F485570

General Info

Members Datasets Scaffolds Average Seq Length
914 283 1828 269

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10003505|Ga0157375_1000350513
Length 292
Sequence LFEHDAISLTFEIGNTQMATQTATLQTRPIPSSDGILLPAFTLWWREIVRFYRQRARVVGVIASPLLFWIVIGSGFGTSFRSGEGPGQDHYLDYFFPGALIMIVLFTAIFTMMSVIEDRKEGFLLSVLVAPVPRSAIVLGKVLGGTTLAAAQGLLFLVFAPFVGIHFHFIQFLLILSVVFLVSFALTALGFAIAWPMDSTQAFHGIINLFLIPLWLLSGALFPLNKAAHWLSMLMRINPLTYGVEALRTLLYPGSPSDFSLTESLATLVLFSLFMFAIAFVVANRRTTKPVA

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
121 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
122 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.35
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 15.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10003505 3300013308 Bacteria 13607
2 LJNas_1000849 3300000546 Bacteria 5012
3 JGI24743J22301_10000093 3300001991 Bacteria 8658
4 JGI24748J21848_1003187 3300002074 Bacteria 1872
5 JGI24034J26672_10001180 3300002239 Bacteria 3419
6 JGI24751J29686_10000635 3300002459 Bacteria 9014
7 Ga0065712_10114404 3300005290 Bacteria 1763
8 Ga0065712_10141661 3300005290 Bacteria 1389
9 Ga0070658_10319675 3300005327 Bacteria 1325
10 Ga0070676_10005283 3300005328 Bacteria 6866
11 Ga0070676_10041193 3300005328 Unclassified 2677
12 Ga0070683_100001910 3300005329 Bacteria 16302
13 Ga0070683_100022151 3300005329 Bacteria 5677
14 Ga0070683_100061135 3300005329 Bacteria 3502
15 Ga0070683_100104700 3300005329 Bacteria 2667
16 Ga0070690_100003363 3300005330 Bacteria 8732
17 Ga0070690_100070525 3300005330 Unclassified 2269
18 Ga0070670_100001939 3300005331 Bacteria 16933
19 Ga0070670_100006041 3300005331 Bacteria 10241
20 Ga0070670_100216357 3300005331 Unclassified 1667
21 Ga0068869_100001662 3300005334 Bacteria 13287
22 Ga0068869_100028706 3300005334 Bacteria 3891
23 Ga0070666_10008180 3300005335 Bacteria 6481
24 Ga0070666_10090596 3300005335 Bacteria 2100
25 Ga0070680_100030773 3300005336 Bacteria 4312
26 Ga0070680_100067974 3300005336 Bacteria 2924
27 Ga0070680_100089406 3300005336 Bacteria 2548
28 Ga0070680_100109169 3300005336 Bacteria 2302
29 Ga0070682_100003286 3300005337 Bacteria 8968
30 Ga0070682_100051417 3300005337 Bacteria 2575
31 Ga0070682_100105957 3300005337 Bacteria 1865
32 Ga0068868_100000991 3300005338 Bacteria 19363
33 Ga0068868_100001388 3300005338 Bacteria 16720
34 Ga0068868_100026812 3300005338 Bacteria 4394
35 Ga0068868_100059864 3300005338 Bacteria 3013
36 Ga0068868_100082544 3300005338 Bacteria 2578
37 Ga0068868_100217838 3300005338 Bacteria 1597
38 Ga0070660_100006387 3300005339 Bacteria 8170
39 Ga0070660_100038052 3300005339 Bacteria 3650
40 Ga0070660_100342498 3300005339 Bacteria 1230
41 Ga0070689_100001082 3300005340 Bacteria 17081
42 Ga0070689_100058095 3300005340 Bacteria 3004
43 Ga0070691_10075503 3300005341 Unclassified 1642
44 Ga0070687_100006182 3300005343 Bacteria 4894
45 Ga0070661_100009183 3300005344 Bacteria 6835
46 Ga0070661_100009221 3300005344 Bacteria 6822
47 Ga0070661_100013353 3300005344 Bacteria 5765
48 Ga0070661_100354113 3300005344 Bacteria 1152
49 Ga0070661_100385656 3300005344 Bacteria 1105
50 Ga0070692_10097853 3300005345 Bacteria 1604
51 Ga0070692_10182399 3300005345 Unclassified 1217
52 Ga0070668_100004887 3300005347 Bacteria 9936
53 Ga0070669_100001365 3300005353 Bacteria 17595
54 Ga0070669_100136207 3300005353 Bacteria 1889
55 Ga0070675_100167505 3300005354 Unclassified 1893
56 Ga0070675_100274711 3300005354 Bacteria 1479
57 Ga0070671_100153160 3300005355 Bacteria 1947
58 Ga0070673_100009008 3300005364 Bacteria 6679
59 Ga0070673_100209855 3300005364 Bacteria 1681
60 Ga0070673_100334647 3300005364 Bacteria 1340
61 Ga0070688_100000289 3300005365 Bacteria 25802
62 Ga0070659_100002441 3300005366 Bacteria 13204
63 Ga0070659_100017607 3300005366 Bacteria 5381
64 Ga0070659_100102405 3300005366 Bacteria 2305
65 Ga0070667_100060743 3300005367 Bacteria 3198
66 Ga0070667_100160758 3300005367 Unclassified 1978
67 Ga0070667_100338983 3300005367 Unclassified 1359
68 Ga0070709_10002030 3300005434 Bacteria 10997
69 Ga0070709_10079424 3300005434 Bacteria 2137
70 Ga0070709_10180861 3300005434 Unclassified 1480
71 Ga0070709_10189359 3300005434 Bacteria 1450
72 Ga0070709_10243746 3300005434 Unclassified 1292
73 Ga0070714_100001155 3300005435 Bacteria 19000
74 Ga0070714_100002082 3300005435 Bacteria 14656
75 Ga0070714_100007533 3300005435 Bacteria 8471
76 Ga0070714_100068882 3300005435 Unclassified 3054
77 Ga0070714_100070692 3300005435 Bacteria 3017
78 Ga0070714_100140930 3300005435 Bacteria 2164
79 Ga0070714_100151946 3300005435 Bacteria 2087
80 Ga0070714_100215517 3300005435 Unclassified 1762
81 Ga0070713_100000222 3300005436 Bacteria 37755
82 Ga0070713_100001170 3300005436 Bacteria 16769
83 Ga0070713_100003074 3300005436 Bacteria 10971
84 Ga0070713_100008216 3300005436 Bacteria 7395
85 Ga0070713_100013181 3300005436 Bacteria 6095
86 Ga0070713_100036869 3300005436 Bacteria 3949
87 Ga0070713_100053651 3300005436 Bacteria 3341
88 Ga0070713_100068656 3300005436 Bacteria 2987
89 Ga0070713_100086410 3300005436 Unclassified 2689
90 Ga0070713_100115254 3300005436 Unclassified 2348
91 Ga0070713_100128906 3300005436 Bacteria 2228
92 Ga0070713_100252448 3300005436 Bacteria 1609
93 Ga0070710_10064456 3300005437 Bacteria 2096
94 Ga0070710_10115611 3300005437 Unclassified 1617
95 Ga0070710_10160200 3300005437 Bacteria 1395
96 Ga0070711_100003515 3300005439 Bacteria 9145
97 Ga0070711_100006478 3300005439 Bacteria 7061
98 Ga0070711_100008083 3300005439 Bacteria 6427
99 Ga0070711_100046532 3300005439 Bacteria 2957
100 Ga0070711_100290878 3300005439 Unclassified 1296
101 Ga0070711_100555484 3300005439 Bacteria 953
102 Ga0070708_100000263 3300005445 Bacteria 39351
103 Ga0070708_100002193 3300005445 Bacteria 15093
104 Ga0070708_100003924 3300005445 Bacteria 11681
105 Ga0070708_100022080 3300005445 Bacteria 5394
106 Ga0070708_100054662 3300005445 Unclassified 3547
107 Ga0070708_100061202 3300005445 Bacteria 3363
108 Ga0070708_100073804 3300005445 Bacteria 3076
109 Ga0070708_100087773 3300005445 Bacteria 2827
110 Ga0070708_100102864 3300005445 Bacteria 2618
111 Ga0070708_100143700 3300005445 Unclassified 2214
112 Ga0070708_100246442 3300005445 Unclassified 1678
113 Ga0070708_100260683 3300005445 Bacteria 1629
114 Ga0070663_100023409 3300005455 Bacteria 4140
115 Ga0070663_100028694 3300005455 Bacteria 3792
116 Ga0070678_100002783 3300005456 Bacteria 9666
117 Ga0070678_100023075 3300005456 Bacteria 4139
118 Ga0070662_100002426 3300005457 Bacteria 11463
119 Ga0070662_100007363 3300005457 Bacteria 7131
120 Ga0070662_100064072 3300005457 Bacteria 2690
121 Ga0070681_10000091 3300005458 Bacteria 67429
122 Ga0070681_10032433 3300005458 Bacteria 5242
123 Ga0070681_10370703 3300005458 Bacteria 1342
124 Ga0070681_10465894 3300005458 Bacteria 1176
125 Ga0068867_100000749 3300005459 Bacteria 21787
126 Ga0068867_100017844 3300005459 Bacteria 5040
127 Ga0068867_100197187 3300005459 Bacteria 1610
128 Ga0070685_10001601 3300005466 Bacteria 11932
129 Ga0070706_100000869 3300005467 Bacteria 33228
130 Ga0070706_100001289 3300005467 Bacteria 26742
131 Ga0070706_100010747 3300005467 Bacteria 8495
132 Ga0070706_100011557 3300005467 Bacteria 8202
133 Ga0070706_100042587 3300005467 Bacteria 4195
134 Ga0070706_100129894 3300005467 Unclassified 2351
135 Ga0070706_100276923 3300005467 Bacteria 1566
136 Ga0070706_100364583 3300005467 Bacteria 1346
137 Ga0070707_100000557 3300005468 Bacteria 37459
138 Ga0070707_100010726 3300005468 Bacteria 8534
139 Ga0070707_100128409 3300005468 Bacteria 2464
140 Ga0070707_100139063 3300005468 Bacteria 2363
141 Ga0070707_100175140 3300005468 Bacteria 2091
142 Ga0070707_100378333 3300005468 Unclassified 1376
143 Ga0070707_100786964 3300005468 Bacteria 915
144 Ga0070698_100000456 3300005471 Bacteria 43335
145 Ga0070698_100001775 3300005471 Bacteria 24031
146 Ga0070698_100226784 3300005471 Bacteria 1801
147 Ga0070698_100401925 3300005471 Bacteria 1303
148 Ga0070699_100000340 3300005518 Bacteria 45329
149 Ga0070699_100001799 3300005518 Bacteria 19484
150 Ga0070699_100011106 3300005518 Bacteria 7785
151 Ga0070699_100044872 3300005518 Bacteria 3827
152 Ga0070699_100068714 3300005518 Bacteria 3078
153 Ga0070699_100488840 3300005518 Unclassified 1117
154 Ga0070699_100509746 3300005518 Unclassified 1093
155 Ga0070679_100007789 3300005530 Bacteria 10037
156 Ga0070679_100114065 3300005530 Bacteria 2687
157 Ga0070679_100207479 3300005530 Bacteria 1924
158 Ga0070679_100252336 3300005530 Bacteria 1720
159 Ga0070679_100351292 3300005530 Unclassified 1422
160 Ga0070679_100353088 3300005530 Bacteria 1418
161 Ga0070684_100001382 3300005535 Bacteria 17441
162 Ga0070684_100007536 3300005535 Bacteria 8472
163 Ga0070684_100042554 3300005535 Bacteria 3922
164 Ga0070684_100043347 3300005535 Bacteria 3885
165 Ga0070697_100000496 3300005536 Bacteria 29902
166 Ga0070697_100000770 3300005536 Bacteria 23986
167 Ga0070697_100001425 3300005536 Bacteria 18173
168 Ga0070697_100003073 3300005536 Bacteria 12803
169 Ga0070697_100012017 3300005536 Bacteria 6777
170 Ga0070697_100045210 3300005536 Bacteria 3568
171 Ga0070697_100133441 3300005536 Unclassified 2084
172 Ga0070697_100210408 3300005536 Bacteria 1655
173 Ga0070697_100298592 3300005536 Bacteria 1384
174 Ga0068853_100004992 3300005539 Bacteria 10340
175 Ga0068853_100028987 3300005539 Unclassified 4661
176 Ga0068853_100054550 3300005539 Bacteria 3445
177 Ga0068853_100318746 3300005539 Bacteria 1441
178 Ga0070672_100002640 3300005543 Bacteria 11462
179 Ga0070672_100239366 3300005543 Bacteria 1526
180 Ga0070686_100002027 3300005544 Bacteria 11243
181 Ga0070696_100094516 3300005546 Bacteria 2133
