F485227

General Info

Members Datasets Scaffolds Average Seq Length
902 295 902 146

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0007521|Ga0496126_0007521_7327_7848
Length 173
Sequence MARDPSVDGKDTGQRREVKMPGIIVGIDGSAHSRRALEWAVDEAAIRHMPLTVLTVNQALASCWTGEPVSYSGDQELTKKVRQAAQEETDSVLKKTNENSRPPSVVVRAVAGLPAKELLNASGDADMVVVGARGADGVKRLLLGSVSVAVTHHARCPVVVIPAGNPQQAYVGP

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 3.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.99
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10001092 3300003659 Bacteria 4557
2 Ga0058861_12043780 3300004800 Bacteria 903
3 Ga0058862_12706110 3300004803 Unclassified 747
4 Ga0070683_100075781 3300005329 Bacteria 3144
5 Ga0070683_100382345 3300005329 Unclassified 1341
6 Ga0070683_100852711 3300005329 Bacteria 874
7 Ga0070670_101404312 3300005331 Unclassified 640
8 Ga0068869_100139532 3300005334 Bacteria 1870
9 Ga0068869_101515775 3300005334 Bacteria 595
10 Ga0070680_100259093 3300005336 Unclassified 1471
11 Ga0070680_100277186 3300005336 Bacteria 1420
12 Ga0070680_101431036 3300005336 Unclassified 598
13 Ga0070682_100109485 3300005337 Unclassified 1839
14 Ga0070682_100315416 3300005337 Bacteria 1152
15 Ga0070682_100933297 3300005337 Bacteria 715
16 Ga0068868_100202235 3300005338 Bacteria 1656
17 Ga0068868_101493115 3300005338 Bacteria 632
18 Ga0070660_100441711 3300005339 Bacteria 1079
19 Ga0070691_10260930 3300005341 Bacteria 933
20 Ga0070691_10698919 3300005341 Bacteria 608
21 Ga0070687_100980794 3300005343 Bacteria 611
22 Ga0070661_100392002 3300005344 Bacteria 1097
23 Ga0070675_100510808 3300005354 Bacteria 1084
24 Ga0070675_101891405 3300005354 Unclassified 550
25 Ga0070671_100651498 3300005355 Bacteria 912
26 Ga0070674_100222825 3300005356 Bacteria 1468
27 Ga0070673_101313412 3300005364 Unclassified 679
28 Ga0070673_101589695 3300005364 Bacteria 617
29 Ga0070659_100142422 3300005366 Bacteria 1952
30 Ga0070703_10296350 3300005406 Bacteria 673
31 Ga0070709_10082338 3300005434 Bacteria 2102
32 Ga0070714_100011586 3300005435 Bacteria 7000
33 Ga0070714_100024414 3300005435 Bacteria 4978
34 Ga0070714_100182401 3300005435 Unclassified 1911
35 Ga0070714_100573750 3300005435 Unclassified 1082
36 Ga0070714_100642932 3300005435 Bacteria 1021
37 Ga0070714_100722612 3300005435 Bacteria 962
38 Ga0070714_101044783 3300005435 Bacteria 795
39 Ga0070714_101062692 3300005435 Bacteria 788
40 Ga0070714_101419944 3300005435 Archaea 678
41 Ga0070713_100043664 3300005436 Bacteria 3666
42 Ga0070713_100090641 3300005436 Bacteria 2628
43 Ga0070713_100120023 3300005436 Bacteria 2304
44 Ga0070713_100224072 3300005436 Bacteria 1707
45 Ga0070713_100244642 3300005436 Bacteria 1634
46 Ga0070713_100560609 3300005436 Bacteria 1082
47 Ga0070713_100776176 3300005436 Bacteria 918
48 Ga0070710_10144798 3300005437 Bacteria 1460
49 Ga0070710_10395102 3300005437 Unclassified 925
50 Ga0070710_10894657 3300005437 Bacteria 640
51 Ga0070711_100057214 3300005439 Bacteria 2699
52 Ga0070711_100078518 3300005439 Bacteria 2345
53 Ga0070705_100391413 3300005440 Bacteria 1026
54 Ga0070705_101335415 3300005440 Bacteria 595
55 Ga0070708_100047647 3300005445 Bacteria 3786
56 Ga0070708_100385452 3300005445 Bacteria 1322
57 Ga0070708_100441042 3300005445 Bacteria 1228
58 Ga0070663_100417308 3300005455 Bacteria 1100
59 Ga0070678_100245676 3300005456 Unclassified 1498
60 Ga0070678_101165527 3300005456 Bacteria 713
61 Ga0070678_101446089 3300005456 Unclassified 643
62 Ga0070662_100767977 3300005457 Bacteria 818
63 Ga0070681_10581936 3300005458 Bacteria 1033
64 Ga0070681_11224918 3300005458 Unclassified 673
65 Ga0070681_11417585 3300005458 Bacteria 618
66 Ga0070706_100074346 3300005467 Bacteria 3145
67 Ga0070706_100093017 3300005467 Bacteria 2797
68 Ga0070706_100312463 3300005467 Bacteria 1466
69 Ga0070706_100490871 3300005467 Bacteria 1143
70 Ga0070706_100555779 3300005467 Bacteria 1067
71 Ga0070707_100003731 3300005468 Bacteria 14373
72 Ga0070707_100086187 3300005468 Bacteria 3037
73 Ga0070707_100226629 3300005468 Bacteria 1820
74 Ga0070707_100679550 3300005468 Bacteria 992
75 Ga0070707_100747280 3300005468 Bacteria 941
76 Ga0070707_100785135 3300005468 Bacteria 916
77 Ga0070707_100886432 3300005468 Unclassified 857
78 Ga0070707_101009222 3300005468 Bacteria 798
79 Ga0070698_100003676 3300005471 Bacteria 16842
80 Ga0070698_100006357 3300005471 Bacteria 12830
81 Ga0070698_100008957 3300005471 Bacteria 10766
82 Ga0070698_100011232 3300005471 Bacteria 9511
83 Ga0070698_100150799 3300005471 Bacteria 2272
84 Ga0070698_100858794 3300005471 Bacteria 852
85 Ga0070699_100000405 3300005518 Bacteria 41700
86 Ga0070699_100039229 3300005518 Bacteria 4101
87 Ga0070699_100132548 3300005518 Bacteria 2197
88 Ga0070699_100402056 3300005518 Unclassified 1238
89 Ga0070679_100118973 3300005530 Bacteria 2626
90 Ga0070679_100221190 3300005530 Bacteria 1854
91 Ga0070684_100261088 3300005535 Bacteria 1584
92 Ga0070684_100340859 3300005535 Bacteria 1378
93 Ga0070684_100932886 3300005535 Bacteria 814
94 Ga0070684_101253660 3300005535 Unclassified 697
95 Ga0070697_100029395 3300005536 Bacteria 4406
96 Ga0070697_101232048 3300005536 Bacteria 667
97 Ga0068853_100061302 3300005539 Bacteria 3253
98 Ga0070686_101162384 3300005544 Bacteria 640
99 Ga0070696_100590070 3300005546 Bacteria 895
100 Ga0070693_100348754 3300005547 Bacteria 1012
101 Ga0070665_100307596 3300005548 Bacteria 1588
102 Ga0070665_100312721 3300005548 Bacteria 1575
103 Ga0070665_101417992 3300005548 Bacteria 703
104 Ga0070704_100362466 3300005549 Bacteria 1226
105 Ga0068855_100579982 3300005563 Bacteria 1211
106 Ga0068855_101510327 3300005563 Bacteria 689
107 Ga0070664_100750291 3300005564 Bacteria 911
108 Ga0068857_100092718 3300005577 Bacteria 2704
109 Ga0068857_100150823 3300005577 Bacteria 2106
110 Ga0068857_100937112 3300005577 Bacteria 832
111 Ga0068854_100447867 3300005578 Bacteria 1078
112 Ga0068856_100445478 3300005614 Bacteria 1316
113 Ga0068856_101258839 3300005614 Bacteria 755
114 Ga0068856_101361486 3300005614 Bacteria 724
115 Ga0070702_101078372 3300005615 Bacteria 640
116 Ga0068859_100422296 3300005617 Bacteria 1429
117 Ga0068859_101257195 3300005617 Unclassified 816
118 Ga0068864_101587790 3300005618 Bacteria 658
119 Ga0068864_102202494 3300005618 Bacteria 558
120 Ga0068861_101318383 3300005719 Bacteria 702
121 Ga0068851_10091240 3300005834 Bacteria 1604
122 Ga0068863_100306613 3300005841 Bacteria 1540
123 Ga0068863_101916837 3300005841 Unclassified 602
124 Ga0068858_100185422 3300005842 Bacteria 1965
125 Ga0068860_100707286 3300005843 Bacteria 1017
126 Ga0068860_101471931 3300005843 Unclassified 702
127 Ga0068860_101556756 3300005843 Unclassified 683
128 Ga0081540_1001743 3300005983 Bacteria 18315
129 Ga0081540_1048040 3300005983 Bacteria 2141
130 Ga0070717_10035084 3300006028 Bacteria 4058
131 Ga0070717_10065911 3300006028 Bacteria 3011
132 Ga0070717_10185487 3300006028 Bacteria 1815
133 Ga0070717_10783239 3300006028 Bacteria 867
134 Ga0070717_11092002 3300006028 Bacteria 727
135 Ga0070717_11143668 3300006028 Bacteria 709
136 Ga0070715_10004114 3300006163 Unclassified 4726
137 Ga0070715_10690291 3300006163 Bacteria 608
138 Ga0070716_100081549 3300006173 Bacteria 1932
139 Ga0070716_100107312 3300006173 Bacteria 1724
140 Ga0070716_100815927 3300006173 Bacteria 723
141 Ga0070716_100953421 3300006173 Unclassified 675
142 Ga0070712_100036052 3300006175 Bacteria 3362
