 | |||
| 1660 | Ga0373931_0115290 | |||
| 1661 | Ga0373935_0008799 | |||
| 1662 | Ga0373935_0010017 | |||
| 1663 | Ga0373935_0017021 | |||
| 1664 | Ga0373935_0034720 | |||
| 1665 | Ga0373927_0000234 | |||
| 1666 | Ga0373927_0016852 | |||
| 1667 | Ga0373927_0027365 | |||
| 1668 | Ga0373927_0095825 | |||
| 1669 | Ga0373927_0109457 | |||
| 1670 | Ga0373927_0126907 | |||
| 1671 | Ga0373927_0143288 | |||
| 1672 | Ga0373933_0055424 | |||
| 1673 | Ga0373947_0025855 | |||
| 1674 | Ga0373947_0057018 | |||
| 1675 | Ga0373947_0129275 | |||
| 1676 | Ga0373947_0229671 | |||
| 1677 | Ga0373937_0000596 | |||
| 1678 | Ga0373937_0024205 | |||
| 1679 | Ga0373937_0033409 | |||
| 1680 | Ga0373937_0035986 | |||
| 1681 | Ga0373937_0053014 | |||
| 1682 | Ga0373937_0259428 | |||
| 1683 | Ga0373925_0000227 | |||
| 1684 | Ga0373925_0001086 | |||
| 1685 | Ga0373925_0002762 | |||
| 1686 | Ga0373925_0037329 | |||
| 1687 | Ga0373925_0129281 | |||
| 1688 | Ga0373925_0276718 | |||
| 1689 | Ga0395898_0163122 | |||
| 1690 | Ga0395898_0337093 | |||
| 1691 | Ga0395905_0071991 | |||
| 1692 | Ga0436365_0696718 | |||
| 1693 | Ga0436360_0051252 | |||
| 1694 | Ga0436363_0131185 | |||
| 1695 | Ga0436363_0265047 | |||
| 1696 | Ga0436363_1291424 | |||
| 1697 | Ga0436362_0848211 | |||
| 1698 | Ga0466963_0001890 | |||
| 1699 | Ga0466964_0039615 | |||
| 1700 | Ga0451576_0279170 | |||
| 1701 | Ga0451576_0541994 | |||
| 1702 | Ga0466958_0109890 | |||
| 1703 | Ga0466967_0004535 | |||
| 1704 | Ga0466967_0014796 | |||
| 1705 | Ga0466967_0020702 | |||
| 1706 | Ga0466967_0032045 | |||
| 1707 | Ga0466967_0035164 | |||
| 1708 | Ga0466967_0049777 | |||
| 1709 | Ga0466967_0248782 | |||
| 1710 | Ga0495653_0140819 | |||
| 1711 | Ga0495580_0005751 | |||
| 1712 | Ga0495580_0008637 | |||
| 1713 | Ga0495580_0012343 | |||
| 1714 | Ga0495580_0015718 | |||
| 1715 | Ga0495580_0037477 | |||
| 1716 | Ga0495580_0166087 | |||
| 1717 | Ga0495580_0176228 | |||
| 1718 | Ga0495580_0200031 | |||
| 1719 | Ga0495580_0234470 | |||
| 1720 | Ga0495580_0268783 | |||
| 1721 | Ga0495582_0001766 | |||
| 1722 | Ga0495582_0031347 | |||
| 1723 | Ga0495582_0081946 | |||
| 1724 | Ga0495639_0056561 | |||
| 1725 | Ga0495639_0075273 | |||
| 1726 | Ga0495664_0061642 | |||
| 1727 | Ga0495628_0018123 | |||
| 1728 | Ga0495630_0156140 | |||
| 1729 | Ga0495630_0208437 | |||
| 1730 | Ga0495642_0176289 | |||
| 1731 | Ga0495665_0010815 | |||
| 1732 | Ga0495665_0114191 | |||
| 1733 | Ga0495635_0096577 | |||
| 1734 | Ga0495635_0305274 | |||
| 1735 | Ga0495657_0226724 | |||
| 1736 | Ga0495623_0024206 | |||
| 1737 | Ga0495623_0034506 | |||
| 1738 | Ga0495623_0083416 | |||
| 1739 | Ga0495658_0054459 | |||
| 1740 | Ga0495669_0085856 | |||
| 1741 | Ga0495674_0033176 | |||
| 1742 | Ga0495676_0144491 | |||
| 1743 | Ga0495676_0157824 | |||
| 1744 | Ga0495593_0142438 | |||
| 1745 | Ga0495602_0055511 | |||
| 1746 | Ga0495602_0135117 | |||
| 1747 | Ga0495602_0269147 | |||
| 1748 | Ga0495614_0041711 | |||
| 1749 | Ga0496100_0003857 | |||
| 1750 | Ga0496100_0130159 | |||
| 1751 | Ga0496100_0214169 | |||
| 1752 | Ga0496101_0003461 | |||
| 1753 | Ga0496101_0382047 | |||
| 1754 | Ga0496102_0000537 | |||
| 1755 | Ga0496102_0103108 | |||
| 1756 | Ga0496102_0195843 | |||
| 1757 | Ga0496102_0272738 | |||
| 1758 | Ga0496103_0010438 | |||
| 1759 | Ga0496103_0011600 | |||
| 1760 | Ga0496103_0053924 | |||
| 1761 | Ga0496104_0035988 | |||
| 1762 | Ga0496104_0036653 | |||
| 1763 | Ga0496104_0050923 | |||
| 1764 | Ga0496104_0227846 | |||
| 1765 | Ga0496104_0653712 | |||