182 Ga0070696_100206286 3300005546 Bacteria 1469
183 Ga0070693_100024209 3300005547 Bacteria 3253
184 Ga0070693_100394450 3300005547 Bacteria 958
185 Ga0068855_100004016 3300005563 Bacteria 17972
186 Ga0068855_100023553 3300005563 Bacteria 7372
187 Ga0068855_100056359 3300005563 Bacteria 4612
188 Ga0068855_100058865 3300005563 Bacteria 4497
189 Ga0068855_100121688 3300005563 Unclassified 2987
190 Ga0068855_100164357 3300005563 Bacteria 2517
191 Ga0068855_100298188 3300005563 Bacteria 1786
192 Ga0070664_100000782 3300005564 Bacteria 24526
193 Ga0070664_100006830 3300005564 Bacteria 9204
194 Ga0070664_100104985 3300005564 Bacteria 2460
195 Ga0070664_100402222 3300005564 Bacteria 1252
196 Ga0068857_100000994 3300005577 Bacteria 21786
197 Ga0068857_100002750 3300005577 Bacteria 14452
198 Ga0068857_100020575 3300005577 Bacteria 5806
199 Ga0068857_100044015 3300005577 Bacteria 3959
200 Ga0068857_100083866 3300005577 Bacteria 2848
201 Ga0068857_100119691 3300005577 Bacteria 2370
202 Ga0068857_100269395 3300005577 Unclassified 1565
203 Ga0068854_100005734 3300005578 Bacteria 7852
204 Ga0068854_100022513 3300005578 Bacteria 4295
205 Ga0068854_100048663 3300005578 Bacteria 3025
206 Ga0068854_100102988 3300005578 Bacteria 2142
207 Ga0068854_100132729 3300005578 Bacteria 1903
208 Ga0068854_100335920 3300005578 Unclassified 1232
209 Ga0068856_100000107 3300005614 Bacteria 81707
210 Ga0068856_100000900 3300005614 Bacteria 31839
211 Ga0068856_100005519 3300005614 Bacteria 12457
212 Ga0068856_100015999 3300005614 Bacteria 7251
213 Ga0068856_100016530 3300005614 Bacteria 7141
214 Ga0068856_100018327 3300005614 Bacteria 6786
215 Ga0068856_100085984 3300005614 Bacteria 3124
216 Ga0068856_100113969 3300005614 Bacteria 2702
217 Ga0070702_100006493 3300005615 Bacteria 5541
218 Ga0068852_100005202 3300005616 Bacteria 9279
219 Ga0068852_100015752 3300005616 Bacteria 5877
220 Ga0068852_100032958 3300005616 Bacteria 4296
221 Ga0068859_100000573 3300005617 Bacteria 36716
222 Ga0068859_100015671 3300005617 Bacteria 7617
223 Ga0068859_100032315 3300005617 Bacteria 5257
224 Ga0068859_100054585 3300005617 Bacteria 4019
225 Ga0068864_100003555 3300005618 Bacteria 12884
226 Ga0068864_100003567 3300005618 Bacteria 12861
227 Ga0068864_100088024 3300005618 Bacteria 2735
228 Ga0068864_100160380 3300005618 Bacteria 2044
229 Ga0068866_10001464 3300005718 Bacteria 10084
230 Ga0068866_10011000 3300005718 Bacteria 3897
231 Ga0068866_10038699 3300005718 Unclassified 2350
232 Ga0068861_100002752 3300005719 Bacteria 11529
233 Ga0068851_10018270 3300005834 Bacteria 3377
234 Ga0068851_10082837 3300005834 Bacteria 1678
235 Ga0068851_10129774 3300005834 Unclassified 1362
236 Ga0068870_10000606 3300005840 Bacteria 13652
237 Ga0068863_100010061 3300005841 Bacteria 9204
238 Ga0068863_100021802 3300005841 Bacteria 6114
239 Ga0068863_100057211 3300005841 Unclassified 3691
240 Ga0068863_100167105 3300005841 Bacteria 2110
241 Ga0068863_100337974 3300005841 Bacteria 1465
242 Ga0068863_100424874 3300005841 Bacteria 1302
243 Ga0068863_100468282 3300005841 Bacteria 1238
244 Ga0068858_100000597 3300005842 Bacteria 37673
245 Ga0068858_100009222 3300005842 Bacteria 9421
246 Ga0068858_100032751 3300005842 Bacteria 4827
247 Ga0068858_100039198 3300005842 Bacteria 4394
248 Ga0068858_100062713 3300005842 Bacteria 3437
249 Ga0068858_100257833 3300005842 Bacteria 1657
250 Ga0068860_100020205 3300005843 Bacteria 6455
251 Ga0068860_100047365 3300005843 Unclassified 4098
252 Ga0068860_100054771 3300005843 Bacteria 3791
253 Ga0068860_100055729 3300005843 Bacteria 3758
254 Ga0068860_100142719 3300005843 Bacteria 2303
255 Ga0068862_100012134 3300005844 Bacteria 7121
256 Ga0068862_100082071 3300005844 Unclassified 2797
257 Ga0068862_100150397 3300005844 Unclassified 2072
258 Ga0081455_10102597 3300005937 Bacteria 2293
259 Ga0081540_1050975 3300005983 Bacteria 2050
260 Ga0070717_10002245 3300006028 Bacteria 13546
261 Ga0070717_10004396 3300006028 Bacteria 10172
262 Ga0070717_10004694 3300006028 Bacteria 9925
263 Ga0070717_10007223 3300006028 Bacteria 8240
264 Ga0070717_10023317 3300006028 Bacteria 4902
265 Ga0070717_10028895 3300006028 Bacteria 4443
266 Ga0070717_10065542 3300006028 Bacteria 3020
267 Ga0070717_10091269 3300006028 Bacteria 2572
268 Ga0070717_10117094 3300006028 Bacteria 2278
269 Ga0070717_10132277 3300006028 Bacteria 2146
270 Ga0070717_10210346 3300006028 Bacteria 1707
271 Ga0070717_10243636 3300006028 Bacteria 1586
272 Ga0070717_10271666 3300006028 Unclassified 1502
273 Ga0070717_10316548 3300006028 Bacteria 1390
274 Ga0070715_10030332 3300006163 Bacteria 2185
275 Ga0070716_100006587 3300006173 Bacteria 5677
276 Ga0070716_100046064 3300006173 Bacteria 2452
277 Ga0070716_100075005 3300006173 Bacteria 2000
278 Ga0070716_100157069 3300006173 Bacteria 1470
279 Ga0070716_100226974 3300006173 Unclassified 1258
280 Ga0070712_100000056 3300006175 Bacteria 56756
281 Ga0070712_100000321 3300006175 Bacteria 27066
282 Ga0070712_100000550 3300006175 Bacteria 21698
283 Ga0070712_100000969 3300006175 Bacteria 17281
284 Ga0070712_100006585 3300006175 Bacteria 7215
285 Ga0070712_100012730 3300006175 Bacteria 5355
286 Ga0070712_100059359 3300006175 Bacteria 2694
287 Ga0070712_100093546 3300006175 Bacteria 2207
288 Ga0070712_100124608 3300006175 Bacteria 1944
289 Ga0097621_100007807 3300006237 Bacteria 7677
290 Ga0097621_100013116 3300006237 Bacteria 6164
291 Ga0097621_100022304 3300006237 Unclassified 4913
292 Ga0097621_100038974 3300006237 Bacteria 3815
293 Ga0097621_100223983 3300006237 Bacteria 1640
294 Ga0097621_100374458 3300006237 Bacteria 1271
295 Ga0097621_100378294 3300006237 Bacteria 1264
296 Ga0068871_100000231 3300006358 Bacteria 39603
297 Ga0068871_100000801 3300006358 Bacteria 21126
298 Ga0068871_100023652 3300006358 Bacteria 4756
299 Ga0068871_100030754 3300006358 Bacteria 4231
300 Ga0068871_100047582 3300006358 Bacteria 3459
301 Ga0068871_100061868 3300006358 Bacteria 3059
302 Ga0075433_10080428 3300006852 Unclassified 2873
303 Ga0075434_100000416 3300006871 Bacteria 31534
304 Ga0075434_100002666 3300006871 Bacteria 15766
305 Ga0075434_100075214 3300006871 Bacteria 3371
306 Ga0075434_100375302 3300006871 Bacteria 1443
307 Ga0075434_100437324 3300006871 Bacteria 1329
308 Ga0068865_100011689 3300006881 Bacteria 5500
309 Ga0068865_100024800 3300006881 Bacteria 3939
310 Ga0068865_100223208 3300006881 Bacteria 1474
311 Ga0075436_100000451 3300006914 Bacteria 26434
312 Ga0075436_100006264 3300006914 Bacteria 8150
313 Ga0075436_100061734 3300006914 Bacteria 2590
314 Ga0075436_100063044 3300006914 Unclassified 2562
315 Ga0097620_100000573 3300006931 Bacteria 36716
316 Ga0097620_100015671 3300006931 Bacteria 7617
317 Ga0097620_100032313 3300006931 Bacteria 5257
318 Ga0097620_100054586 3300006931 Bacteria 4019
319 Ga0075435_100018943 3300007076 Bacteria 5246
320 Ga0075435_100098623 3300007076 Unclassified 2419
321 Ga0075435_100317973 3300007076 Bacteria 1332
322 Ga0105251_10106009 3300009011 Bacteria 1283
323 Ga0105240_10010408 3300009093 Bacteria 13071
324 Ga0105240_10022299 3300009093 Bacteria 8399
325 Ga0105240_10067816 3300009093 Bacteria 4421
326 Ga0105240_10067976 3300009093 Bacteria 4415
327 Ga0105240_10108380 3300009093 Bacteria 3365
328 Ga0105240_10207523 3300009093 Bacteria 2292
329 Ga0105240_10217910 3300009093 Unclassified 2225
330 Ga0105240_10255755 3300009093 Bacteria 2023
331 Ga0105240_10364637 3300009093 Bacteria 1635
332 Ga0105240_10589274 3300009093 Unclassified 1225
333 Ga0105240_10783170 3300009093 Bacteria 1034
334 Ga0105245_10002797 3300009098 Bacteria 15694
335 Ga0105245_10068422 3300009098 Bacteria 3217
336 Ga0105245_10132404 3300009098 Bacteria 2340
337 Ga0105245_10321209 3300009098 Bacteria 1525
338 Ga0105247_10001769 3300009101 Bacteria 15200
339 Ga0105247_10013079 3300009101 Bacteria 4977
340 Ga0105247_10078385 3300009101 Unclassified 2078
341 Ga0105247_10121480 3300009101 Bacteria 1693
342 Ga0114129_10308529 3300009147 Bacteria 2107
343 Ga0114129_10483618 3300009147 Bacteria 1619
344 Ga0105243_10122132 3300009148 Unclassified 2198
345 Ga0105241_10006514 3300009174 Bacteria 8607
346 Ga0105241_10011553 3300009174 Bacteria 6474
347 Ga0105241_10011918 3300009174 Bacteria 6387
348 Ga0105241_10015255 3300009174 Bacteria 5626
349 Ga0105241_10091233 3300009174 Unclassified 2403
350 Ga0105241_10151018 3300009174 Bacteria 1900
351 Ga0105241_10187045 3300009174 Bacteria 1722
352 Ga0105241_10258223 3300009174 Bacteria 1480
353 Ga0105242_10005432 3300009176 Bacteria 9856
354 Ga0105242_10071023 3300009176 Bacteria 2888
355 Ga0105242_10098205 3300009176 Unclassified 2477
356 Ga0105242_10116161 3300009176 Bacteria 2289
357 Ga0105248_10006081 3300009177 Bacteria 13248
358 Ga0105248_10033583 3300009177 Bacteria 5732
359 Ga0105248_10068327 3300009177 Bacteria 3990
360 Ga0105248_10102641 3300009177 Bacteria 3223
361 Ga0105248_10390370 3300009177 Bacteria 1567
362 Ga0105248_10793638 3300009177 Bacteria 1069
363 Ga0105237_10020363 3300009545 Bacteria 6841
364 Ga0105237_10027226 3300009545 Bacteria 5838
365 Ga0105237_10114417 3300009545 Bacteria 2690
366 Ga0105237_10201447 3300009545 Bacteria 1991
367 Ga0105237_10238445 3300009545 Bacteria 1820
368 Ga0105238_10022710 3300009551 Bacteria 6394
369 Ga0105238_10023137 3300009551 Bacteria 6336
370 Ga0105238_10089695 3300009551 Bacteria 3062
371 Ga0105238_10134056 3300009551 Bacteria 2455
372 Ga0105238_10140412 3300009551 Bacteria 2393
373 Ga0105238_10155261 3300009551 Bacteria 2264
374 Ga0105238_10240384 3300009551 Bacteria 1788
375 Ga0105249_10004117 3300009553 Bacteria 12556
376 Ga0105249_10032008 3300009553 Bacteria 4757
377 Ga0099796_10071648 3300010159 Unclassified 1252