143 Ga0070712_100132094 3300006175 Bacteria 1893
144 Ga0070712_100207072 3300006175 Bacteria 1545
145 Ga0070712_100281608 3300006175 Bacteria 1339
146 Ga0070712_100322043 3300006175 Bacteria 1257
147 Ga0070712_101617694 3300006175 Bacteria 567
148 Ga0097621_100363651 3300006237 Bacteria 1289
149 Ga0068871_100133473 3300006358 Bacteria 2107
150 Ga0068871_101710712 3300006358 Bacteria 596
151 Ga0075428_100212893 3300006844 Unclassified 2088
152 Ga0075431_100626913 3300006847 Unclassified 1057
153 Ga0075433_10128788 3300006852 Unclassified 2248
154 Ga0075433_11422670 3300006852 Bacteria 600
155 Ga0075434_100146391 3300006871 Bacteria 2382
156 Ga0075434_100515993 3300006871 Bacteria 1216
157 Ga0075434_100810258 3300006871 Unclassified 952
158 Ga0068865_100028789 3300006881 Bacteria 3680
159 Ga0075436_100252256 3300006914 Bacteria 1257
160 Ga0075436_100550978 3300006914 Unclassified 846
161 Ga0097620_100422283 3300006931 Bacteria 1429
162 Ga0097620_101257251 3300006931 Unclassified 816
163 Ga0075435_100286519 3300007076 Unclassified 1407
164 Ga0075435_100365353 3300007076 Unclassified 1238
165 Ga0075435_101482424 3300007076 Unclassified 595
166 Ga0075435_101852209 3300007076 Unclassified 530
167 Ga0105250_10077867 3300009092 Bacteria 1342
168 Ga0105240_10348767 3300009093 Bacteria 1680
169 Ga0105240_10398695 3300009093 Bacteria 1550
170 Ga0105240_10972950 3300009093 Bacteria 909
171 Ga0111539_11089217 3300009094 Unclassified 928
172 Ga0111539_13510366 3300009094 Bacteria 503
173 Ga0105245_10973672 3300009098 Bacteria 892
174 Ga0105245_11152039 3300009098 Bacteria 822
175 Ga0105247_10430328 3300009101 Unclassified 947
176 Ga0105247_10700423 3300009101 Bacteria 762
177 Ga0114129_10018632 3300009147 Bacteria 9882
178 Ga0105243_10071648 3300009148 Bacteria 2803
179 Ga0105241_10176838 3300009174 Bacteria 1767
180 Ga0105241_10830963 3300009174 Bacteria 853
181 Ga0105242_10819844 3300009176 Bacteria 923
182 Ga0105248_10797356 3300009177 Unclassified 1066
183 Ga0105237_10917324 3300009545 Bacteria 883
184 Ga0105238_10149293 3300009551 Bacteria 2313
185 Ga0105238_11304333 3300009551 Bacteria 752
186 Ga0105238_11304335 3300009551 Bacteria 752
187 Ga0105249_10249872 3300009553 Bacteria 1758
188 Ga0105249_11967813 3300009553 Unclassified 657
189 Ga0099796_10080203 3300010159 Bacteria 1195
190 Ga0105239_11672622 3300010375 Unclassified 736
191 Ga0105246_10011576 3300011119 Bacteria 5475
192 Ga0105246_10523851 3300011119 Unclassified 1011
193 Ga0157342_1009931 3300012507 Bacteria 965
194 Ga0157373_10092891 3300013100 Bacteria 2125
195 Ga0157371_10181709 3300013102 Bacteria 1504
196 Ga0157370_10122936 3300013104 Bacteria 2423
197 Ga0157370_10268413 3300013104 Bacteria 1577
198 Ga0157370_11142876 3300013104 Bacteria 703
199 Ga0157369_10659842 3300013105 Unclassified 1078
200 Ga0157369_10668021 3300013105 Bacteria 1071
201 Ga0157369_11136163 3300013105 Bacteria 798
202 Ga0157369_11204219 3300013105 Bacteria 773
203 Ga0157369_11747414 3300013105 Bacteria 632
204 Ga0157374_10448039 3300013296 Bacteria 1292
205 Ga0157374_10872999 3300013296 Bacteria 917
206 Ga0157378_10318606 3300013297 Bacteria 1510
207 Ga0157378_11401071 3300013297 Bacteria 742
208 Ga0163162_10616706 3300013306 Bacteria 1210
209 Ga0163162_11470083 3300013306 Unclassified 776
210 Ga0163162_11744644 3300013306 Unclassified 711
211 Ga0157372_10393051 3300013307 Bacteria 1616
212 Ga0157372_10635203 3300013307 Unclassified 1244
213 Ga0157372_11226822 3300013307 Unclassified 866
214 Ga0157372_12353686 3300013307 Unclassified 612
215 Ga0157375_12038382 3300013308 Unclassified 682
216 Ga0157375_12065253 3300013308 Unclassified 678
217 Ga0163163_10361023 3300014325 Bacteria 1509
218 Ga0157377_10644064 3300014745 Bacteria 762
219 Ga0157379_10591307 3300014968 Bacteria 1035
220 Ga0157379_10728805 3300014968 Bacteria 932
221 Ga0157379_11971263 3300014968 Bacteria 576
222 Ga0157376_11360918 3300014969 Bacteria 741
223 Ga0197907_10032160 3300020069 Bacteria 1453
224 Ga0197907_10861133 3300020069 Bacteria 1175
225 Ga0197907_10924303 3300020069 Bacteria 1493
226 Ga0206356_10039166 3300020070 Unclassified 844
227 Ga0206356_11395269 3300020070 Bacteria 597
228 Ga0206349_1814736 3300020075 Bacteria 900
229 Ga0206355_1681200 3300020076 Unclassified 704
230 Ga0206351_10213855 3300020077 Unclassified 758
231 Ga0206351_10244370 3300020077 Bacteria 504
232 Ga0206352_10526204 3300020078 Bacteria 540
233 Ga0206352_11106613 3300020078 Bacteria 610
234 Ga0206352_11335809 3300020078 Bacteria 668
235 Ga0206350_10136229 3300020080 Bacteria 1124
236 Ga0206350_11119363 3300020080 Unclassified 740
237 Ga0206350_11310291 3300020080 Bacteria 743
238 Ga0206350_11351073 3300020080 Bacteria 956
239 Ga0206354_10541864 3300020081 Bacteria 773
240 Ga0206354_11573652 3300020081 Bacteria 1621
241 Ga0206353_10209463 3300020082 Bacteria 705
242 Ga0206353_11391335 3300020082 Bacteria 2815
243 Ga0154015_1066765 3300020610 Unclassified 627
244 Ga0213875_10000312 3300021388 Bacteria 46369
245 Ga0213875_10004119 3300021388 Bacteria 8061
246 Ga0224712_10300427 3300022467 Unclassified 751
247 Ga0224712_10521254 3300022467 Bacteria 576
248 Ga0207656_10412629 3300025321 Unclassified 680
249 Ga0207653_10133864 3300025885 Bacteria 902
250 Ga0207653_10373377 3300025885 Bacteria 558
251 Ga0207692_10001693 3300025898 Bacteria 8328
252 Ga0207692_10040840 3300025898 Bacteria 2292
253 Ga0207692_10069804 3300025898 Bacteria 1847
254 Ga0207692_10211134 3300025898 Bacteria 1146
255 Ga0207692_10325830 3300025898 Unclassified 941
256 Ga0207692_10754394 3300025898 Bacteria 634
257 Ga0207692_11014266 3300025898 Bacteria 548
258 Ga0207710_10358472 3300025900 Bacteria 744
259 Ga0207710_10446397 3300025900 Bacteria 667
260 Ga0207688_10246000 3300025901 Bacteria 1082
261 Ga0207680_10895081 3300025903 Unclassified 636
262 Ga0207647_10066847 3300025904 Bacteria 2179
263 Ga0207685_10000213 3300025905 Bacteria 8954
264 Ga0207685_10248683 3300025905 Unclassified 859
265 Ga0207699_10004260 3300025906 Bacteria 6841
266 Ga0207699_10020249 3300025906 Bacteria 3561
267 Ga0207699_10055907 3300025906 Bacteria 2350
268 Ga0207699_10140995 3300025906 Unclassified 1584
269 Ga0207699_10515578 3300025906 Unclassified 864
270 Ga0207684_10042592 3300025910 Bacteria 3849
271 Ga0207684_10064256 3300025910 Bacteria 3116
272 Ga0207684_10174450 3300025910 Bacteria 1853
273 Ga0207684_10391147 3300025910 Bacteria 1195
274 Ga0207654_10203593 3300025911 Bacteria 1305
275 Ga0207707_10465904 3300025912 Unclassified 1080
276 Ga0207695_10534452 3300025913 Bacteria 1054
277 Ga0207671_10597283 3300025914 Unclassified 880
278 Ga0207693_10485565 3300025915 Unclassified 965
279 Ga0207693_10579703 3300025915 Bacteria 874
280 Ga0207693_10666239 3300025915 Bacteria 808
281 Ga0207693_10829362 3300025915 Unclassified 712
282 Ga0207663_10001922 3300025916 Bacteria 9839
283 Ga0207663_10126743 3300025916 Bacteria 1757
284 Ga0207663_10281209 3300025916 Bacteria 1236
285 Ga0207663_10357438 3300025916 Bacteria 1107
286 Ga0207663_10829456 3300025916 Bacteria 737
287 Ga0207663_11148745 3300025916 Unclassified 625
288 Ga0207660_10177213 3300025917 Bacteria 1654
289 Ga0207660_10292633 3300025917 Bacteria 1295
290 Ga0207660_10423097 3300025917 Bacteria 1075
291 Ga0207662_10054165 3300025918 Bacteria 2391
292 Ga0207657_10009522 3300025919 Bacteria 9756
293 Ga0207657_10058280 3300025919 Bacteria 3324
294 Ga0207649_10053478 3300025920 Bacteria 2509