| 1766 | Ga0496105_0031508 | |||
| 1767 | Ga0496105_0110162 | |||
| 1768 | Ga0496105_0139926 | |||
| 1769 | Ga0496105_0249987 | |||
| 1770 | Ga0496106_0062827 | |||
| 1771 | Ga0496106_0097339 | |||
| 1772 | Ga0496106_0113740 | |||
| 1773 | Ga0496107_0052486 | |||
| 1774 | Ga0496107_0140506 | |||
| 1775 | Ga0496108_0002118 | |||
| 1776 | Ga0496108_0035693 | |||
| 1777 | Ga0496108_0094357 | |||
| 1778 | Ga0496109_0000008 | |||
| 1779 | Ga0496109_0039890 | |||
| 1780 | Ga0496109_0184031 | |||
| 1781 | Ga0496109_0195916 | |||
| 1782 | Ga0496109_0209122 | |||
| 1783 | Ga0496110_0051224 | |||
| 1784 | Ga0496110_0094519 | |||
| 1785 | Ga0496110_0129613 | |||
| 1786 | Ga0496111_0014712 | |||
| 1787 | Ga0496112_0000334 | |||
| 1788 | Ga0496112_0001099 | |||
| 1789 | Ga0496112_0005467 | |||
| 1790 | Ga0496112_0013062 | |||
| 1791 | Ga0496112_0037620 | |||
| 1792 | Ga0496112_0041732 | |||
| 1793 | Ga0496112_0050195 | |||
| 1794 | Ga0496112_0082762 | |||
| 1795 | Ga0496112_0141816 | |||
| 1796 | Ga0496112_0328175 | |||
| 1797 | Ga0496112_0433018 | |||
| 1798 | Ga0496112_0445385 | |||
| 1799 | Ga0496113_0000238 | |||
| 1800 | Ga0496113_0005618 | |||
| 1801 | Ga0496113_0113103 | |||
| 1802 | Ga0496114_0028113 | |||
| 1803 | Ga0496114_0126229 | |||
| 1804 | Ga0496115_0004624 | |||
| 1805 | Ga0496115_0016349 | |||
| 1806 | Ga0496115_0070340 | |||
| 1807 | Ga0501073_0038132 | |||
| 1808 | Ga0501245_025829 | |||
| 1809 | Ga0501083_0255154 | |||
| 1810 | nmdc:mga05p37_104900_c1 | |||
| 1811 | nmdc:mga05p37_318014_c1 | |||
| 1812 | nmdc:mga0n895_50045_c1 | |||
| 1813 | nmdc:mga0n895_634_c1 | |||
| 1814 | nmdc:mga0n895_85268_c1 | |||
| 1815 | nmdc:mga0rr50_297315_c1 | |||
| 1816 | nmdc:mga0rr50_34917_c1 | |||
| 1817 | nmdc:mga0rr50_370252_c1 | |||
| 1818 | nmdc:mga0rr50_66550_c1 | |||
| 1819 | nmdc:mga0rr50_85082_c1 | |||
| 1820 | nmdc:mga08x19_10856_c1 | |||
| 1821 | nmdc:mga08x19_158610_c1 | |||
| 1822 | nmdc:mga08x19_18527_c1 | |||
| 1823 | nmdc:mga08x19_233356_c1 | |||
| 1824 | nmdc:mga08x19_6888_c1 | |||
| 1825 | nmdc:mga0a205_365708_c1 | |||
| 1826 | Ga0495619_0071569 | |||
| 1827 | Ga0501084_0199022 | |||
| 1828 | Ga0587091_015504 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m1q-assembly1.cif.gz_A | human abca4 structure in complex with n-ret-pe | 0.7598 | 76 | 262 |
| 5xjy-assembly1.cif.gz_A | cryo-em structure of human abca1 | 0.7548 | 75 | 264 |
| 7nez-assembly1.cif.gz_B | structure of topotecan-bound abcg2 | 0.7285 | 22 | 265 |
| 7e7o-assembly1.cif.gz_A | cryo-em structure of human abca4 in nrpe-bound state | 0.7265 | 75 | 265 |
| 6ffc-assembly1.cif.gz_A | structure of an inhibitor-bound abc transporter | 0.7254 | 22 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.856 | 66 | 264 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8246 | 66 | 263 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7961 | 48 | 264 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6375 | 48 | 264 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6329 | 66 | 264 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537C6L3-F1-model_v4 | Multidrug ABC transporter permease | 0.9673 | 76 | 267 |
GO:0016020
GO:0140359 |
| AF-A0A7J2HAA6-F1-model_v4 | deleted | 0.956 | 77 | 267 |
|
| AF-A0A3D2AYY1-F1-model_v4 | Transport permease protein | 0.9539 | 21 | 239 |
GO:0043190
GO:0140359 |
| AF-A0A7Y5H975-F1-model_v4 | Transport permease protein | 0.9536 | 22 | 268 |
GO:0043190
GO:0140359 |
| AF-A0A832U5F1-F1-model_v4 | ABC transporter permease | 0.9505 | 18 | 267 |
GO:0043190
GO:0140359 |