378 Ga0105239_10004431 3300010375 Bacteria 16792
379 Ga0105239_10014150 3300010375 Bacteria 8852
380 Ga0105239_10033827 3300010375 Bacteria 5611
381 Ga0105239_10073681 3300010375 Bacteria 3753
382 Ga0105239_10135233 3300010375 Bacteria 2744
383 Ga0105239_10576771 3300010375 Unclassified 1282
384 Ga0105239_10623364 3300010375 Bacteria 1231
385 Ga0105246_10002416 3300011119 Bacteria 11268
386 Ga0105246_10037404 3300011119 Unclassified 3258
387 Ga0105246_10137306 3300011119 Bacteria 1834
388 Ga0157373_10001041 3300013100 Bacteria 21375
389 Ga0157373_10036749 3300013100 Bacteria 3513
390 Ga0157373_10071872 3300013100 Bacteria 2443
391 Ga0157373_10123708 3300013100 Unclassified 1819
392 Ga0157373_10145969 3300013100 Bacteria 1664
393 Ga0157371_10005311 3300013102 Bacteria 10903
394 Ga0157371_10011857 3300013102 Bacteria 6690
395 Ga0157371_10027814 3300013102 Bacteria 4098
396 Ga0157370_10077936 3300013104 Unclassified 3121
397 Ga0157370_10104957 3300013104 Bacteria 2645
398 Ga0157370_10129021 3300013104 Bacteria 2359
399 Ga0157370_10158132 3300013104 Unclassified 2108
400 Ga0157370_10180456 3300013104 Unclassified 1962
401 Ga0157370_10347078 3300013104 Bacteria 1368
402 Ga0157369_10001478 3300013105 Bacteria 28808
403 Ga0157369_10008130 3300013105 Bacteria 12028
404 Ga0157369_10042110 3300013105 Bacteria 4982
405 Ga0157369_10042263 3300013105 Bacteria 4973
406 Ga0157369_10047069 3300013105 Bacteria 4685
407 Ga0157369_10053909 3300013105 Bacteria 4343
408 Ga0157369_10082514 3300013105 Bacteria 3439
409 Ga0157369_10101196 3300013105 Bacteria 3071
410 Ga0157369_10111785 3300013105 Bacteria 2903
411 Ga0157369_10602100 3300013105 Bacteria 1134
412 Ga0157374_10000567 3300013296 Bacteria 32753
413 Ga0157374_10001092 3300013296 Bacteria 23356
414 Ga0157374_10002984 3300013296 Bacteria 14164
415 Ga0157374_10008704 3300013296 Bacteria 8680
416 Ga0157374_10043895 3300013296 Bacteria 4130
417 Ga0157374_10111210 3300013296 Bacteria 2635
418 Ga0157374_10125363 3300013296 Bacteria 2482
419 Ga0157374_10154667 3300013296 Bacteria 2231
420 Ga0157378_10000104 3300013297 Bacteria 80068
421 Ga0157378_10000151 3300013297 Bacteria 65215
422 Ga0157378_10000686 3300013297 Bacteria 31832
423 Ga0157378_10040368 3300013297 Bacteria 4138
424 Ga0157378_10067348 3300013297 Bacteria 3208
425 Ga0157378_10128829 3300013297 Bacteria 2340
426 Ga0157378_10262763 3300013297 Bacteria 1657
427 Ga0163162_10002065 3300013306 Bacteria 18873
428 Ga0163162_10019988 3300013306 Bacteria 6577
429 Ga0163162_10179078 3300013306 Bacteria 2246
430 Ga0163162_10425636 3300013306 Bacteria 1460
431 Ga0163162_10623645 3300013306 Bacteria 1203
432 Ga0163162_10674784 3300013306 Unclassified 1156
433 Ga0157372_10000242 3300013307 Bacteria 60460
434 Ga0157372_10001206 3300013307 Bacteria 27941
435 Ga0157372_10021173 3300013307 Bacteria 7024
436 Ga0157372_10028555 3300013307 Bacteria 6089
437 Ga0157372_10033716 3300013307 Bacteria 5626
438 Ga0157372_10048057 3300013307 Unclassified 4743
439 Ga0157372_10071446 3300013307 Bacteria 3908
440 Ga0157372_10207642 3300013307 Bacteria 2269
441 Ga0157372_10410757 3300013307 Unclassified 1577
442 Ga0157372_10517586 3300013307 Bacteria 1391
443 Ga0157372_10679332 3300013307 Bacteria 1198
444 Ga0157375_10214888 3300013308 Unclassified 2081
445 Ga0157375_10275025 3300013308 Unclassified 1846
446 Ga0163163_10000958 3300014325 Bacteria 24503
447 Ga0163163_10038041 3300014325 Bacteria 4685
448 Ga0163163_10123035 3300014325 Bacteria 2629
449 Ga0163163_10186870 3300014325 Bacteria 2120
450 Ga0163163_10213891 3300014325 Unclassified 1977
451 Ga0163163_10229886 3300014325 Unclassified 1904
452 Ga0182008_10006892 3300014497 Bacteria 6315
453 Ga0157377_10000467 3300014745 Bacteria 17434
454 Ga0157377_10086543 3300014745 Bacteria 1842
455 Ga0157379_10015074 3300014968 Bacteria 6780
456 Ga0157379_10016233 3300014968 Bacteria 6552
457 Ga0157379_10037518 3300014968 Bacteria 4322
458 Ga0157379_10460502 3300014968 Bacteria 1175
459 Ga0157376_10006340 3300014969 Bacteria 8355
460 Ga0157376_10040819 3300014969 Bacteria 3795
461 Ga0157376_10236564 3300014969 Bacteria 1699
462 Ga0182006_1018783 3300015261 Bacteria 2916
463 Ga0182007_10021918 3300015262 Bacteria 2262
464 Ga0182005_1009501 3300015265 Bacteria 2829
465 Ga0213873_10020417 3300021358 Bacteria 1547
466 Ga0213874_10004832 3300021377 Bacteria 3108
467 Ga0213874_10008783 3300021377 Unclassified 2475
468 Ga0224569_100235 3300022732 Bacteria 4574
469 Ga0224572_1020124 3300024225 Unclassified 1282
470 Ga0228598_1000123 3300024227 Bacteria 13117
471 Ga0228598_1012618 3300024227 Bacteria 1678
472 Ga0207697_10002916 3300025315 Bacteria 8654
473 Ga0207656_10044557 3300025321 Bacteria 1895
474 Ga0207682_10003786 3300025893 Bacteria 6496
475 Ga0207692_10005206 3300025898 Bacteria 5192
476 Ga0207692_10102007 3300025898 Bacteria 1577
477 Ga0207692_10121944 3300025898 Bacteria 1461
478 Ga0207642_10027052 3300025899 Bacteria 2343
479 Ga0207642_10031016 3300025899 Bacteria 2235
480 Ga0207642_10078826 3300025899 Bacteria 1593
481 Ga0207710_10003898 3300025900 Bacteria 6589
482 Ga0207710_10124601 3300025900 Bacteria 1233
483 Ga0207688_10000372 3300025901 Bacteria 20907
484 Ga0207680_10013123 3300025903 Bacteria 4245
485 Ga0207680_10041482 3300025903 Bacteria 2685
486 Ga0207647_10007186 3300025904 Bacteria 8069
487 Ga0207647_10025887 3300025904 Bacteria 3846
488 Ga0207699_10002709 3300025906 Bacteria 8378
489 Ga0207699_10027886 3300025906 Bacteria 3132
490 Ga0207699_10051162 3300025906 Bacteria 2440
491 Ga0207699_10293990 3300025906 Bacteria 1132
492 Ga0207645_10000051 3300025907 Bacteria 84255
493 Ga0207645_10022895 3300025907 Bacteria 4060
494 Ga0207643_10000079 3300025908 Bacteria 63366
495 Ga0207705_10030843 3300025909 Unclassified 3826
496 Ga0207684_10000311 3300025910 Bacteria 69074
497 Ga0207684_10001754 3300025910 Bacteria 22933
498 Ga0207684_10013315 3300025910 Bacteria 7115
499 Ga0207684_10016755 3300025910 Bacteria 6292
500 Ga0207654_10004043 3300025911 Bacteria 7383
501 Ga0207654_10009332 3300025911 Bacteria 4980
502 Ga0207654_10014943 3300025911 Bacteria 4019
503 Ga0207654_10023432 3300025911 Bacteria 3307
504 Ga0207707_10000127 3300025912 Bacteria 78669
505 Ga0207707_10013860 3300025912 Bacteria 7030
506 Ga0207707_10053101 3300025912 Bacteria 3527
507 Ga0207707_10074436 3300025912 Bacteria 2962
508 Ga0207695_10011737 3300025913 Bacteria 10580
509 Ga0207695_10028217 3300025913 Bacteria 6230
510 Ga0207695_10034398 3300025913 Bacteria 5512
511 Ga0207695_10092563 3300025913 Bacteria 3033
512 Ga0207695_10170732 3300025913 Bacteria 2100
513 Ga0207671_10036278 3300025914 Bacteria 3656
514 Ga0207671_10052188 3300025914 Bacteria 3030
515 Ga0207671_10247140 3300025914 Unclassified 1402
516 Ga0207671_10261186 3300025914 Unclassified 1363
517 Ga0207693_10000119 3300025915 Bacteria 69804
518 Ga0207693_10000362 3300025915 Bacteria 41574
519 Ga0207693_10000457 3300025915 Bacteria 37236
520 Ga0207693_10002950 3300025915 Bacteria 14728
521 Ga0207693_10004359 3300025915 Bacteria 11968
522 Ga0207693_10016269 3300025915 Bacteria 5947
523 Ga0207693_10026570 3300025915 Bacteria 4580
524 Ga0207693_10029207 3300025915 Bacteria 4357
525 Ga0207693_10137434 3300025915 Bacteria 1922
526 Ga0207663_10002106 3300025916 Bacteria 9481
527 Ga0207663_10004317 3300025916 Bacteria 7055
528 Ga0207663_10007244 3300025916 Bacteria 5742
529 Ga0207663_10008816 3300025916 Bacteria 5301
530 Ga0207663_10208298 3300025916 Bacteria 1415
531 Ga0207663_10381026 3300025916 Unclassified 1074
532 Ga0207660_10103759 3300025917 Bacteria 2128
533 Ga0207662_10023390 3300025918 Unclassified 3550
534 Ga0207657_10000246 3300025919 Bacteria 57698
535 Ga0207657_10000292 3300025919 Bacteria 53366
536 Ga0207657_10001266 3300025919 Bacteria 26953
537 Ga0207657_10314117 3300025919 Bacteria 1240
538 Ga0207649_10000242 3300025920 Bacteria 44166
539 Ga0207649_10011296 3300025920 Bacteria 4921
540 Ga0207652_10021090 3300025921 Bacteria 5375
541 Ga0207652_10052352 3300025921 Bacteria 3503
542 Ga0207652_10062363 3300025921 Bacteria 3221
543 Ga0207652_10070448 3300025921 Bacteria 3037
544 Ga0207652_10071878 3300025921 Bacteria 3007
545 Ga0207652_10368458 3300025921 Unclassified 1297
546 Ga0207646_10000565 3300025922 Bacteria 48737
547 Ga0207646_10002216 3300025922 Bacteria 23136
548 Ga0207646_10106702 3300025922 Bacteria 2512
549 Ga0207646_10111939 3300025922 Bacteria 2450
550 Ga0207646_10623807 3300025922 Bacteria 967
551 Ga0207681_10046219 3300025923 Bacteria 2927
552 Ga0207694_10001306 3300025924 Bacteria 21454
553 Ga0207694_10137574 3300025924 Bacteria 1963
554 Ga0207694_10140319 3300025924 Bacteria 1943
555 Ga0207694_10154911 3300025924 Bacteria 1847
556 Ga0207694_10558443 3300025924 Unclassified 961
557 Ga0207650_10000090 3300025925 Bacteria 118973
558 Ga0207650_10007969 3300025925 Bacteria 7222
559 Ga0207659_10002035 3300025926 Bacteria 11997
560 Ga0207687_10004238 3300025927 Bacteria 9587
561 Ga0207687_10011229 3300025927 Bacteria 5850
562 Ga0207687_10148099 3300025927 Bacteria 1788
563 Ga0207687_10271631 3300025927 Bacteria 1356
564 Ga0207687_10663359 3300025927 Bacteria 883
565 Ga0207700_10000528 3300025928 Bacteria 22511
566 Ga0207700_10002119 3300025928 Bacteria 11337
567 Ga0207700_10003068 3300025928 Bacteria 9645
568 Ga0207700_10008312 3300025928 Bacteria 6419
569 Ga0207700_10030361 3300025928 Unclassified 3827
570 Ga0207700_10052588 3300025928 Bacteria 3046
571 Ga0207700_10057649 3300025928 Bacteria 2930
572 Ga0207700_10092278 3300025928 Bacteria 2394
573 Ga0207664_10000165 3300025929 Bacteria 53011
574 Ga0207664_10004851 3300025929 Bacteria 9146
575 Ga0207664_10081835 3300025929 Bacteria 2629