295 Ga0207652_10069883 3300025921 Bacteria 3049
296 Ga0207652_11877724 3300025921 Unclassified 504
297 Ga0207646_10015499 3300025922 Bacteria 7197
298 Ga0207646_10049954 3300025922 Bacteria 3744
299 Ga0207646_10196833 3300025922 Bacteria 1820
300 Ga0207646_10467288 3300025922 Bacteria 1138
301 Ga0207646_10646855 3300025922 Bacteria 947
302 Ga0207694_10670273 3300025924 Bacteria 874
303 Ga0207694_10736727 3300025924 Bacteria 832
304 Ga0207659_10150235 3300025926 Bacteria 1818
305 Ga0207659_11099803 3300025926 Bacteria 684
306 Ga0207687_10361043 3300025927 Bacteria 1186
307 Ga0207700_10007608 3300025928 Bacteria 6644
308 Ga0207700_10011082 3300025928 Bacteria 5732
309 Ga0207700_10028774 3300025928 Bacteria 3913
310 Ga0207700_10053874 3300025928 Bacteria 3016
311 Ga0207700_10085135 3300025928 Bacteria 2480
312 Ga0207700_10187131 3300025928 Bacteria 1738
313 Ga0207700_10230825 3300025928 Bacteria 1573
314 Ga0207700_10239984 3300025928 Bacteria 1544
315 Ga0207700_11246577 3300025928 Bacteria 663
316 Ga0207664_10039123 3300025929 Bacteria 3681
317 Ga0207664_10089946 3300025929 Bacteria 2515
318 Ga0207664_10112691 3300025929 Bacteria 2264
319 Ga0207664_10119876 3300025929 Bacteria 2200
320 Ga0207664_10147936 3300025929 Bacteria 1993
321 Ga0207664_10187820 3300025929 Bacteria 1777
322 Ga0207664_10203924 3300025929 Bacteria 1708
323 Ga0207664_10392896 3300025929 Bacteria 1233
324 Ga0207644_10785168 3300025931 Bacteria 796
325 Ga0207644_10966538 3300025931 Bacteria 714
326 Ga0207690_10275050 3300025932 Bacteria 1310
327 Ga0207706_10079698 3300025933 Bacteria 2879
328 Ga0207686_10427430 3300025934 Bacteria 1014
329 Ga0207670_11479671 3300025936 Bacteria 577
330 Ga0207669_10835396 3300025937 Bacteria 766
331 Ga0207704_10441898 3300025938 Bacteria 1036
332 Ga0207665_10011289 3300025939 Bacteria 5862
333 Ga0207665_10441729 3300025939 Bacteria 997
334 Ga0207665_10824288 3300025939 Unclassified 734
335 Ga0207665_11124624 3300025939 Unclassified 626
336 Ga0207691_11002390 3300025940 Bacteria 697
337 Ga0207689_10067729 3300025942 Bacteria 2934
338 Ga0207661_10021010 3300025944 Bacteria 4888
339 Ga0207661_10090467 3300025944 Bacteria 2548
340 Ga0207661_10188507 3300025944 Bacteria 1807
341 Ga0207661_11123924 3300025944 Bacteria 723
342 Ga0207661_11187068 3300025944 Bacteria 702
343 Ga0207679_10659019 3300025945 Bacteria 947
344 Ga0207667_11133427 3300025949 Bacteria 764
345 Ga0207712_11083251 3300025961 Bacteria 713
346 Ga0207668_10958664 3300025972 Bacteria 763
347 Ga0207668_11136578 3300025972 Bacteria 701
348 Ga0207640_10613787 3300025981 Unclassified 922
349 Ga0207677_11417353 3300026023 Unclassified 640
350 Ga0207703_11039607 3300026035 Unclassified 786
351 Ga0207678_10013839 3300026067 Bacteria 7088
352 Ga0207678_10100422 3300026067 Bacteria 2472
353 Ga0207678_10397255 3300026067 Bacteria 1193
354 Ga0207708_10307659 3300026075 Bacteria 1290
355 Ga0207702_10241806 3300026078 Bacteria 1691
356 Ga0207702_10715297 3300026078 Unclassified 987
357 Ga0207702_12103158 3300026078 Bacteria 554
358 Ga0207702_12425335 3300026078 Unclassified 511
359 Ga0207641_10444188 3300026088 Bacteria 1252
360 Ga0207676_11560025 3300026095 Bacteria 658
361 Ga0207674_10097284 3300026116 Bacteria 2927
362 Ga0207674_10119813 3300026116 Bacteria 2600
363 Ga0207674_10124222 3300026116 Bacteria 2547
364 Ga0207674_11314288 3300026116 Unclassified 692
365 Ga0207675_100052218 3300026118 Bacteria 3815
366 Ga0207675_100456499 3300026118 Bacteria 1267
367 Ga0207683_11546339 3300026121 Bacteria 612
368 Ga0207683_11566398 3300026121 Bacteria 608
369 Ga0207698_10621326 3300026142 Bacteria 1067
370 Ga0207698_11351965 3300026142 Unclassified 727
371 Ga0207698_11946099 3300026142 Bacteria 602
372 Ga0207428_10674306 3300027907 Unclassified 741
373 Ga0265357_1001605 3300028023 Bacteria 1698
374 Ga0268266_10084515 3300028379 Bacteria 2772
375 Ga0268264_11863866 3300028381 Bacteria 611
376 Ga0265322_10040260 3300028654 Bacteria 1330
377 Ga0265338_10001197 3300028800 Bacteria 42864
378 Ga0265338_10311204 3300028800 Bacteria 1142
379 Ga0265762_1013027 3300030760 Bacteria 1496
380 Ga0265763_1000424 3300030763 Bacteria 2510
381 Ga0265764_100491 3300030882 Unclassified 1498
382 Ga0265320_10210696 3300031240 Bacteria 866
383 Ga0265325_10147857 3300031241 Bacteria 1113
384 Ga0373948_0024187 3300034817 Bacteria 1184
385 Ga0373948_0031650 3300034817 Bacteria 1070
386 Ga0373938_0010587 3300034957 Bacteria 1699
387 Ga0373938_0203447 3300034957 Bacteria 549
388 Ga0373926_0189688 3300035083 Bacteria 789
389 Ga0373934_0000178 3300035086 Bacteria 23259
390 Ga0373934_0000453 3300035086 Bacteria 14355
391 Ga0373934_0043283 3300035086 Bacteria 1780
392 Ga0373934_0092380 3300035086 Bacteria 1220
393 Ga0373934_0117000 3300035086 Bacteria 1083
394 Ga0373934_0148985 3300035086 Bacteria 958
395 Ga0373940_0069726 3300035088 Unclassified 1021
396 Ga0373940_0073419 3300035088 Unclassified 1000
397 Ga0373940_0194261 3300035088 Unclassified 665
398 Ga0373949_0013622 3300035090 Bacteria 1805
399 Ga0373949_0016761 3300035090 Bacteria 1645
400 Ga0373951_0010086 3300035091 Bacteria 2120
401 Ga0373952_0102240 3300035092 Bacteria 757
402 Ga0373923_0004236 3300035111 Bacteria 4736
403 Ga0373923_0056622 3300035111 Bacteria 1656
404 Ga0373923_0136030 3300035111 Bacteria 1108
405 Ga0373923_0179470 3300035111 Bacteria 972
406 Ga0373923_0313732 3300035111 Bacteria 744
407 Ga0373923_0316615 3300035111 Bacteria 740
408 Ga0373923_0394451 3300035111 Unclassified 665
409 Ga0373923_0480089 3300035111 Unclassified 605
410 Ga0373923_0564858 3300035111 Bacteria 558
411 Ga0373936_0004218 3300035113 Bacteria 5422
412 Ga0373936_0110775 3300035113 Bacteria 1165
413 Ga0373936_0246688 3300035113 Bacteria 797
414 Ga0373936_0252938 3300035113 Bacteria 787
415 Ga0373939_0071112 3300035114 Bacteria 1133
416 Ga0373939_0327359 3300035114 Bacteria 618
417 Ga0373941_0006980 3300035115 Unclassified 2744
418 Ga0373941_0120095 3300035115 Bacteria 936
419 Ga0373945_0029669 3300035116 Bacteria 1923
420 Ga0373953_0000084 3300035117 Bacteria 22481
421 Ga0373953_0000923 3300035117 Bacteria 8227
422 Ga0373953_0031819 3300035117 Bacteria 2054
423 Ga0373953_0098302 3300035117 Bacteria 1230
424 Ga0373953_0133458 3300035117 Bacteria 1059
425 Ga0373953_0167413 3300035117 Bacteria 946
426 Ga0373953_0355166 3300035117 Bacteria 642
427 Ga0373954_0003839 3300035118 Bacteria 6426
428 Ga0373954_0011646 3300035118 Unclassified 3902
429 Ga0373954_0019992 3300035118 Bacteria 3023
430 Ga0373954_0041490 3300035118 Bacteria 2146
431 Ga0373954_0532331 3300035118 Unclassified 582
432 Ga0373956_0000007 3300035119 Bacteria 63448
433 Ga0373956_0002523 3300035119 Bacteria 7452
434 Ga0373956_0026014 3300035119 Bacteria 2533
435 Ga0373956_0056883 3300035119 Bacteria 1766
436 Ga0373956_0062845 3300035119 Bacteria 1683
437 Ga0373956_0160706 3300035119 Bacteria 1058
438 Ga0373956_0338483 3300035119 Bacteria 717
439 Ga0373957_0000024 3300035120 Bacteria 39141
440 Ga0373957_0000702 3300035120 Bacteria 8677
441 Ga0373957_0000994 3300035120 Bacteria 7461
442 Ga0373957_0048228 3300035120 Bacteria 1622
443 Ga0373957_0105863 3300035120 Bacteria 1129
444 Ga0373957_0343265 3300035120 Bacteria 637
445 Ga0373957_0460855 3300035120 Unclassified 551
446 Ga0373960_0115475 3300035121 Bacteria 885
447 Ga0373943_0788562 3300035170 Unclassified 565
448 Ga0373946_0162184 3300035171 Bacteria 1050