576 Ga0207664_10170502 3300025929 Bacteria 1862
577 Ga0207664_10251504 3300025929 Bacteria 1542
578 Ga0207664_10455318 3300025929 Unclassified 1142
579 Ga0207644_10002582 3300025931 Bacteria 11652
580 Ga0207644_10599867 3300025931 Bacteria 914
581 Ga0207690_10003087 3300025932 Bacteria 10034
582 Ga0207690_10010651 3300025932 Bacteria 5478
583 Ga0207690_10203468 3300025932 Unclassified 1505
584 Ga0207706_10000139 3300025933 Bacteria 79096
585 Ga0207706_10000640 3300025933 Bacteria 37158
586 Ga0207706_10079906 3300025933 Bacteria 2876
587 Ga0207686_10035211 3300025934 Bacteria 3003
588 Ga0207686_10089477 3300025934 Bacteria 2029
589 Ga0207686_10090666 3300025934 Unclassified 2017
590 Ga0207709_10171480 3300025935 Unclassified 1523
591 Ga0207670_10001693 3300025936 Bacteria 11493
592 Ga0207704_10012294 3300025938 Bacteria 4247
593 Ga0207704_10223177 3300025938 Bacteria 1396
594 Ga0207704_10447185 3300025938 Bacteria 1030
595 Ga0207665_10002897 3300025939 Bacteria 11511
596 Ga0207665_10024039 3300025939 Bacteria 4015
597 Ga0207665_10028063 3300025939 Bacteria 3718
598 Ga0207665_10070289 3300025939 Archaea 2388
599 Ga0207665_10257129 3300025939 Bacteria 1292
600 Ga0207665_10307124 3300025939 Bacteria 1187
601 Ga0207691_10001343 3300025940 Bacteria 24540
602 Ga0207711_10002838 3300025941 Bacteria 15224
603 Ga0207711_10011787 3300025941 Bacteria 7263
604 Ga0207689_10000304 3300025942 Bacteria 45071
605 Ga0207689_10001053 3300025942 Bacteria 26527
606 Ga0207689_10039634 3300025942 Bacteria 3900
607 Ga0207661_10000583 3300025944 Bacteria 23334
608 Ga0207661_10023933 3300025944 Bacteria 4621
609 Ga0207661_10185193 3300025944 Unclassified 1821
610 Ga0207661_10440149 3300025944 Bacteria 1186
611 Ga0207679_10000184 3300025945 Bacteria 51157
612 Ga0207679_10005367 3300025945 Bacteria 8036
613 Ga0207679_10027166 3300025945 Bacteria 3955
614 Ga0207679_10040898 3300025945 Bacteria 3321
615 Ga0207667_10004029 3300025949 Bacteria 18047
616 Ga0207667_10020400 3300025949 Bacteria 7371
617 Ga0207667_10071649 3300025949 Bacteria 3603
618 Ga0207667_10103960 3300025949 Bacteria 2929
619 Ga0207667_10107244 3300025949 Bacteria 2881
620 Ga0207667_10311841 3300025949 Bacteria 1607
621 Ga0207667_10528456 3300025949 Unclassified 1195
622 Ga0207651_10002456 3300025960 Bacteria 8859
623 Ga0207651_10107201 3300025960 Bacteria 2088
624 Ga0207651_10281777 3300025960 Bacteria 1374
625 Ga0207712_10023786 3300025961 Bacteria 4048
626 Ga0207712_10024542 3300025961 Bacteria 3995
627 Ga0207712_10119906 3300025961 Bacteria 1988
628 Ga0207640_10015374 3300025981 Bacteria 4429
629 Ga0207640_10036120 3300025981 Bacteria 3099
630 Ga0207640_10036188 3300025981 Bacteria 3097
631 Ga0207640_10078421 3300025981 Unclassified 2248
632 Ga0207658_10001983 3300025986 Bacteria 15269
633 Ga0207658_10041406 3300025986 Bacteria 3335
634 Ga0207677_10005049 3300026023 Bacteria 7132
635 Ga0207677_10006393 3300026023 Bacteria 6462
636 Ga0207677_10057478 3300026023 Bacteria 2671
637 Ga0207677_10459496 3300026023 Unclassified 1093
638 Ga0207703_10001863 3300026035 Bacteria 18753
639 Ga0207703_10005260 3300026035 Bacteria 10438
640 Ga0207703_10012716 3300026035 Bacteria 6562
641 Ga0207703_10034192 3300026035 Bacteria 4033
642 Ga0207703_10448356 3300026035 Bacteria 1205
643 Ga0207639_10046457 3300026041 Bacteria 3276
644 Ga0207639_10223963 3300026041 Bacteria 1626
645 Ga0207678_10000204 3300026067 Bacteria 52306
646 Ga0207678_10004676 3300026067 Bacteria 12295
647 Ga0207702_10000704 3300026078 Bacteria 35989
648 Ga0207702_10005927 3300026078 Bacteria 10617
649 Ga0207702_10014881 3300026078 Bacteria 6453
650 Ga0207702_10015530 3300026078 Bacteria 6303
651 Ga0207702_10016745 3300026078 Bacteria 6067
652 Ga0207702_10028337 3300026078 Bacteria 4655
653 Ga0207702_10145508 3300026078 Bacteria 2150
654 Ga0207702_10155741 3300026078 Bacteria 2083
655 Ga0207702_10181513 3300026078 Bacteria 1938
656 Ga0207641_10000894 3300026088 Bacteria 31042
657 Ga0207641_10026028 3300026088 Bacteria 4827
658 Ga0207641_10035294 3300026088 Bacteria 4165
659 Ga0207641_10078652 3300026088 Unclassified 2857
660 Ga0207641_10283961 3300026088 Bacteria 1558
661 Ga0207648_10000757 3300026089 Bacteria 36296
662 Ga0207648_10003612 3300026089 Bacteria 16172
663 Ga0207648_10294286 3300026089 Bacteria 1454
664 Ga0207648_10357029 3300026089 Bacteria 1318
665 Ga0207676_10000113 3300026095 Bacteria 73022
666 Ga0207676_10004935 3300026095 Bacteria 9456
667 Ga0207676_10114539 3300026095 Bacteria 2262
668 Ga0207674_10000076 3300026116 Bacteria 104404
669 Ga0207674_10008255 3300026116 Bacteria 12057
670 Ga0207674_10009505 3300026116 Bacteria 11102
671 Ga0207674_10017787 3300026116 Bacteria 7749
672 Ga0207674_10049003 3300026116 Bacteria 4322
673 Ga0207675_100008819 3300026118 Bacteria 9464
674 Ga0207675_100112550 3300026118 Unclassified 2569
675 Ga0207675_100252047 3300026118 Bacteria 1709
676 Ga0207683_10001129 3300026121 Bacteria 24286
677 Ga0207683_10317610 3300026121 Bacteria 1426
678 Ga0207698_10044147 3300026142 Bacteria 3346
679 Ga0207698_10190368 3300026142 Bacteria 1827
680 Ga0265356_1000298 3300028017 Bacteria 9271
681 Ga0268266_10005373 3300028379 Bacteria 11969
682 Ga0268265_10002144 3300028380 Bacteria 15280
683 Ga0268265_10063459 3300028380 Unclassified 2842
684 Ga0268265_10079197 3300028380 Unclassified 2587
685 Ga0268264_10016388 3300028381 Bacteria 6066
686 Ga0268264_10016978 3300028381 Bacteria 5960
687 Ga0268264_10075570 3300028381 Bacteria 2865
688 Ga0265338_10000750 3300028800 Bacteria 55295
689 Ga0265338_10005847 3300028800 Bacteria 15876
690 Ga0265338_10055749 3300028800 Unclassified 3513
691 Ga0265338_10098810 3300028800 Bacteria 2386
692 Ga0265338_10149453 3300028800 Bacteria 1817
693 Ga0265762_1000030 3300030760 Bacteria 15999
694 Ga0265762_1000238 3300030760 Bacteria 8907
695 Ga0265760_10001710 3300031090 Bacteria 6454
696 Ga0265760_10003216 3300031090 Bacteria 4783
697 Ga0265760_10007818 3300031090 Bacteria 3054
698 Ga0265332_10145196 3300031238 Bacteria 993
699 Ga0265328_10022041 3300031239 Bacteria 2427
700 Ga0265328_10056880 3300031239 Unclassified 1435
701 Ga0265325_10032315 3300031241 Bacteria 2794
702 Ga0265325_10072788 3300031241 Bacteria 1721
703 Ga0265325_10081413 3300031241 Bacteria 1609
704 Ga0265340_10008487 3300031247 Bacteria 5544
705 Ga0265340_10015846 3300031247 Bacteria 3911
706 Ga0265340_10024956 3300031247 Unclassified 3032
707 Ga0265339_10004196 3300031249 Bacteria 9880
708 Ga0265339_10014860 3300031249 Bacteria 4682
709 Ga0265339_10034652 3300031249 Bacteria 2835
710 Ga0265339_10096303 3300031249 Bacteria 1545
711 Ga0265339_10141199 3300031249 Unclassified 1225
712 Ga0265327_10032110 3300031251 Bacteria 2942
713 Ga0265316_10010624 3300031344 Bacteria 8375
714 Ga0265316_10010927 3300031344 Bacteria 8242
715 Ga0265316_10014931 3300031344 Bacteria 6811
716 Ga0265316_10086374 3300031344 Unclassified 2398
717 Ga0265316_10298086 3300031344 Bacteria 1175
718 Ga0265316_10348815 3300031344 Bacteria 1072
719 Ga0307408_100009058 3300031548 Bacteria 6574
720 Ga0265313_10035068 3300031595 Bacteria 2530
721 Ga0265314_10031361 3300031711 Bacteria 3925
722 Ga0265314_10079739 3300031711 Bacteria 2163
723 Ga0265314_10123316 3300031711 Unclassified 1627
724 Ga0265342_10057462 3300031712 Unclassified 2303
725 Ga0307405_10026721 3300031731 Bacteria 3335
726 Ga0307405_10060022 3300031731 Bacteria 2399
727 Ga0307410_10007103 3300031852 Bacteria 6107
728 Ga0307410_10108380 3300031852 Bacteria 2005
729 Ga0307407_10057069 3300031903 Unclassified 2264
730 Ga0307409_100001571 3300031995 Bacteria 11371
731 Ga0307409_100060913 3300031995 Bacteria 2946
732 Ga0307416_100043835 3300032002 Bacteria 3507
733 Ga0307411_10023898 3300032005 Bacteria 3632
734 Ga0307415_100002646 3300032126 Bacteria 8933
735 Ga0316212_1005580 3300033547 Bacteria 1827
736 Ga0373926_0028490 3300035083 Archaea 1960
737 Ga0373926_0088761 3300035083 Bacteria 1148
738 Ga0373928_0011668 3300035084 Bacteria 1744
739 Ga0373934_0040916 3300035086 Unclassified 1829
740 Ga0373949_0045606 3300035090 Unclassified 1090
741 Ga0373936_0027518 3300035113 Unclassified 2230
742 Ga0373945_0046101 3300035116 Bacteria 1590
743 Ga0373943_0013463 3300035170 Bacteria 3695
744 Ga0373943_0085500 3300035170 Bacteria 1625
745 Ga0373946_0079993 3300035171 Bacteria 1429
746 Ga0373931_0115290 3300035691 Unclassified 1529
747 Ga0373935_0008799 3300035692 Bacteria 6046
748 Ga0373935_0010017 3300035692 Bacteria 5679
749 Ga0373935_0017021 3300035692 Bacteria 4404
750 Ga0373935_0034720 3300035692 Bacteria 3145
751 Ga0373927_0000234 3300035695 Bacteria 43438
752 Ga0373927_0016852 3300035695 Unclassified 4818
753 Ga0373927_0027365 3300035695 Bacteria 3723
754 Ga0373927_0095825 3300035695 Bacteria 1929
755 Ga0373927_0109457 3300035695 Bacteria 1800
756 Ga0373927_0126907 3300035695 Unclassified 1666
757 Ga0373927_0143288 3300035695 Bacteria 1564
758 Ga0373933_0055424 3300035724 Bacteria 2378
759 Ga0373947_0025855 3300035725 Bacteria 3425
760 Ga0373947_0057018 3300035725 Bacteria 2362
761 Ga0373947_0129275 3300035725 Bacteria 1611
762 Ga0373947_0229671 3300035725 Bacteria 1222
763 Ga0373937_0000596 3300036401 Bacteria 31987
764 Ga0373937_0024205 3300036401 Bacteria 5473
765 Ga0373937_0033409 3300036401 Bacteria 4672
766 Ga0373937_0035986 3300036401 Bacteria 4510
767 Ga0373937_0053014 3300036401 Bacteria 3720
768 Ga0373937_0259428 3300036401 Unclassified 1639
769 Ga0373925_0000227 3300037068 Bacteria 60089
770 Ga0373925_0001086 3300037068 Bacteria 24439
771 Ga0373925_0002762 3300037068 Bacteria 13893
772 Ga0373925_0037329 3300037068 Bacteria 3587
773 Ga0373925_0129281 3300037068 Bacteria 1968
774 Ga0373925_0276718 3300037068 Bacteria 1351
775 Ga0395898_0163122 3300037466 Bacteria 2132
776 Ga0395898_0337093 3300037466 Bacteria 1438
777 Ga0395905_0071991 3300037471 Bacteria 3241
778 Ga0436365_0696718 3300039437 Unclassified 2177
779 Ga0436360_0051252 3300039438 Bacteria 3043
780 Ga0436363_0131185 3300039450 Unclassified 2496
781 Ga0436363_0265047 3300039450 Bacteria 11625
782 Ga0436363_1291424 3300039450 Unclassified 1559
783 Ga0436362_0848211 3300039453 Bacteria 15307
784 Ga0466963_0001890 3300044694 Bacteria 11437
785 Ga0466964_0039615 3300044706 Bacteria 1900
786 Ga0451576_0279170 3300045051 Bacteria 1747
787 Ga0451576_0541994 3300045051 Bacteria 1222
788 Ga0466958_0109890 3300045836 Bacteria 1721
789 Ga0466967_0004535 3300045976 Bacteria 9396
790 Ga0466967_0014796 3300045976 Bacteria 6095
791 Ga0466967_0020702 3300045976 Bacteria 5325
792 Ga0466967_0032045 3300045976 Bacteria 4434
793 Ga0466967_0035164 3300045976 Bacteria 4261
794 Ga0466967_0049777 3300045976 Bacteria 3667
795 Ga0466967_0248782 3300045976 Unclassified 1697
796 Ga0495653_0140819 3300046463 Unclassified 1697
797 Ga0495580_0005751 3300046472 Bacteria 10184
798 Ga0495580_0008637 3300046472 Bacteria 8080
799 Ga0495580_0012343 3300046472 Bacteria 6555
800 Ga0495580_0015718 3300046472 Bacteria 5703
801 Ga0495580_0037477 3300046472 Bacteria 3480
802 Ga0495580_0166087 3300046472 Bacteria 1527
803 Ga0495580_0176228 3300046472 Bacteria 1477
804 Ga0495580_0200031 3300046472 Bacteria 1377
805 Ga0495580_0234470 3300046472 Bacteria 1259
806 Ga0495580_0268783 3300046472 Unclassified 1165
807 Ga0495582_0001766 3300046473 Bacteria 12202
808 Ga0495582_0031347 3300046473 Unclassified 2922
809 Ga0495582_0081946 3300046473 Archaea 1792
810 Ga0495639_0056561 3300046475 Bacteria 1791
811 Ga0495639_0075273 3300046475 Bacteria 1565
812 Ga0495664_0061642 3300046477 Bacteria 2233
813 Ga0495628_0018123 3300046516 Bacteria 5839
814 Ga0495630_0156140 3300046517 Bacteria 1737
815 Ga0495630_0208437 3300046517 Unclassified 1492
816 Ga0495642_0176289 3300046528 Unclassified 930
817 Ga0495665_0010815 3300046531 Unclassified 4938
818 Ga0495665_0114191 3300046531 Unclassified 1415
819 Ga0495635_0096577 3300046663 Unclassified 2020
820 Ga0495635_0305274 3300046663 Bacteria 1067
821 Ga0495657_0226724 3300046675 Archaea 1131
822 Ga0495623_0024206 3300046679 Bacteria 3916
823 Ga0495623_0034506 3300046679 Bacteria 3244
824 Ga0495623_0083416 3300046679 Unclassified 1974
825 Ga0495658_0054459 3300046683 Unclassified 2276
826 Ga0495669_0085856 3300046684 Bacteria 1449
827 Ga0495674_0033176 3300047319 Bacteria 4679
828 Ga0495676_0144491 3300047321 Unclassified 1701
829 Ga0495676_0157824 3300047321 Bacteria 1608
830 Ga0495593_0142438 3300047673 Bacteria 1214
831 Ga0495602_0055511 3300048088 Bacteria 3488
832 Ga0495602_0135117 3300048088 Bacteria 1961
833 Ga0495602_0269147 3300048088 Bacteria 1260
834 Ga0495614_0041711 3300048089 Archaea 1969
835 Ga0496100_0003857 3300048903 Bacteria 7862
836 Ga0496100_0130159 3300048903 Bacteria 1772
837 Ga0496100_0214169 3300048903 Unclassified 1411
838 Ga0496101_0003461 3300048904 Bacteria 9848
839 Ga0496101_0382047 3300048904 Unclassified 1108
840 Ga0496102_0000537 3300048905 Bacteria 40994
841 Ga0496102_0103108 3300048905 Bacteria 2653
842 Ga0496102_0195843 3300048905 Bacteria 1904
843 Ga0496102_0272738 3300048905 Unclassified 1595
844 Ga0496103_0010438 3300048906 Bacteria 5496
845 Ga0496103_0011600 3300048906 Bacteria 5225
846 Ga0496103_0053924 3300048906 Unclassified 2492
847 Ga0496104_0035988 3300048907 Bacteria 4625
848 Ga0496104_0036653 3300048907 Unclassified 4585
849 Ga0496104_0050923 3300048907 Bacteria 3907
850 Ga0496104_0227846 3300048907 Bacteria 1776
851 Ga0496104_0653712 3300048907 Bacteria 960
852 Ga0496105_0031508 3300048908 Unclassified 4347
853 Ga0496105_0110162 3300048908 Bacteria 2273
854 Ga0496105_0139926 3300048908 Bacteria 1993
855 Ga0496105_0249987 3300048908 Unclassified 1437
856 Ga0496106_0062827 3300048909 Unclassified 2821
857 Ga0496106_0097339 3300048909 Unclassified 2278
858 Ga0496106_0113740 3300048909 Bacteria 2110
859 Ga0496107_0052486 3300048910 Bacteria 2941
860 Ga0496107_0140506 3300048910 Unclassified 1785
861 Ga0496108_0002118 3300048911 Bacteria 15901
862 Ga0496108_0035693 3300048911 Bacteria 4134
863 Ga0496108_0094357 3300048911 Unclassified 2547
864 Ga0496109_0000008 3300048912 Bacteria 245809
865 Ga0496109_0039890 3300048912 Bacteria 4251
866 Ga0496109_0184031 3300048912 Bacteria 1963
867 Ga0496109_0195916 3300048912 Bacteria 1899
868 Ga0496109_0209122 3300048912 Unclassified 1835
869 Ga0496110_0051224 3300048913 Bacteria 3628
870 Ga0496110_0094519 3300048913 Bacteria 2677
871 Ga0496110_0129613 3300048913 Bacteria 2277
872 Ga0496111_0014712 3300048914 Bacteria 5352
873 Ga0496112_0000334 3300048915 Bacteria 30562
874 Ga0496112_0001099 3300048915 Bacteria 20026
875 Ga0496112_0005467 3300048915 Bacteria 10996
876 Ga0496112_0013062 3300048915 Bacteria 7661
877 Ga0496112_0037620 3300048915 Bacteria 4723
878 Ga0496112_0041732 3300048915 Bacteria 4489
879 Ga0496112_0050195 3300048915 Bacteria 4090
880 Ga0496112_0082762 3300048915 Bacteria 3174
881 Ga0496112_0141816 3300048915 Unclassified 2372
882 Ga0496112_0328175 3300048915 Unclassified 1474
883 Ga0496112_0433018 3300048915 Bacteria 1253
884 Ga0496112_0445385 3300048915 Unclassified 1233
885 Ga0496113_0000238 3300048916 Bacteria 25957
886 Ga0496113_0005618 3300048916 Bacteria 7846
887 Ga0496113_0113103 3300048916 Bacteria 2115
888 Ga0496114_0028113 3300048917 Bacteria 4612
889 Ga0496114_0126229 3300048917 Bacteria 2206
890 Ga0496115_0004624 3300048918 Bacteria 9960
891 Ga0496115_0016349 3300048918 Bacteria 5648
892 Ga0496115_0070340 3300048918 Bacteria 2837
893 Ga0501073_0038132 3300049589 Unclassified 3411
894 Ga0501245_025829 3300049708 Unclassified 946
895 Ga0501083_0255154 3300049744 Bacteria 1141
896 nmdc:mga05p37_104900_c1 3300050507 Bacteria 3477
897 nmdc:mga05p37_318014_c1 3300050507 Unclassified 1843
898 nmdc:mga0n895_50045_c1 3300050512 Bacteria 4096
899 nmdc:mga0n895_634_c1 3300050512 Bacteria 24414
900 nmdc:mga0n895_85268_c1 3300050512 Bacteria 3153
901 nmdc:mga0rr50_297315_c1 3300050513 Unclassified 1350
902 nmdc:mga0rr50_34917_c1 3300050513 Unclassified 3606
903 nmdc:mga0rr50_370252_c1 3300050513 Unclassified 1207
904 nmdc:mga0rr50_66550_c1 3300050513 Bacteria 2734
905 nmdc:mga0rr50_85082_c1 3300050513 Unclassified 2450
906 nmdc:mga08x19_10856_c1 3300050514 Bacteria 5478
907 nmdc:mga08x19_158610_c1 3300050514 Unclassified 1536
908 nmdc:mga08x19_18527_c1 3300050514 Unclassified 4267
909 nmdc:mga08x19_233356_c1 3300050514 Bacteria 1267
910 nmdc:mga08x19_6888_c1 3300050514 Bacteria 6749
911 nmdc:mga0a205_365708_c1 3300050515 Bacteria 1309
912 Ga0495619_0071569 3300053085 Unclassified 2321
913 Ga0501084_0199022 3300054114 Bacteria 1690
914 Ga0587091_015504 3300059511 Unclassified 1259
915 Ga0157375_10003505
916 LJNas_1000849
917 JGI24743J22301_10000093
918 JGI24748J21848_1003187
919 JGI24034J26672_10001180
920 JGI24751J29686_10000635
921 Ga0065712_10114404
922 Ga0065712_10141661
923 Ga0070658_10319675
924 Ga0070676_10005283
925 Ga0070676_10041193
926 Ga0070683_100001910
927 Ga0070683_100022151
928 Ga0070683_100061135
929 Ga0070683_100104700
930 Ga0070690_100003363
931 Ga0070690_100070525
932 Ga0070670_100001939
933 Ga0070670_100006041
934 Ga0070670_100216357
935 Ga0068869_100001662
936 Ga0068869_100028706
937 Ga0070666_10008180
938 Ga0070666_10090596
939 Ga0070680_100030773
940 Ga0070680_100067974
941 Ga0070680_100089406
942 Ga0070680_100109169
943 Ga0070682_100003286
944 Ga0070682_100051417
945 Ga0070682_100105957
946 Ga0068868_100000991
947 Ga0068868_100001388
948 Ga0068868_100026812
949 Ga0068868_100059864
950 Ga0068868_100082544
951 Ga0068868_100217838
952 Ga0070660_100006387
953 Ga0070660_100038052
954 Ga0070660_100342498
955 Ga0070689_100001082
956 Ga0070689_100058095
957 Ga0070691_10075503
958 Ga0070687_100006182
959 Ga0070661_100009183
960 Ga0070661_100009221
961 Ga0070661_100013353
962 Ga0070661_100354113
963 Ga0070661_100385656
964 Ga0070692_10097853
965 Ga0070692_10182399
966 Ga0070668_100004887
967 Ga0070669_100001365
968 Ga0070669_100136207
969 Ga0070675_100167505
970 Ga0070675_100274711
971 Ga0070671_100153160
972 Ga0070673_100009008
973 Ga0070673_100209855
974 Ga0070673_100334647
975 Ga0070688_100000289
976 Ga0070659_100002441
977 Ga0070659_100017607
978 Ga0070659_100102405
979 Ga0070667_100060743
980 Ga0070667_100160758
981 Ga0070667_100338983
982 Ga0070709_10002030
983 Ga0070709_10079424
984 Ga0070709_10180861
985 Ga0070709_10189359
986 Ga0070709_10243746
987 Ga0070714_100001155
988 Ga0070714_100002082
989 Ga0070714_100007533
990 Ga0070714_100068882
991 Ga0070714_100070692
992 Ga0070714_100140930
993 Ga0070714_100151946
994 Ga0070714_100215517
995 Ga0070713_100000222
996 Ga0070713_100001170
997 Ga0070713_100003074
998 Ga0070713_100008216
999 Ga0070713_100013181
1000 Ga0070713_100036869
1001 Ga0070713_100053651
1002 Ga0070713_100068656
1003 Ga0070713_100086410
1004 Ga0070713_100115254
1005 Ga0070713_100128906
1006 Ga0070713_100252448
1007 Ga0070710_10064456
1008 Ga0070710_10115611
1009 Ga0070710_10160200
1010 Ga0070711_100003515
1011 Ga0070711_100006478
1012 Ga0070711_100008083
1013 Ga0070711_100046532
1014 Ga0070711_100290878
1015 Ga0070711_100555484
1016 Ga0070708_100000263
1017 Ga0070708_100002193
1018 Ga0070708_100003924
1019 Ga0070708_100022080
1020 Ga0070708_100054662
1021 Ga0070708_100061202
1022 Ga0070708_100073804
1023 Ga0070708_100087773
1024 Ga0070708_100102864
1025 Ga0070708_100143700
1026 Ga0070708_100246442
1027 Ga0070708_100260683
1028 Ga0070663_100023409