449 Ga0373946_0213227 3300035171 Bacteria 930
450 Ga0373955_0000007 3300035172 Bacteria 87917
451 Ga0373955_0000515 3300035172 Bacteria 16465
452 Ga0373955_0008335 3300035172 Bacteria 4810
453 Ga0373955_0022057 3300035172 Bacteria 3224
454 Ga0373955_0066861 3300035172 Bacteria 1999
455 Ga0373955_0127993 3300035172 Bacteria 1480
456 Ga0373955_0206105 3300035172 Bacteria 1171
457 Ga0373955_0262269 3300035172 Bacteria 1037
458 Ga0373942_0047809 3300035207 Bacteria 1190
459 Ga0373961_0029012 3300035241 Bacteria 1530
460 Ga0373961_0160668 3300035241 Bacteria 771
461 Ga0373962_0009476 3300035242 Bacteria 2414
462 Ga0373924_0000549 3300035410 Bacteria 11538
463 Ga0373924_0003234 3300035410 Bacteria 5572
464 Ga0373924_0005522 3300035410 Bacteria 4483
465 Ga0373924_0008042 3300035410 Bacteria 3818
466 Ga0373924_0021111 3300035410 Bacteria 2538
467 Ga0373924_0044440 3300035410 Bacteria 1825
468 Ga0373924_0099290 3300035410 Bacteria 1251
469 Ga0373924_0335527 3300035410 Unclassified 673
470 Ga0373931_0007289 3300035691 Bacteria 5203
471 Ga0373931_0588235 3300035691 Unclassified 726
472 Ga0373935_0042315 3300035692 Unclassified 2864
473 Ga0373935_0058944 3300035692 Bacteria 2453
474 Ga0373935_0102985 3300035692 Bacteria 1884
475 Ga0373935_0129031 3300035692 Bacteria 1697
476 Ga0373935_0227928 3300035692 Bacteria 1296
477 Ga0373935_0232599 3300035692 Bacteria 1284
478 Ga0373935_0357506 3300035692 Unclassified 1042
479 Ga0373935_0792642 3300035692 Unclassified 699
480 Ga0373935_1025005 3300035692 Bacteria 613
481 Ga0373927_0040668 3300035695 Bacteria 3016
482 Ga0373933_0000002 3300035724 Bacteria 151785
483 Ga0373933_0000507 3300035724 Bacteria 24320
484 Ga0373933_0010125 3300035724 Bacteria 5162
485 Ga0373933_0016037 3300035724 Bacteria 4185
486 Ga0373933_0023500 3300035724 Bacteria 3522
487 Ga0373933_0042757 3300035724 Bacteria 2678
488 Ga0373933_0099864 3300035724 Bacteria 1799
489 Ga0373933_0187527 3300035724 Bacteria 1320
490 Ga0373933_0354340 3300035724 Bacteria 953
491 Ga0373933_0377478 3300035724 Bacteria 923
492 Ga0373933_0555170 3300035724 Unclassified 753
493 Ga0373947_0045765 3300035725 Bacteria 2619
494 Ga0373947_0580152 3300035725 Bacteria 764
495 Ga0373947_0613926 3300035725 Bacteria 741
496 Ga0310104_02245 3300036242 Bacteria 1649
497 Ga0373937_0000014 3300036401 Bacteria 151785
498 Ga0373937_0001460 3300036401 Bacteria 19784
499 Ga0373937_0045905 3300036401 Bacteria 3993
500 Ga0373937_0047413 3300036401 Bacteria 3931
501 Ga0373937_0129547 3300036401 Bacteria 2356
502 Ga0373937_0164171 3300036401 Bacteria 2082
503 Ga0373937_0211646 3300036401 Unclassified 1824
504 Ga0373937_0241320 3300036401 Bacteria 1702
505 Ga0373937_0251406 3300036401 Bacteria 1666
506 Ga0373937_0314424 3300036401 Bacteria 1481
507 Ga0373937_0472999 3300036401 Bacteria 1190
508 Ga0373937_1277377 3300036401 Bacteria 682
509 Ga0265778_005647 3300036457 Unclassified 1328
510 Ga0265778_061930 3300036457 Unclassified 524
511 Ga0373925_0000373 3300037068 Bacteria 46652
512 Ga0373925_0001704 3300037068 Bacteria 18516
513 Ga0373925_0014582 3300037068 Bacteria 5679
514 Ga0373925_0020188 3300037068 Bacteria 4849
515 Ga0373925_0044387 3300037068 Bacteria 3300
516 Ga0373925_0068135 3300037068 Bacteria 2685
517 Ga0373925_0227508 3300037068 Bacteria 1490
518 Ga0373925_1148892 3300037068 Unclassified 638
519 Ga0395898_0128858 3300037466 Bacteria 2424
520 Ga0395898_0771912 3300037466 Bacteria 902
521 Ga0436364_0037108 3300037853 Bacteria 71393
522 Ga0436364_0787453 3300037853 Bacteria 1290
523 Ga0436364_1101267 3300037853 Bacteria 67281
524 Ga0466963_0051020 3300044694 Bacteria 2741
525 Ga0466958_0236814 3300045836 Bacteria 1166
526 Ga0466967_0093023 3300045976 Bacteria 2743
527 Ga0495592_0000077 3300046454 Bacteria 85837
528 Ga0495592_0002671 3300046454 Bacteria 12603
529 Ga0495592_0004469 3300046454 Bacteria 10228
530 Ga0495592_0019917 3300046454 Bacteria 5101
531 Ga0495592_0111874 3300046454 Bacteria 1931
532 Ga0495592_0207603 3300046454 Bacteria 1317
533 Ga0495592_0218829 3300046454 Bacteria 1274
534 Ga0495592_0328586 3300046454 Bacteria 986
535 Ga0495592_0811343 3300046454 Bacteria 555
536 Ga0495592_0837131 3300046454 Unclassified 544
537 Ga0495603_0015082 3300046455 Bacteria 4674
538 Ga0495629_0001557 3300046459 Bacteria 18015
539 Ga0495629_0003864 3300046459 Bacteria 11294
540 Ga0495629_0095977 3300046459 Unclassified 2068
541 Ga0495641_0004654 3300046461 Bacteria 9591
542 Ga0495641_0446907 3300046461 Unclassified 588
543 Ga0495651_0000019 3300046462 Bacteria 120970
544 Ga0495651_0000798 3300046462 Bacteria 24389
545 Ga0495651_0002496 3300046462 Bacteria 14228
546 Ga0495651_0010232 3300046462 Bacteria 7200
547 Ga0495651_0011292 3300046462 Bacteria 6864
548 Ga0495651_0027504 3300046462 Bacteria 4429
549 Ga0495651_0087391 3300046462 Bacteria 2344
550 Ga0495651_0099790 3300046462 Bacteria 2164
551 Ga0495651_0345108 3300046462 Bacteria 985
552 Ga0495651_0626085 3300046462 Unclassified 677
553 Ga0495653_0000252 3300046463 Bacteria 42994
554 Ga0495653_0003377 3300046463 Bacteria 12834
555 Ga0495653_0004643 3300046463 Bacteria 11110
556 Ga0495653_0008354 3300046463 Bacteria 8485
557 Ga0495653_0010757 3300046463 Bacteria 7492
558 Ga0495653_0017464 3300046463 Bacteria 5834
559 Ga0495653_0039019 3300046463 Bacteria 3723
560 Ga0495653_0117177 3300046463 Bacteria 1903
561 Ga0495653_0165935 3300046463 Bacteria 1528
562 Ga0495653_0303146 3300046463 Bacteria 1041
563 Ga0495653_0517388 3300046463 Unclassified 742
564 Ga0495653_0570295 3300046463 Unclassified 698
565 Ga0495580_0009989 3300046472 Bacteria 7421
566 Ga0495580_0353633 3300046472 Bacteria 995
567 Ga0495582_0003757 3300046473 Bacteria 8560
568 Ga0495582_0008905 3300046473 Bacteria 5538
569 Ga0495582_0052093 3300046473 Bacteria 2257
570 Ga0495639_0023727 3300046475 Bacteria 2697
571 Ga0495662_0015519 3300046476 Bacteria 3697
572 Ga0495662_0038680 3300046476 Bacteria 2306
573 Ga0495662_0187277 3300046476 Bacteria 1020
574 Ga0495664_0013599 3300046477 Bacteria 4615
575 Ga0495664_0027093 3300046477 Bacteria 3341
576 Ga0495664_0059757 3300046477 Unclassified 2269
577 Ga0495664_0110325 3300046477 Bacteria 1660
578 Ga0495664_0181731 3300046477 Bacteria 1275
579 Ga0495664_0216956 3300046477 Bacteria 1158
580 Ga0495664_0241888 3300046477 Archaea 1092
581 Ga0495664_0263247 3300046477 Bacteria 1042
582 Ga0495664_0526357 3300046477 Bacteria 705
583 Ga0495594_0058118 3300046499 Bacteria 2136
584 Ga0495608_0000028 3300046511 Bacteria 151829
585 Ga0495608_0000630 3300046511 Bacteria 24324
586 Ga0495608_0001073 3300046511 Bacteria 19281
587 Ga0495608_0030352 3300046511 Bacteria 3660
588 Ga0495608_0071331 3300046511 Unclassified 2266
589 Ga0495608_0120100 3300046511 Bacteria 1686
590 Ga0495608_0151698 3300046511 Bacteria 1477
591 Ga0495608_0292448 3300046511 Bacteria 1009
592 Ga0495618_0006927 3300046514 Bacteria 6867
593 Ga0495618_0069043 3300046514 Unclassified 2247
594 Ga0495618_0139021 3300046514 Bacteria 1553
595 Ga0495618_0210974 3300046514 Bacteria 1227
596 Ga0495618_0242575 3300046514 Bacteria 1132
597 Ga0495618_0265639 3300046514 Bacteria 1073
598 Ga0495618_0297745 3300046514 Bacteria 1003
599 Ga0495628_0000337 3300046516 Bacteria 42541
600 Ga0495628_0001397 3300046516 Bacteria 22153
601 Ga0495628_0002940 3300046516 Bacteria 15281
602 Ga0495628_0007939 3300046516 Bacteria 9142
603 Ga0495628_0025055 3300046516 Bacteria 4877
604 Ga0495628_0073798 3300046516 Bacteria 2658