1029 Ga0070663_100028694
1030 Ga0070678_100002783
1031 Ga0070678_100023075
1032 Ga0070662_100002426
1033 Ga0070662_100007363
1034 Ga0070662_100064072
1035 Ga0070681_10000091
1036 Ga0070681_10032433
1037 Ga0070681_10370703
1038 Ga0070681_10465894
1039 Ga0068867_100000749
1040 Ga0068867_100017844
1041 Ga0068867_100197187
1042 Ga0070685_10001601
1043 Ga0070706_100000869
1044 Ga0070706_100001289
1045 Ga0070706_100010747
1046 Ga0070706_100011557
1047 Ga0070706_100042587
1048 Ga0070706_100129894
1049 Ga0070706_100276923
1050 Ga0070706_100364583
1051 Ga0070707_100000557
1052 Ga0070707_100010726
1053 Ga0070707_100128409
1054 Ga0070707_100139063
1055 Ga0070707_100175140
1056 Ga0070707_100378333
1057 Ga0070707_100786964
1058 Ga0070698_100000456
1059 Ga0070698_100001775
1060 Ga0070698_100226784
1061 Ga0070698_100401925
1062 Ga0070699_100000340
1063 Ga0070699_100001799
1064 Ga0070699_100011106
1065 Ga0070699_100044872
1066 Ga0070699_100068714
1067 Ga0070699_100488840
1068 Ga0070699_100509746
1069 Ga0070679_100007789
1070 Ga0070679_100114065
1071 Ga0070679_100207479
1072 Ga0070679_100252336
1073 Ga0070679_100351292
1074 Ga0070679_100353088
1075 Ga0070684_100001382
1076 Ga0070684_100007536
1077 Ga0070684_100042554
1078 Ga0070684_100043347
1079 Ga0070697_100000496
1080 Ga0070697_100000770
1081 Ga0070697_100001425
1082 Ga0070697_100003073
1083 Ga0070697_100012017
1084 Ga0070697_100045210
1085 Ga0070697_100133441
1086 Ga0070697_100210408
1087 Ga0070697_100298592
1088 Ga0068853_100004992
1089 Ga0068853_100028987
1090 Ga0068853_100054550
1091 Ga0068853_100318746
1092 Ga0070672_100002640
1093 Ga0070672_100239366
1094 Ga0070686_100002027
1095 Ga0070696_100094516
1096 Ga0070696_100206286
1097 Ga0070693_100024209
1098 Ga0070693_100394450
1099 Ga0068855_100004016
1100 Ga0068855_100023553
1101 Ga0068855_100056359
1102 Ga0068855_100058865
1103 Ga0068855_100121688
1104 Ga0068855_100164357
1105 Ga0068855_100298188
1106 Ga0070664_100000782
1107 Ga0070664_100006830
1108 Ga0070664_100104985
1109 Ga0070664_100402222
1110 Ga0068857_100000994
1111 Ga0068857_100002750
1112 Ga0068857_100020575
1113 Ga0068857_100044015
1114 Ga0068857_100083866
1115 Ga0068857_100119691
1116 Ga0068857_100269395
1117 Ga0068854_100005734
1118 Ga0068854_100022513
1119 Ga0068854_100048663
1120 Ga0068854_100102988
1121 Ga0068854_100132729
1122 Ga0068854_100335920
1123 Ga0068856_100000107
1124 Ga0068856_100000900
1125 Ga0068856_100005519
1126 Ga0068856_100015999
1127 Ga0068856_100016530
1128 Ga0068856_100018327
1129 Ga0068856_100085984
1130 Ga0068856_100113969
1131 Ga0070702_100006493
1132 Ga0068852_100005202
1133 Ga0068852_100015752
1134 Ga0068852_100032958
1135 Ga0068859_100000573
1136 Ga0068859_100015671
1137 Ga0068859_100032315
1138 Ga0068859_100054585
1139 Ga0068864_100003555
1140 Ga0068864_100003567
1141 Ga0068864_100088024
1142 Ga0068864_100160380
1143 Ga0068866_10001464
1144 Ga0068866_10011000
1145 Ga0068866_10038699
1146 Ga0068861_100002752
1147 Ga0068851_10018270
1148 Ga0068851_10082837
1149 Ga0068851_10129774
1150 Ga0068870_10000606
1151 Ga0068863_100010061
1152 Ga0068863_100021802
1153 Ga0068863_100057211
1154 Ga0068863_100167105
1155 Ga0068863_100337974
1156 Ga0068863_100424874
1157 Ga0068863_100468282
1158 Ga0068858_100000597
1159 Ga0068858_100009222
1160 Ga0068858_100032751
1161 Ga0068858_100039198
1162 Ga0068858_100062713
1163 Ga0068858_100257833
1164 Ga0068860_100020205
1165 Ga0068860_100047365
1166 Ga0068860_100054771
1167 Ga0068860_100055729
1168 Ga0068860_100142719
1169 Ga0068862_100012134
1170 Ga0068862_100082071
1171 Ga0068862_100150397
1172 Ga0081455_10102597
1173 Ga0081540_1050975
1174 Ga0070717_10002245
1175 Ga0070717_10004396
1176 Ga0070717_10004694
1177 Ga0070717_10007223
1178 Ga0070717_10023317
1179 Ga0070717_10028895
1180 Ga0070717_10065542
1181 Ga0070717_10091269
1182 Ga0070717_10117094
1183 Ga0070717_10132277
1184 Ga0070717_10210346
1185 Ga0070717_10243636
1186 Ga0070717_10271666
1187 Ga0070717_10316548
1188 Ga0070715_10030332
1189 Ga0070716_100006587
1190 Ga0070716_100046064
1191 Ga0070716_100075005
1192 Ga0070716_100157069
1193 Ga0070716_100226974
1194 Ga0070712_100000056
1195 Ga0070712_100000321
1196 Ga0070712_100000550
1197 Ga0070712_100000969
1198 Ga0070712_100006585
1199 Ga0070712_100012730
1200 Ga0070712_100059359
1201 Ga0070712_100093546
1202 Ga0070712_100124608
1203 Ga0097621_100007807
1204 Ga0097621_100013116
1205 Ga0097621_100022304
1206 Ga0097621_100038974
1207 Ga0097621_100223983
1208 Ga0097621_100374458
1209 Ga0097621_100378294
1210 Ga0068871_100000231
1211 Ga0068871_100000801
1212 Ga0068871_100023652
1213 Ga0068871_100030754
1214 Ga0068871_100047582
1215 Ga0068871_100061868
1216 Ga0075433_10080428
1217 Ga0075434_100000416
1218 Ga0075434_100002666
1219 Ga0075434_100075214
1220 Ga0075434_100375302
1221 Ga0075434_100437324
1222 Ga0068865_100011689
1223 Ga0068865_100024800
1224 Ga0068865_100223208
1225 Ga0075436_100000451
1226 Ga0075436_100006264
1227 Ga0075436_100061734
1228 Ga0075436_100063044
1229 Ga0097620_100000573
1230 Ga0097620_100015671
1231 Ga0097620_100032313
1232 Ga0097620_100054586
1233 Ga0075435_100018943
1234 Ga0075435_100098623
1235 Ga0075435_100317973
1236 Ga0105251_10106009
1237 Ga0105240_10010408
1238 Ga0105240_10022299
1239 Ga0105240_10067816
1240 Ga0105240_10067976
1241 Ga0105240_10108380
1242 Ga0105240_10207523
1243 Ga0105240_10217910
1244 Ga0105240_10255755
1245 Ga0105240_10364637
1246 Ga0105240_10589274
1247 Ga0105240_10783170
1248 Ga0105245_10002797
1249 Ga0105245_10068422
1250 Ga0105245_10132404
1251 Ga0105245_10321209
1252 Ga0105247_10001769
1253 Ga0105247_10013079
1254 Ga0105247_10078385
1255 Ga0105247_10121480
1256 Ga0114129_10308529
1257 Ga0114129_10483618
1258 Ga0105243_10122132
1259 Ga0105241_10006514
1260 Ga0105241_10011553
1261 Ga0105241_10011918
1262 Ga0105241_10015255
1263 Ga0105241_10091233
1264 Ga0105241_10151018
1265 Ga0105241_10187045
1266 Ga0105241_10258223
1267 Ga0105242_10005432
1268 Ga0105242_10071023
1269 Ga0105242_10098205
1270 Ga0105242_10116161
1271 Ga0105248_10006081
1272 Ga0105248_10033583
1273 Ga0105248_10068327
1274 Ga0105248_10102641
1275 Ga0105248_10390370
1276 Ga0105248_10793638
1277 Ga0105237_10020363
1278 Ga0105237_10027226
1279 Ga0105237_10114417
1280 Ga0105237_10201447
1281 Ga0105237_10238445
1282 Ga0105238_10022710
1283 Ga0105238_10023137
1284 Ga0105238_10089695
1285 Ga0105238_10134056
1286 Ga0105238_10140412
1287 Ga0105238_10155261
1288 Ga0105238_10240384
1289 Ga0105249_10004117
1290 Ga0105249_10032008
1291 Ga0099796_10071648
1292 Ga0105239_10004431
1293 Ga0105239_10014150
1294 Ga0105239_10033827
1295 Ga0105239_10073681
1296 Ga0105239_10135233
1297 Ga0105239_10576771
1298 Ga0105239_10623364
1299 Ga0105246_10002416
1300 Ga0105246_10037404
1301 Ga0105246_10137306
1302 Ga0157373_10001041
1303 Ga0157373_10036749
1304 Ga0157373_10071872
1305 Ga0157373_10123708
1306 Ga0157373_10145969
1307 Ga0157371_10005311
1308 Ga0157371_10011857
1309 Ga0157371_10027814
1310 Ga0157370_10077936
1311 Ga0157370_10104957
1312 Ga0157370_10129021
1313 Ga0157370_10158132
1314 Ga0157370_10180456
1315 Ga0157370_10347078
1316 Ga0157369_10001478
1317 Ga0157369_10008130
1318 Ga0157369_10042110
1319 Ga0157369_10042263
1320 Ga0157369_10047069
1321 Ga0157369_10053909
1322 Ga0157369_10082514
1323 Ga0157369_10101196
1324 Ga0157369_10111785
1325 Ga0157369_10602100
1326 Ga0157374_10000567
1327 Ga0157374_10001092
1328 Ga0157374_10002984
1329 Ga0157374_10008704
1330 Ga0157374_10043895
1331 Ga0157374_10111210
1332 Ga0157374_10125363
1333 Ga0157374_10154667
1334 Ga0157378_10000104
1335 Ga0157378_10000151
1336 Ga0157378_10000686
1337 Ga0157378_10040368
1338 Ga0157378_10067348
1339 Ga0157378_10128829
1340 Ga0157378_10262763
1341 Ga0163162_10002065
1342 Ga0163162_10019988
1343 Ga0163162_10179078
1344 Ga0163162_10425636
1345 Ga0163162_10623645
1346 Ga0163162_10674784
1347 Ga0157372_10000242
1348 Ga0157372_10001206
1349 Ga0157372_10021173
1350 Ga0157372_10028555
1351 Ga0157372_10033716
1352 Ga0157372_10048057
1353 Ga0157372_10071446
1354 Ga0157372_10207642
1355 Ga0157372_10410757
1356 Ga0157372_10517586
1357 Ga0157372_10679332
1358 Ga0157375_10214888
1359 Ga0157375_10275025
1360 Ga0163163_10000958
1361 Ga0163163_10038041
1362 Ga0163163_10123035
1363 Ga0163163_10186870
1364 Ga0163163_10213891
1365 Ga0163163_10229886
1366 Ga0182008_10006892
1367 Ga0157377_10000467
1368 Ga0157377_10086543
1369 Ga0157379_10015074
1370 Ga0157379_10016233
1371 Ga0157379_10037518
1372 Ga0157379_10460502
1373 Ga0157376_10006340
1374 Ga0157376_10040819
1375 Ga0157376_10236564
1376 Ga0182006_1018783
1377 Ga0182007_10021918
1378 Ga0182005_1009501
1379 Ga0213873_10020417
1380 Ga0213874_10004832
1381 Ga0213874_10008783
1382 Ga0224569_100235
1383 Ga0224572_1020124
1384 Ga0228598_1000123
1385 Ga0228598_1012618
1386 Ga0207697_10002916
1387 Ga0207656_10044557
1388 Ga0207682_10003786
1389 Ga0207692_10005206
1390 Ga0207692_10102007
1391 Ga0207692_10121944
1392 Ga0207642_10027052
1393 Ga0207642_10031016
1394 Ga0207642_10078826
1395 Ga0207710_10003898
1396 Ga0207710_10124601
1397 Ga0207688_10000372
1398 Ga0207680_10013123
1399 Ga0207680_10041482
1400 Ga0207647_10007186
1401 Ga0207647_10025887
1402 Ga0207699_10002709
1403 Ga0207699_10027886
1404 Ga0207699_10051162
1405 Ga0207699_10293990
1406 Ga0207645_10000051
1407 Ga0207645_10022895
1408 Ga0207643_10000079
1409 Ga0207705_10030843
1410 Ga0207684_10000311
1411 Ga0207684_10001754
1412 Ga0207684_10013315
1413 Ga0207684_10016755
1414 Ga0207654_10004043
1415 Ga0207654_10009332
1416 Ga0207654_10014943
1417 Ga0207654_10023432
1418 Ga0207707_10000127
1419 Ga0207707_10013860
1420 Ga0207707_10053101
1421 Ga0207707_10074436
1422 Ga0207695_10011737
1423 Ga0207695_10028217