605 Ga0495628_0080452 3300046516 Bacteria 2532
606 Ga0495628_0176967 3300046516 Bacteria 1615
607 Ga0495628_0221717 3300046516 Bacteria 1420
608 Ga0495628_0240418 3300046516 Bacteria 1354
609 Ga0495628_0479676 3300046516 Bacteria 900
610 Ga0495628_0797776 3300046516 Bacteria 661
611 Ga0495630_0015723 3300046517 Bacteria 5529
612 Ga0495630_0017241 3300046517 Bacteria 5289
613 Ga0495630_0018016 3300046517 Bacteria 5181
614 Ga0495630_0082836 3300046517 Bacteria 2421
615 Ga0495630_0364152 3300046517 Bacteria 1107
616 Ga0495630_0871694 3300046517 Bacteria 686
617 Ga0495630_0891594 3300046517 Bacteria 678
618 Ga0495630_1313459 3300046517 Unclassified 545
619 Ga0495630_1333270 3300046517 Bacteria 540
620 Ga0495666_0404550 3300046526 Bacteria 613
621 Ga0495652_0000031 3300046529 Bacteria 151765
622 Ga0495652_0003271 3300046529 Bacteria 16138
623 Ga0495652_0003576 3300046529 Bacteria 15253
624 Ga0495652_0007308 3300046529 Bacteria 10187
625 Ga0495652_0112765 3300046529 Bacteria 2184
626 Ga0495652_0137619 3300046529 Bacteria 1924
627 Ga0495652_0158058 3300046529 Unclassified 1763
628 Ga0495652_0180700 3300046529 Bacteria 1619
629 Ga0495652_0344535 3300046529 Bacteria 1069
630 Ga0495652_0381455 3300046529 Bacteria 1002
631 Ga0495652_0702169 3300046529 Bacteria 681
632 Ga0495652_0844350 3300046529 Unclassified 607
633 Ga0495665_0007582 3300046531 Bacteria 5877
634 Ga0495665_0009220 3300046531 Bacteria 5346
635 Ga0495665_0171308 3300046531 Bacteria 1130
636 Ga0495665_0424489 3300046531 Bacteria 673
637 Ga0495640_0007314 3300046533 Bacteria 8692
638 Ga0495640_0009138 3300046533 Bacteria 7737
639 Ga0495640_0009834 3300046533 Bacteria 7423
640 Ga0495640_0020499 3300046533 Bacteria 4865
641 Ga0495640_0036929 3300046533 Bacteria 3449
642 Ga0495640_0111789 3300046533 Bacteria 1784
643 Ga0495640_0125737 3300046533 Bacteria 1663
644 Ga0495640_0570823 3300046533 Unclassified 685
645 Ga0495586_0034210 3300046535 Unclassified 2729
646 Ga0495586_0042447 3300046535 Bacteria 2449
647 Ga0495586_0047495 3300046535 Bacteria 2318
648 Ga0495586_0235443 3300046535 Bacteria 1043
649 Ga0495586_0321362 3300046535 Bacteria 888
650 Ga0495586_0461387 3300046535 Bacteria 732
651 Ga0495587_0000023 3300046536 Bacteria 151763
652 Ga0495587_0000605 3300046536 Bacteria 24467
653 Ga0495587_0017195 3300046536 Bacteria 4496
654 Ga0495587_0019208 3300046536 Bacteria 4233
655 Ga0495587_0038095 3300046536 Bacteria 2884
656 Ga0495587_0080734 3300046536 Bacteria 1884
657 Ga0495587_0150278 3300046536 Bacteria 1327
658 Ga0495587_0168066 3300046536 Bacteria 1246
659 Ga0495587_0246748 3300046536 Bacteria 1004
660 Ga0495587_0485569 3300046536 Unclassified 683
661 Ga0495645_0001541 3300046543 Bacteria 15575
662 Ga0495645_0165556 3300046543 Bacteria 1525
663 Ga0495645_0167115 3300046543 Bacteria 1516
664 Ga0495645_0200680 3300046543 Bacteria 1353
665 Ga0495645_0275153 3300046543 Bacteria 1109
666 Ga0495645_0358643 3300046543 Bacteria 937
667 Ga0495645_0608445 3300046543 Bacteria 671
668 Ga0495645_0811952 3300046543 Bacteria 560
669 Ga0495667_0000054 3300046559 Bacteria 105009
670 Ga0495667_0000537 3300046559 Bacteria 24240
671 Ga0495667_0001852 3300046559 Bacteria 14028
672 Ga0495667_0006609 3300046559 Bacteria 7873
673 Ga0495667_0014908 3300046559 Bacteria 5252
674 Ga0495667_0025502 3300046559 Bacteria 3983
675 Ga0495667_0030746 3300046559 Bacteria 3607
676 Ga0495667_0176125 3300046559 Bacteria 1373
677 Ga0495667_0249565 3300046559 Bacteria 1129
678 Ga0495667_0433992 3300046559 Bacteria 826
679 Ga0495667_0785427 3300046559 Bacteria 587
680 Ga0495667_0990582 3300046559 Bacteria 513
681 Ga0495634_0007391 3300046642 Bacteria 8266
682 Ga0495634_0047022 3300046642 Bacteria 2909
683 Ga0495634_0073656 3300046642 Bacteria 2245
684 Ga0495634_0253555 3300046642 Bacteria 1075
685 Ga0495634_0575132 3300046642 Bacteria 655
686 Ga0495635_0007332 3300046663 Bacteria 7697
687 Ga0495635_0010898 3300046663 Bacteria 6373
688 Ga0495635_0028679 3300046663 Bacteria 3869
689 Ga0495635_0043166 3300046663 Bacteria 3111
690 Ga0495635_0052383 3300046663 Bacteria 2812
691 Ga0495635_0056438 3300046663 Bacteria 2703
692 Ga0495635_0224288 3300046663 Bacteria 1270
693 Ga0495635_0477239 3300046663 Bacteria 822
694 Ga0495588_0354385 3300046674 Unclassified 771
695 Ga0495588_0698851 3300046674 Unclassified 530
696 Ga0495657_0000022 3300046675 Bacteria 151837
697 Ga0495657_0001623 3300046675 Bacteria 19291
698 Ga0495657_0019891 3300046675 Bacteria 4837
699 Ga0495657_0025659 3300046675 Bacteria 4182
700 Ga0495657_0031326 3300046675 Bacteria 3717
701 Ga0495657_0034083 3300046675 Bacteria 3539
702 Ga0495657_0081932 3300046675 Bacteria 2086
703 Ga0495657_0141062 3300046675 Bacteria 1502
704 Ga0495657_0160676 3300046675 Bacteria 1390
705 Ga0495657_0290507 3300046675 Bacteria 976
706 Ga0495657_0309586 3300046675 Bacteria 940
707 Ga0495599_0000125 3300046678 Bacteria 50781
708 Ga0495599_0000408 3300046678 Bacteria 24589
709 Ga0495599_0000918 3300046678 Bacteria 16473
710 Ga0495599_0068859 3300046678 Bacteria 2209
711 Ga0495599_0139996 3300046678 Bacteria 1501
712 Ga0495599_0227269 3300046678 Bacteria 1140
713 Ga0495599_0270759 3300046678 Bacteria 1030
714 Ga0495599_0342355 3300046678 Bacteria 897
715 Ga0495599_0364063 3300046678 Unclassified 865
716 Ga0495599_0553227 3300046678 Unclassified 673
717 Ga0495623_0000797 3300046679 Bacteria 21197
718 Ga0495623_0003230 3300046679 Bacteria 10766
719 Ga0495623_0021765 3300046679 Bacteria 4141
720 Ga0495623_0044612 3300046679 Bacteria 2816
721 Ga0495623_0078087 3300046679 Bacteria 2052
722 Ga0495623_0220595 3300046679 Bacteria 1080
723 Ga0495646_0011988 3300046680 Bacteria 5513
724 Ga0495646_0013443 3300046680 Bacteria 5204
725 Ga0495646_0018933 3300046680 Bacteria 4359
726 Ga0495646_0019395 3300046680 Bacteria 4306
727 Ga0495646_0028041 3300046680 Bacteria 3528
728 Ga0495646_0040386 3300046680 Bacteria 2874
729 Ga0495646_0373425 3300046680 Bacteria 744
730 Ga0495647_0060509 3300046681 Bacteria 1493
731 Ga0495658_0005016 3300046683 Bacteria 6500
732 Ga0495658_0019344 3300046683 Bacteria 3553
733 Ga0495658_0184159 3300046683 Bacteria 1296
734 Ga0495658_0645519 3300046683 Bacteria 678
735 Ga0495613_0010040 3300046689 Bacteria 7033
736 Ga0495613_0040724 3300046689 Bacteria 3441
737 Ga0495613_0303649 3300046689 Bacteria 1104
738 Ga0495613_0879351 3300046689 Bacteria 581
739 Ga0495624_0062162 3300046690 Bacteria 2337
740 Ga0495624_0096475 3300046690 Bacteria 1821
741 Ga0495624_0591969 3300046690 Bacteria 661
742 Ga0495600_0002853 3300046809 Bacteria 10060
743 Ga0495600_0012611 3300046809 Bacteria 5291
744 Ga0495600_0040792 3300046809 Bacteria 3024
745 Ga0495600_0063555 3300046809 Bacteria 2412
746 Ga0495600_0069165 3300046809 Bacteria 2307
747 Ga0495600_0096300 3300046809 Unclassified 1929
748 Ga0495600_0126883 3300046809 Bacteria 1659
749 Ga0495600_0159285 3300046809 Bacteria 1459
750 Ga0495581_0005608 3300047315 Bacteria 7275
751 Ga0495581_0007642 3300047315 Bacteria 6255
752 Ga0495581_0065108 3300047315 Bacteria 2107
753 Ga0495581_0360629 3300047315 Bacteria 848
754 Ga0495604_0000022 3300047317 Bacteria 151744
755 Ga0495604_0001543 3300047317 Bacteria 18968
756 Ga0495604_0002956 3300047317 Bacteria 13606
757 Ga0495604_0004407 3300047317 Bacteria 11141
758 Ga0495604_0010952 3300047317 Bacteria 7199
759 Ga0495604_0049504 3300047317 Bacteria 3264
760 Ga0495604_0107071 3300047317 Bacteria 2044