1424 Ga0207695_10034398
1425 Ga0207695_10092563
1426 Ga0207695_10170732
1427 Ga0207671_10036278
1428 Ga0207671_10052188
1429 Ga0207671_10247140
1430 Ga0207671_10261186
1431 Ga0207693_10000119
1432 Ga0207693_10000362
1433 Ga0207693_10000457
1434 Ga0207693_10002950
1435 Ga0207693_10004359
1436 Ga0207693_10016269
1437 Ga0207693_10026570
1438 Ga0207693_10029207
1439 Ga0207693_10137434
1440 Ga0207663_10002106
1441 Ga0207663_10004317
1442 Ga0207663_10007244
1443 Ga0207663_10008816
1444 Ga0207663_10208298
1445 Ga0207663_10381026
1446 Ga0207660_10103759
1447 Ga0207662_10023390
1448 Ga0207657_10000246
1449 Ga0207657_10000292
1450 Ga0207657_10001266
1451 Ga0207657_10314117
1452 Ga0207649_10000242
1453 Ga0207649_10011296
1454 Ga0207652_10021090
1455 Ga0207652_10052352
1456 Ga0207652_10062363
1457 Ga0207652_10070448
1458 Ga0207652_10071878
1459 Ga0207652_10368458
1460 Ga0207646_10000565
1461 Ga0207646_10002216
1462 Ga0207646_10106702
1463 Ga0207646_10111939
1464 Ga0207646_10623807
1465 Ga0207681_10046219
1466 Ga0207694_10001306
1467 Ga0207694_10137574
1468 Ga0207694_10140319
1469 Ga0207694_10154911
1470 Ga0207694_10558443
1471 Ga0207650_10000090
1472 Ga0207650_10007969
1473 Ga0207659_10002035
1474 Ga0207687_10004238
1475 Ga0207687_10011229
1476 Ga0207687_10148099
1477 Ga0207687_10271631
1478 Ga0207687_10663359
1479 Ga0207700_10000528
1480 Ga0207700_10002119
1481 Ga0207700_10003068
1482 Ga0207700_10008312
1483 Ga0207700_10030361
1484 Ga0207700_10052588
1485 Ga0207700_10057649
1486 Ga0207700_10092278
1487 Ga0207664_10000165
1488 Ga0207664_10004851
1489 Ga0207664_10081835
1490 Ga0207664_10170502
1491 Ga0207664_10251504
1492 Ga0207664_10455318
1493 Ga0207644_10002582
1494 Ga0207644_10599867
1495 Ga0207690_10003087
1496 Ga0207690_10010651
1497 Ga0207690_10203468
1498 Ga0207706_10000139
1499 Ga0207706_10000640
1500 Ga0207706_10079906
1501 Ga0207686_10035211
1502 Ga0207686_10089477
1503 Ga0207686_10090666
1504 Ga0207709_10171480
1505 Ga0207670_10001693
1506 Ga0207704_10012294
1507 Ga0207704_10223177
1508 Ga0207704_10447185
1509 Ga0207665_10002897
1510 Ga0207665_10024039
1511 Ga0207665_10028063
1512 Ga0207665_10070289
1513 Ga0207665_10257129
1514 Ga0207665_10307124
1515 Ga0207691_10001343
1516 Ga0207711_10002838
1517 Ga0207711_10011787
1518 Ga0207689_10000304
1519 Ga0207689_10001053
1520 Ga0207689_10039634
1521 Ga0207661_10000583
1522 Ga0207661_10023933
1523 Ga0207661_10185193
1524 Ga0207661_10440149
1525 Ga0207679_10000184
1526 Ga0207679_10005367
1527 Ga0207679_10027166
1528 Ga0207679_10040898
1529 Ga0207667_10004029
1530 Ga0207667_10020400
1531 Ga0207667_10071649
1532 Ga0207667_10103960
1533 Ga0207667_10107244
1534 Ga0207667_10311841
1535 Ga0207667_10528456
1536 Ga0207651_10002456
1537 Ga0207651_10107201
1538 Ga0207651_10281777
1539 Ga0207712_10023786
1540 Ga0207712_10024542
1541 Ga0207712_10119906
1542 Ga0207640_10015374
1543 Ga0207640_10036120
1544 Ga0207640_10036188
1545 Ga0207640_10078421
1546 Ga0207658_10001983
1547 Ga0207658_10041406
1548 Ga0207677_10005049
1549 Ga0207677_10006393
1550 Ga0207677_10057478
1551 Ga0207677_10459496
1552 Ga0207703_10001863
1553 Ga0207703_10005260
1554 Ga0207703_10012716
1555 Ga0207703_10034192
1556 Ga0207703_10448356
1557 Ga0207639_10046457
1558 Ga0207639_10223963
1559 Ga0207678_10000204
1560 Ga0207678_10004676
1561 Ga0207702_10000704
1562 Ga0207702_10005927
1563 Ga0207702_10014881
1564 Ga0207702_10015530
1565 Ga0207702_10016745
1566 Ga0207702_10028337
1567 Ga0207702_10145508
1568 Ga0207702_10155741
1569 Ga0207702_10181513
1570 Ga0207641_10000894
1571 Ga0207641_10026028
1572 Ga0207641_10035294
1573 Ga0207641_10078652
1574 Ga0207641_10283961
1575 Ga0207648_10000757
1576 Ga0207648_10003612
1577 Ga0207648_10294286
1578 Ga0207648_10357029
1579 Ga0207676_10000113
1580 Ga0207676_10004935
1581 Ga0207676_10114539
1582 Ga0207674_10000076
1583 Ga0207674_10008255
1584 Ga0207674_10009505
1585 Ga0207674_10017787
1586 Ga0207674_10049003
1587 Ga0207675_100008819
1588 Ga0207675_100112550
1589 Ga0207675_100252047
1590 Ga0207683_10001129
1591 Ga0207683_10317610
1592 Ga0207698_10044147
1593 Ga0207698_10190368
1594 Ga0265356_1000298
1595 Ga0268266_10005373
1596 Ga0268265_10002144
1597 Ga0268265_10063459
1598 Ga0268265_10079197
1599 Ga0268264_10016388
1600 Ga0268264_10016978
1601 Ga0268264_10075570
1602 Ga0265338_10000750
1603 Ga0265338_10005847
1604 Ga0265338_10055749
1605 Ga0265338_10098810
1606 Ga0265338_10149453
1607 Ga0265762_1000030
1608 Ga0265762_1000238
1609 Ga0265760_10001710
1610 Ga0265760_10003216
1611 Ga0265760_10007818
1612 Ga0265332_10145196
1613 Ga0265328_10022041
1614 Ga0265328_10056880
1615 Ga0265325_10032315
1616 Ga0265325_10072788
1617 Ga0265325_10081413
1618 Ga0265340_10008487
1619 Ga0265340_10015846
1620 Ga0265340_10024956
1621 Ga0265339_10004196
1622 Ga0265339_10014860
1623 Ga0265339_10034652
1624 Ga0265339_10096303
1625 Ga0265339_10141199
1626 Ga0265327_10032110
1627 Ga0265316_10010624
1628 Ga0265316_10010927
1629 Ga0265316_10014931
1630 Ga0265316_10086374
1631 Ga0265316_10298086
1632 Ga0265316_10348815
1633 Ga0307408_100009058
1634 Ga0265313_10035068
1635 Ga0265314_10031361
1636 Ga0265314_10079739
1637 Ga0265314_10123316
1638 Ga0265342_10057462
1639 Ga0307405_10026721
1640 Ga0307405_10060022
1641 Ga0307410_10007103
1642 Ga0307410_10108380
1643 Ga0307407_10057069
1644 Ga0307409_100001571
1645 Ga0307409_100060913
1646 Ga0307416_100043835
1647 Ga0307411_10023898
1648 Ga0307415_100002646
1649 Ga0316212_1005580
1650 Ga0373926_0028490
1651 Ga0373926_0088761
1652 Ga0373928_0011668
1653 Ga0373934_0040916
1654 Ga0373949_0045606
1655 Ga0373936_0027518
1656 Ga0373945_0046101
1657 Ga0373943_0013463
1658 Ga0373943_0085500
1659 Ga0373946_0079993
1660 Ga0373931_0115290
1661 Ga0373935_0008799
1662 Ga0373935_0010017
1663 Ga0373935_0017021
1664 Ga0373935_0034720
1665 Ga0373927_0000234
1666 Ga0373927_0016852
1667 Ga0373927_0027365
1668 Ga0373927_0095825
1669 Ga0373927_0109457
1670 Ga0373927_0126907
1671 Ga0373927_0143288
1672 Ga0373933_0055424
1673 Ga0373947_0025855
1674 Ga0373947_0057018
1675 Ga0373947_0129275
1676 Ga0373947_0229671
1677 Ga0373937_0000596
1678 Ga0373937_0024205
1679 Ga0373937_0033409
1680 Ga0373937_0035986
1681 Ga0373937_0053014
1682 Ga0373937_0259428
1683 Ga0373925_0000227
1684 Ga0373925_0001086
1685 Ga0373925_0002762
1686 Ga0373925_0037329
1687 Ga0373925_0129281
1688 Ga0373925_0276718
1689 Ga0395898_0163122
1690 Ga0395898_0337093
1691 Ga0395905_0071991
1692 Ga0436365_0696718
1693 Ga0436360_0051252
1694 Ga0436363_0131185
1695 Ga0436363_0265047
1696 Ga0436363_1291424
1697 Ga0436362_0848211
1698 Ga0466963_0001890
1699 Ga0466964_0039615
1700 Ga0451576_0279170
1701 Ga0451576_0541994
1702 Ga0466958_0109890
1703 Ga0466967_0004535
1704 Ga0466967_0014796
1705 Ga0466967_0020702
1706 Ga0466967_0032045
1707 Ga0466967_0035164
1708 Ga0466967_0049777
1709 Ga0466967_0248782
1710 Ga0495653_0140819
1711 Ga0495580_0005751
1712 Ga0495580_0008637
1713 Ga0495580_0012343
1714 Ga0495580_0015718
1715 Ga0495580_0037477
1716 Ga0495580_0166087
1717 Ga0495580_0176228
1718 Ga0495580_0200031
1719 Ga0495580_0234470
1720 Ga0495580_0268783
1721 Ga0495582_0001766
1722 Ga0495582_0031347
1723 Ga0495582_0081946
1724 Ga0495639_0056561
1725 Ga0495639_0075273
1726 Ga0495664_0061642
1727 Ga0495628_0018123
1728 Ga0495630_0156140
1729 Ga0495630_0208437
1730 Ga0495642_0176289
1731 Ga0495665_0010815
1732 Ga0495665_0114191
1733 Ga0495635_0096577
1734 Ga0495635_0305274
1735 Ga0495657_0226724
1736 Ga0495623_0024206
1737 Ga0495623_0034506
1738 Ga0495623_0083416
1739 Ga0495658_0054459
1740 Ga0495669_0085856
1741 Ga0495674_0033176
1742 Ga0495676_0144491
1743 Ga0495676_0157824
1744 Ga0495593_0142438
1745 Ga0495602_0055511
1746 Ga0495602_0135117
1747 Ga0495602_0269147
1748 Ga0495614_0041711
1749 Ga0496100_0003857
1750 Ga0496100_0130159
1751 Ga0496100_0214169
1752 Ga0496101_0003461
1753 Ga0496101_0382047
1754 Ga0496102_0000537
1755 Ga0496102_0103108
1756 Ga0496102_0195843
1757 Ga0496102_0272738
1758 Ga0496103_0010438
1759 Ga0496103_0011600
1760 Ga0496103_0053924
1761 Ga0496104_0035988
1762 Ga0496104_0036653
1763 Ga0496104_0050923
1764 Ga0496104_0227846
1765 Ga0496104_0653712
1766 Ga0496105_0031508
1767 Ga0496105_0110162
1768 Ga0496105_0139926
1769 Ga0496105_0249987
1770 Ga0496106_0062827
1771 Ga0496106_0097339
1772 Ga0496106_0113740
1773 Ga0496107_0052486
1774 Ga0496107_0140506
1775 Ga0496108_0002118
1776 Ga0496108_0035693
1777 Ga0496108_0094357
1778 Ga0496109_0000008
1779 Ga0496109_0039890
1780 Ga0496109_0184031
1781 Ga0496109_0195916
1782 Ga0496109_0209122
1783 Ga0496110_0051224
1784 Ga0496110_0094519
1785 Ga0496110_0129613
1786 Ga0496111_0014712
1787 Ga0496112_0000334
1788 Ga0496112_0001099
1789 Ga0496112_0005467
1790 Ga0496112_0013062
1791 Ga0496112_0037620
1792 Ga0496112_0041732
1793 Ga0496112_0050195
1794 Ga0496112_0082762
1795 Ga0496112_0141816
1796 Ga0496112_0328175
1797 Ga0496112_0433018
1798 Ga0496112_0445385
1799 Ga0496113_0000238
1800 Ga0496113_0005618
1801 Ga0496113_0113103
1802 Ga0496114_0028113
1803 Ga0496114_0126229
1804 Ga0496115_0004624
1805 Ga0496115_0016349
1806 Ga0496115_0070340
1807 Ga0501073_0038132
1808 Ga0501245_025829
1809 Ga0501083_0255154
1810 nmdc:mga05p37_104900_c1
1811 nmdc:mga05p37_318014_c1
1812 nmdc:mga0n895_50045_c1
1813 nmdc:mga0n895_634_c1
1814 nmdc:mga0n895_85268_c1
1815 nmdc:mga0rr50_297315_c1
1816 nmdc:mga0rr50_34917_c1
1817 nmdc:mga0rr50_370252_c1
1818 nmdc:mga0rr50_66550_c1
1819 nmdc:mga0rr50_85082_c1
1820 nmdc:mga08x19_10856_c1
1821 nmdc:mga08x19_158610_c1
1822 nmdc:mga08x19_18527_c1
1823 nmdc:mga08x19_233356_c1
1824 nmdc:mga08x19_6888_c1
1825 nmdc:mga0a205_365708_c1
1826 Ga0495619_0071569
1827 Ga0501084_0199022
1828 Ga0587091_015504