761 Ga0495604_0246550 3300047317 Unclassified 1219
762 Ga0495604_0272387 3300047317 Bacteria 1146
763 Ga0495604_0309630 3300047317 Bacteria 1058
764 Ga0495674_0003502 3300047319 Bacteria 15276
765 Ga0495674_0011185 3300047319 Bacteria 8474
766 Ga0495674_0017960 3300047319 Bacteria 6585
767 Ga0495674_0052414 3300047319 Bacteria 3590
768 Ga0495674_0100855 3300047319 Bacteria 2456
769 Ga0495674_0119975 3300047319 Bacteria 2222
770 Ga0495674_0122790 3300047319 Bacteria 2193
771 Ga0495674_0156110 3300047319 Bacteria 1911
772 Ga0495674_0514326 3300047319 Bacteria 956
773 Ga0495674_0610323 3300047319 Bacteria 863
774 Ga0495674_0748919 3300047319 Bacteria 763
775 Ga0495674_1301116 3300047319 Bacteria 545
776 Ga0495676_0123102 3300047321 Bacteria 1883
777 Ga0495676_0471218 3300047321 Bacteria 827
778 Ga0495676_0830946 3300047321 Bacteria 594
779 Ga0495680_0000154 3300047322 Bacteria 69567
780 Ga0495680_0001902 3300047322 Bacteria 21925
781 Ga0495680_0003448 3300047322 Bacteria 15586
782 Ga0495680_0009581 3300047322 Bacteria 8699
783 Ga0495680_0012869 3300047322 Bacteria 7331
784 Ga0495680_0031915 3300047322 Bacteria 4281
785 Ga0495680_0035570 3300047322 Bacteria 4010
786 Ga0495680_0044489 3300047322 Bacteria 3510
787 Ga0495680_0472025 3300047322 Bacteria 855
788 Ga0495680_0756159 3300047322 Bacteria 638
789 Ga0495675_0000235 3300047444 Bacteria 39995
790 Ga0495675_0006489 3300047444 Bacteria 7159
791 Ga0495675_0027380 3300047444 Bacteria 3631
792 Ga0495675_0060940 3300047444 Bacteria 2391
793 Ga0495675_0064506 3300047444 Unclassified 2317
794 Ga0495675_0079269 3300047444 Bacteria 2068
795 Ga0495675_0093748 3300047444 Bacteria 1883
796 Ga0495675_0716074 3300047444 Unclassified 559
797 Ga0495684_0002498 3300047471 Bacteria 14648
798 Ga0495684_0003448 3300047471 Bacteria 12381
799 Ga0495684_0006901 3300047471 Bacteria 8815
800 Ga0495684_0037269 3300047471 Bacteria 3729
801 Ga0495684_0057283 3300047471 Bacteria 2970
802 Ga0495684_0499929 3300047471 Unclassified 836
803 Ga0495684_0532602 3300047471 Bacteria 802
804 Ga0495684_0648246 3300047471 Bacteria 706
805 Ga0495684_0673310 3300047471 Bacteria 689
806 Ga0495684_0935619 3300047471 Unclassified 555
807 Ga0495593_0003416 3300047673 Bacteria 9511
808 Ga0495593_0037411 3300047673 Bacteria 2625
809 Ga0495593_0038128 3300047673 Bacteria 2596
810 Ga0495602_0000251 3300048088 Bacteria 50166
811 Ga0495602_0001263 3300048088 Bacteria 24919
812 Ga0495602_0021230 3300048088 Bacteria 6398
813 Ga0495602_0031790 3300048088 Bacteria 4983
814 Ga0495602_0078803 3300048088 Bacteria 2781
815 Ga0495602_0109463 3300048088 Bacteria 2247
816 Ga0495602_0123138 3300048088 Bacteria 2082
817 Ga0495602_0308311 3300048088 Bacteria 1156
818 Ga0495602_0359072 3300048088 Bacteria 1049
819 Ga0495602_0416945 3300048088 Bacteria 954
820 Ga0495602_0490428 3300048088 Bacteria 860
821 Ga0495602_0563992 3300048088 Bacteria 787
822 Ga0495614_0022156 3300048089 Bacteria 2743
823 Ga0495614_0054616 3300048089 Bacteria 1713
824 Ga0496100_0348139 3300048903 Bacteria 1118
825 Ga0496100_1068297 3300048903 Bacteria 636
826 Ga0496100_1177138 3300048903 Unclassified 604
827 Ga0496101_0020360 3300048904 Bacteria 4539
828 Ga0496101_0284736 3300048904 Unclassified 1292
829 Ga0496102_0383507 3300048905 Bacteria 1322
830 Ga0496103_0189036 3300048906 Unclassified 1324
831 Ga0496103_0480845 3300048906 Bacteria 795
832 Ga0496104_0033323 3300048907 Unclassified 4797
833 Ga0496104_1001737 3300048907 Bacteria 739
834 Ga0496105_0003676 3300048908 Bacteria 11410
835 Ga0496105_0296952 3300048908 Bacteria 1299
836 Ga0496105_0734781 3300048908 Unclassified 755
837 Ga0496106_0017660 3300048909 Bacteria 5277
838 Ga0496106_0248619 3300048909 Bacteria 1421
839 Ga0496106_0776858 3300048909 Unclassified 760
840 Ga0496107_0045925 3300048910 Unclassified 3143
841 Ga0496108_0009624 3300048911 Bacteria 7834
842 Ga0496108_0822512 3300048911 Unclassified 800
843 Ga0496108_1287560 3300048911 Unclassified 615
844 Ga0496109_0059843 3300048912 Unclassified 3480
845 Ga0496109_0332485 3300048912 Bacteria 1434
846 Ga0496110_0023186 3300048913 Bacteria 5278
847 Ga0496110_0986764 3300048913 Unclassified 749
848 Ga0496111_0090092 3300048914 Unclassified 2247
849 Ga0496111_0180004 3300048914 Bacteria 1571
850 Ga0496112_0018059 3300048915 Bacteria 6638
851 Ga0496112_0383225 3300048915 Bacteria 1347
852 Ga0496112_0474127 3300048915 Bacteria 1188
853 Ga0496112_0596566 3300048915 Bacteria 1036
854 Ga0496113_0043910 3300048916 Unclassified 3309
855 Ga0496113_0688241 3300048916 Unclassified 816
856 Ga0496114_0008516 3300048917 Bacteria 8130
857 Ga0496114_0619402 3300048917 Bacteria 953
858 Ga0496115_0011257 3300048918 Bacteria 6703
859 Ga0496115_0074354 3300048918 Bacteria 2759
860 Ga0496126_0007521 3300048929 Bacteria 11929
861 Ga0496126_0009157 3300048929 Bacteria 10567
862 Ga0496126_0027096 3300048929 Bacteria 5482
863 Ga0501040_1049803 3300049576 Unclassified 591
864 nmdc:mga05p37_2166644_c1 3300050507 Bacteria 518
865 nmdc:mga05p37_22004_c1 3300050507 Bacteria 7725
866 nmdc:mga06r32_500290_c1 3300050510 Unclassified 1192
867 nmdc:mga0n895_31385_c1 3300050512 Bacteria 5087
868 nmdc:mga0n895_384159_c1 3300050512 Bacteria 1421
869 nmdc:mga0n895_91844_c1 3300050512 Bacteria 3039
870 nmdc:mga0rr50_216559_c1 3300050513 Unclassified 1580
871 nmdc:mga0rr50_23633_c1 3300050513 Bacteria 4242
872 nmdc:mga0rr50_453393_c1 3300050513 Bacteria 1087
873 nmdc:mga0rr50_46566_c1 3300050513 Unclassified 3194
874 nmdc:mga08x19_120296_c1 3300050514 Bacteria 1760
875 nmdc:mga08x19_82232_c1 3300050514 Unclassified 2116
876 nmdc:mga0a205_12757_c1 3300050515 Bacteria 7791
877 nmdc:mga0a205_169598_c1 3300050515 Bacteria 2078
878 nmdc:mga0a205_225589_c1 3300050515 Unclassified 1758
879 Ga0495601_0001455 3300053077 Bacteria 13046
880 Ga0495601_0053364 3300053077 Bacteria 2555
881 Ga0495601_0366732 3300053077 Unclassified 935
882 Ga0495612_0037716 3300053078 Bacteria 1963
883 Ga0495612_0112059 3300053078 Bacteria 1168
884 Ga0495612_0192636 3300053078 Bacteria 898
885 Ga0495612_0426118 3300053078 Unclassified 605
886 Ga0495595_0000843 3300053084 Bacteria 11740
887 Ga0495595_0006287 3300053084 Bacteria 4837
888 Ga0495595_0007342 3300053084 Bacteria 4512
889 Ga0495595_0024435 3300053084 Bacteria 2669
890 Ga0495595_0043393 3300053084 Bacteria 2062
891 Ga0495595_0143843 3300053084 Bacteria 1171
892 Ga0495595_0387754 3300053084 Unclassified 707
893 Ga0495619_0035776 3300053085 Bacteria 3231
894 Ga0495619_0060984 3300053085 Bacteria 2509
895 Ga0495619_0080308 3300053085 Unclassified 2195
896 Ga0495619_0371497 3300053085 Archaea 988
897 Ga0495619_0873685 3300053085 Unclassified 606
898 Ga0495619_1141415 3300053085 Bacteria 517
899 Ga0587084_022021 3300059477 Bacteria 961
900 Ga0587066_054018 3300059490 Bacteria 800
901 Ga0587115_088045 3300059626 Unclassified 560
902 Ga0587067_008625 3300059640 Unclassified 1495

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0344535 Ga0495652_0344535_46_414 117
2 3300046543 Ga0495645_0165556 Ga0495645_0165556_1096_1464 117
3 3300035725 Ga0373947_0613926 Ga0373947_0613926_19_384 119
4 3300013297 Ga0157378_11401071 Ga0157378_114010711 120
5 3300046472 Ga0495580_0353633 Ga0495580_0353633_575_961 120
6 3300035086 Ga0373934_0000453 Ga0373934_0000453_47_436 121
7 3300046535 Ga0495586_0042447 Ga0495586_0042447_2037_2429 121
8 3300046559 Ga0495667_0785427 Ga0495667_0785427_149_541 121
9 3300053078 Ga0495612_0112059 Ga0495612_0112059_38_430 121
10 3300010375 Ga0105239_11672622 Ga0105239_116726221 122
11 3300046543 Ga0495645_0811952 Ga0495645_0811952_32_418 125
12 3300035724 Ga0373933_0187527 Ga0373933_0187527_409_894 136
13 3300025926 Ga0207659_11099803 Ga0207659_110998031 137
14 3300025915 Ga0207693_10579703 Ga0207693_105797032 138
15 3300025916 Ga0207663_10829456 Ga0207663_108294562 138
16 3300035086 Ga0373934_0043283 Ga0373934_0043283_529_960 138
17 3300035113 Ga0373936_0252938 Ga0373936_0252938_19_450 138
18 3300035116 Ga0373945_0029669 Ga0373945_0029669_693_1124 138
19 3300035119 Ga0373956_0062845 Ga0373956_0062845_992_1423 138
20 3300035170 Ga0373943_0788562 Ga0373943_0788562_101_532 138
21 3300035172 Ga0373955_0008335 Ga0373955_0008335_2082_2513 138
22 3300035410 Ga0373924_0008042 Ga0373924_0008042_1058_1489 138
23 3300035692 Ga0373935_0129031 Ga0373935_0129031_1235_1666 138
24 3300035724 Ga0373933_0016037 Ga0373933_0016037_2236_2667 138
25 3300036401 Ga0373937_0047413 Ga0373937_0047413_126_557 138
26 3300037068 Ga0373925_0068135 Ga0373925_0068135_1222_1653 138
27 3300046454 Ga0495592_0019917 Ga0495592_0019917_2390_2821 138
28 3300046454 Ga0495592_0811343 Ga0495592_0811343_84_515 138
29 3300046462 Ga0495651_0010232 Ga0495651_0010232_6753_7184 138
30 3300046463 Ga0495653_0017464 Ga0495653_0017464_3862_4293 138
31 3300046473 Ga0495582_0052093 Ga0495582_0052093_1110_1541 138
32 3300046477 Ga0495664_0013599 Ga0495664_0013599_90_521 138
33 3300046511 Ga0495608_0001073 Ga0495608_0001073_1625_2056 138
34 3300046514 Ga0495618_0210974 Ga0495618_0210974_20_451 138
35 3300046514 Ga0495618_0265639 Ga0495618_0265639_223_654 138
36 3300046516 Ga0495628_0002940 Ga0495628_0002940_2315_2746 138
37 3300046517 Ga0495630_0018016 Ga0495630_0018016_801_1232 138
38 3300046529 Ga0495652_0381455 Ga0495652_0381455_300_731 138
39 3300046531 Ga0495665_0171308 Ga0495665_0171308_355_786 138
40 3300046533 Ga0495640_0111789 Ga0495640_0111789_852_1283 138
41 3300046535 Ga0495586_0047495 Ga0495586_0047495_443_874 138
42 3300046536 Ga0495587_0080734 Ga0495587_0080734_678_1109 138
43 3300046543 Ga0495645_0167115 Ga0495645_0167115_979_1410 138
44 3300046559 Ga0495667_0006609 Ga0495667_0006609_1304_1735 138
45 3300046642 Ga0495634_0047022 Ga0495634_0047022_2378_2809 138
46 3300046663 Ga0495635_0052383 Ga0495635_0052383_2283_2714 138
47 3300046674 Ga0495588_0698851 Ga0495588_0698851_16_447 138
48 3300046675 Ga0495657_0031326 Ga0495657_0031326_1178_1609 138
49 3300046678 Ga0495599_0553227 Ga0495599_0553227_122_553 138
50 3300046679 Ga0495623_0078087 Ga0495623_0078087_824_1255 138
51 3300046680 Ga0495646_0018933 Ga0495646_0018933_699_1130 138
52 3300046683 Ga0495658_0184159 Ga0495658_0184159_337_768 138
53 3300046690 Ga0495624_0062162 Ga0495624_0062162_502_933 138
54 3300046809 Ga0495600_0002853 Ga0495600_0002853_8874_9305 138
55 3300047315 Ga0495581_0360629 Ga0495581_0360629_361_792 138
56 3300047317 Ga0495604_0010952 Ga0495604_0010952_2665_3096 138
57 3300047319 Ga0495674_0052414 Ga0495674_0052414_2657_3088 138
58 3300047319 Ga0495674_0748919 Ga0495674_0748919_120_551 138
59 3300047322 Ga0495680_0001902 Ga0495680_0001902_3700_4131 138
60 3300047444 Ga0495675_0079269 Ga0495675_0079269_815_1246 138
61 3300047471 Ga0495684_0006901 Ga0495684_0006901_6157_6588 138
62 3300047673 Ga0495593_0038128 Ga0495593_0038128_1101_1532 138
63 3300048088 Ga0495602_0109463 Ga0495602_0109463_33_464 138
64 3300048088 Ga0495602_0416945 Ga0495602_0416945_21_452 138
65 3300053077 Ga0495601_0366732 Ga0495601_0366732_24_455 138
66 3300053084 Ga0495595_0006287 Ga0495595_0006287_2630_3061 138
67 3300053085 Ga0495619_0035776 Ga0495619_0035776_683_1114 138
68 3300053085 Ga0495619_1141415 Ga0495619_1141415_60_491 138
69 3300047319 Ga0495674_0514326 Ga0495674_0514326_465_893 140
70 3300005336 Ga0070680_100259093 Ga0070680_1002590932 141
71 3300005336 Ga0070680_100277186 Ga0070680_1002771862 141
72 3300005337 Ga0070682_100109485 Ga0070682_1001094853 141
73 3300005339 Ga0070660_100441711 Ga0070660_1004417112 141
74 3300005341 Ga0070691_10260930 Ga0070691_102609301 141
75 3300005343 Ga0070687_100980794 Ga0070687_1009807941 141
76 3300005355 Ga0070671_100651498 Ga0070671_1006514981 141
77 3300005366 Ga0070659_100142422 Ga0070659_1001424222 141
78 3300005406 Ga0070703_10296350 Ga0070703_102963501 141
79 3300005435 Ga0070714_100011586 Ga0070714_1000115864 141
80 3300005435 Ga0070714_100573750 Ga0070714_1005737501 141
81 3300005435 Ga0070714_100642932 Ga0070714_1006429321 141
82 3300005436 Ga0070713_100224072 Ga0070713_1002240722 141
83 3300005440 Ga0070705_100391413 Ga0070705_1003914132 141
84 3300005445 Ga0070708_100385452 Ga0070708_1003854522 141
85 3300005467 Ga0070706_100074346 Ga0070706_1000743461 141
86 3300005468 Ga0070707_100785135 Ga0070707_1007851352 141
87 3300005468 Ga0070707_101009222 Ga0070707_1010092222 141
88 3300005471 Ga0070698_100006357 Ga0070698_10000635712 141
89 3300005518 Ga0070699_100039229 Ga0070699_1000392297 141
90 3300005518 Ga0070699_100402056 Ga0070699_1004020563 141
91 3300005530 Ga0070679_100118973 Ga0070679_1001189734 141
92 3300005536 Ga0070697_101232048 Ga0070697_1012320481 141
93 3300005548 Ga0070665_100312721 Ga0070665_1003127213 141
94 3300005564 Ga0070664_100750291 Ga0070664_1007502911 141
95 3300005577 Ga0068857_100937112 Ga0068857_1009371122 141
96 3300005614 Ga0068856_100445478 Ga0068856_1004454781 141
97 3300005618 Ga0068864_101587790 Ga0068864_1015877902 141
98 3300006028 Ga0070717_11143668 Ga0070717_111436681 141
99 3300006163 Ga0070715_10004114 Ga0070715_100041145 141
100 3300006173 Ga0070716_100081549 Ga0070716_1000815493 141
101 3300006358 Ga0068871_100133473 Ga0068871_1001334731 141
102 3300006871 Ga0075434_100146391 Ga0075434_1001463912 141
103 3300006914 Ga0075436_100252256 Ga0075436_1002522562 141
104 3300007076 Ga0075435_100286519 Ga0075435_1002865192 141
105 3300009093 Ga0105240_10348767 Ga0105240_103487672 141
106 3300009177 Ga0105248_10797356 Ga0105248_107973561 141
107 3300013104 Ga0157370_10268413 Ga0157370_102684132 141
108 3300013105 Ga0157369_11747414 Ga0157369_117474141 141
109 3300013307 Ga0157372_10393051 Ga0157372_103930512 141
110 3300013307 Ga0157372_11226822 Ga0157372_112268222 141
111 3300014968 Ga0157379_11971263 Ga0157379_119712631 141
112 3300014969 Ga0157376_11360918 Ga0157376_113609182 141
113 3300020082 Ga0206353_11391335 Ga0206353_113913355 141
114 3300021388 Ga0213875_10000312 Ga0213875_1000031218 141
115 3300022467 Ga0224712_10521254 Ga0224712_105212542 141
116 3300025885 Ga0207653_10373377 Ga0207653_103733771 141
117 3300025898 Ga0207692_10001693 Ga0207692_100016935 141
118 3300025898 Ga0207692_10040840 Ga0207692_100408403 141
119 3300025905 Ga0207685_10000213 Ga0207685_100002137 141
120 3300025906 Ga0207699_10004260 Ga0207699_100042605 141
121 3300025910 Ga0207684_10064256 Ga0207684_100642561 141
122 3300025912 Ga0207707_10465904 Ga0207707_104659042 141
123 3300025916 Ga0207663_10001922 Ga0207663_100019228 141
124 3300025917 Ga0207660_10423097 Ga0207660_104230971 141
125 3300025919 Ga0207657_10058280 Ga0207657_100582806 141
126 3300025922 Ga0207646_10646855 Ga0207646_106468551 141
127 3300025928 Ga0207700_10007608 Ga0207700_100076083 141
128 3300025928 Ga0207700_10230825 Ga0207700_102308252 141
129 3300025929 Ga0207664_10039123 Ga0207664_100391234 141
130 3300025929 Ga0207664_10112691 Ga0207664_101126914 141