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

59

281

0.93

PF01061

ABC2_membrane

ABC-2 type transporter

40

252

0.91

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

6

287

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m1q-assembly1.cif.gz_A human abca4 structure in complex with n-ret-pe 0.7598 76 262
5xjy-assembly1.cif.gz_A cryo-em structure of human abca1 0.7548 75 264
7nez-assembly1.cif.gz_B structure of topotecan-bound abcg2 0.7285 22 265
7e7o-assembly1.cif.gz_A cryo-em structure of human abca4 in nrpe-bound state 0.7265 75 265
6ffc-assembly1.cif.gz_A structure of an inhibitor-bound abc transporter 0.7254 22 265
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.856 66 264 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8246 66 263 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7961 48 264 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6375 48 264 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6329 66 264 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A537C6L3-F1-model_v4 Multidrug ABC transporter permease 0.9673 76 267 GO:0016020
GO:0140359
AF-A0A7J2HAA6-F1-model_v4 deleted 0.956 77 267
AF-A0A3D2AYY1-F1-model_v4 Transport permease protein 0.9539 21 239 GO:0043190
GO:0140359
AF-A0A7Y5H975-F1-model_v4 Transport permease protein 0.9536 22 268 GO:0043190
GO:0140359
AF-A0A832U5F1-F1-model_v4 ABC transporter permease 0.9505 18 267 GO:0043190
GO:0140359

Map