131 3300025931 Ga0207644_10966538 Ga0207644_109665381 141
132 3300025932 Ga0207690_10275050 Ga0207690_102750502 141
133 3300025939 Ga0207665_10441729 Ga0207665_104417291 141
134 3300025944 Ga0207661_10090467 Ga0207661_100904672 141
135 3300026067 Ga0207678_10100422 Ga0207678_101004224 141
136 3300026067 Ga0207678_10397255 Ga0207678_103972552 141
137 3300026078 Ga0207702_10241806 Ga0207702_102418063 141
138 3300026078 Ga0207702_12425335 Ga0207702_124253351 141
139 3300026095 Ga0207676_11560025 Ga0207676_115600251 141
140 3300026116 Ga0207674_10097284 Ga0207674_100972844 141
141 3300026142 Ga0207698_10621326 Ga0207698_106213262 141
142 3300028379 Ga0268266_10084515 Ga0268266_100845153 141
143 3300034817 Ga0373948_0031650 Ga0373948_0031650_280_729 141
144 3300034957 Ga0373938_0203447 Ga0373938_0203447_51_500 141
145 3300035088 Ga0373940_0069726 Ga0373940_0069726_115_564 141
146 3300035090 Ga0373949_0016761 Ga0373949_0016761_828_1277 141
147 3300035091 Ga0373951_0010086 Ga0373951_0010086_216_665 141
148 3300035092 Ga0373952_0102240 Ga0373952_0102240_130_579 141
149 3300035113 Ga0373936_0246688 Ga0373936_0246688_21_470 141
150 3300035115 Ga0373941_0006980 Ga0373941_0006980_1026_1475 141
151 3300035121 Ga0373960_0115475 Ga0373960_0115475_241_690 141
152 3300035241 Ga0373961_0160668 Ga0373961_0160668_107_556 141
153 3300035242 Ga0373962_0009476 Ga0373962_0009476_543_992 141
154 3300035691 Ga0373931_0007289 Ga0373931_0007289_3277_3726 141
155 3300035692 Ga0373935_0042315 Ga0373935_0042315_296_745 141
156 3300037068 Ga0373925_0020188 Ga0373925_0020188_2469_2918 141
157 3300037466 Ga0395898_0128858 Ga0395898_0128858_856_1290 141
158 3300037466 Ga0395898_0771912 Ga0395898_0771912_38_472 141
159 3300037853 Ga0436364_1101267 Ga0436364_1101267_51051_51512 141
160 3300044694 Ga0466963_0051020 Ga0466963_0051020_1327_1761 141
161 3300045836 Ga0466958_0236814 Ga0466958_0236814_536_970 141
162 3300045976 Ga0466967_0093023 Ga0466967_0093023_1683_2117 141
163 3300046454 Ga0495592_0328586 Ga0495592_0328586_170_619 141
164 3300046455 Ga0495603_0015082 Ga0495603_0015082_1033_1482 141
165 3300046459 Ga0495629_0003864 Ga0495629_0003864_5076_5525 141
166 3300046461 Ga0495641_0004654 Ga0495641_0004654_4912_5361 141
167 3300046462 Ga0495651_0099790 Ga0495651_0099790_299_748 141
168 3300046463 Ga0495653_0004643 Ga0495653_0004643_6069_6518 141
169 3300046472 Ga0495580_0009989 Ga0495580_0009989_5275_5724 141
170 3300046473 Ga0495582_0003757 Ga0495582_0003757_3954_4403 141
171 3300046475 Ga0495639_0023727 Ga0495639_0023727_572_1021 141
172 3300046476 Ga0495662_0015519 Ga0495662_0015519_1471_1920 141
173 3300046499 Ga0495594_0058118 Ga0495594_0058118_1610_2059 141
174 3300046511 Ga0495608_0030352 Ga0495608_0030352_1439_1888 141
175 3300046516 Ga0495628_0073798 Ga0495628_0073798_756_1205 141
176 3300046517 Ga0495630_0017241 Ga0495630_0017241_3463_3912 141
177 3300046531 Ga0495665_0009220 Ga0495665_0009220_491_940 141
178 3300046533 Ga0495640_0009138 Ga0495640_0009138_4132_4581 141
179 3300046559 Ga0495667_0014908 Ga0495667_0014908_2123_2572 141
180 3300046642 Ga0495634_0007391 Ga0495634_0007391_3951_4400 141
181 3300046663 Ga0495635_0007332 Ga0495635_0007332_3545_3994 141
182 3300046674 Ga0495588_0354385 Ga0495588_0354385_249_698 141
183 3300046678 Ga0495599_0364063 Ga0495599_0364063_73_522 141
184 3300046680 Ga0495646_0040386 Ga0495646_0040386_1553_2002 141
185 3300046681 Ga0495647_0060509 Ga0495647_0060509_684_1133 141
186 3300046683 Ga0495658_0005016 Ga0495658_0005016_2926_3375 141
187 3300046689 Ga0495613_0010040 Ga0495613_0010040_2297_2746 141
188 3300046690 Ga0495624_0096475 Ga0495624_0096475_13_462 141
189 3300046809 Ga0495600_0069165 Ga0495600_0069165_397_846 141
190 3300047315 Ga0495581_0005608 Ga0495581_0005608_2866_3315 141
191 3300047319 Ga0495674_0017960 Ga0495674_0017960_4447_4896 141
192 3300047321 Ga0495676_0123102 Ga0495676_0123102_177_626 141
193 3300047322 Ga0495680_0012869 Ga0495680_0012869_2713_3162 141
194 3300047471 Ga0495684_0002498 Ga0495684_0002498_12420_12869 141
195 3300047673 Ga0495593_0003416 Ga0495593_0003416_4288_4737 141
196 3300048089 Ga0495614_0022156 Ga0495614_0022156_922_1371 141
197 3300048903 Ga0496100_0348139 Ga0496100_0348139_326_775 141
198 3300048904 Ga0496101_0020360 Ga0496101_0020360_3968_4417 141
199 3300048906 Ga0496103_0189036 Ga0496103_0189036_687_1136 141
200 3300048907 Ga0496104_0033323 Ga0496104_0033323_2057_2506 141
201 3300048908 Ga0496105_0003676 Ga0496105_0003676_6245_6694 141
202 3300048909 Ga0496106_0017660 Ga0496106_0017660_701_1150 141
203 3300048910 Ga0496107_0045925 Ga0496107_0045925_426_875 141
204 3300048911 Ga0496108_0009624 Ga0496108_0009624_1341_1790 141
205 3300048912 Ga0496109_0059843 Ga0496109_0059843_1707_2156 141
206 3300048913 Ga0496110_0023186 Ga0496110_0023186_4065_4514 141
207 3300048914 Ga0496111_0090092 Ga0496111_0090092_1332_1781 141
208 3300048915 Ga0496112_0018059 Ga0496112_0018059_5892_6341 141
209 3300048915 Ga0496112_0383225 Ga0496112_0383225_656_1090 141
210 3300048916 Ga0496113_0043910 Ga0496113_0043910_2213_2662 141
211 3300048917 Ga0496114_0008516 Ga0496114_0008516_2692_3141 141
212 3300048918 Ga0496115_0011257 Ga0496115_0011257_4198_4647 141
213 3300048929 Ga0496126_0009157 Ga0496126_0009157_7653_8141 141
214 3300050507 nmdc:mga05p37_2166644_c1 nmdc:mga05p37_2166644_c1_41_481 141
215 3300050512 nmdc:mga0n895_31385_c1 nmdc:mga0n895_31385_c1_1642_2082 141
216 3300050513 nmdc:mga0rr50_216559_c1 nmdc:mga0rr50_216559_c1_864_1304 141
217 3300050513 nmdc:mga0rr50_23633_c1 nmdc:mga0rr50_23633_c1_1630_2079 141
218 3300050514 nmdc:mga08x19_120296_c1 nmdc:mga08x19_120296_c1_317_757 141
219 3300050515 nmdc:mga0a205_225589_c1 nmdc:mga0a205_225589_c1_296_745 141
220 3300053084 Ga0495595_0387754 Ga0495595_0387754_71_520 141
221 3300053085 Ga0495619_0060984 Ga0495619_0060984_1604_2053 141
222 3300059640 Ga0587067_008625 Ga0587067_008625_995_1429 141
223 3300005354 Ga0070675_101891405 Ga0070675_1018914051 142
224 3300005435 Ga0070714_100182401 Ga0070714_1001824012 142
225 3300005436 Ga0070713_100090641 Ga0070713_1000906412 142
226 3300005439 Ga0070711_100057214 Ga0070711_1000572143 142
227 3300005983 Ga0081540_1048040 Ga0081540_10480403 142
228 3300006028 Ga0070717_11092002 Ga0070717_110920022 142
229 3300006173 Ga0070716_100953421 Ga0070716_1009534211 142
230 3300006844 Ga0075428_100212893 Ga0075428_1002128932 142
231 3300006847 Ga0075431_100626913 Ga0075431_1006269131 142
232 3300006852 Ga0075433_10128788 Ga0075433_101287882 142
233 3300006871 Ga0075434_100810258 Ga0075434_1008102582 142
234 3300006914 Ga0075436_100550978 Ga0075436_1005509782 142
235 3300007076 Ga0075435_100365353 Ga0075435_1003653532 142
236 3300007076 Ga0075435_101482424 Ga0075435_1014824241 142
237 3300009094 Ga0111539_11089217 Ga0111539_110892171 142
238 3300009147 Ga0114129_10018632 Ga0114129_1001863210 142
239 3300013306 Ga0163162_11744644 Ga0163162_117446441 142
240 3300025916 Ga0207663_10281209 Ga0207663_102812092 142
241 3300025928 Ga0207700_10053874 Ga0207700_100538741 142
242 3300025929 Ga0207664_10392896 Ga0207664_103928962 142
243 3300025939 Ga0207665_10824288 Ga0207665_108242881 142
244 3300027907 Ga0207428_10674306 Ga0207428_106743061 142
245 3300035086 Ga0373934_0092380 Ga0373934_0092380_604_1059 142
246 3300035088 Ga0373940_0073419 Ga0373940_0073419_367_819 142
247 3300035111 Ga0373923_0004236 Ga0373923_0004236_487_942 142
248 3300035111 Ga0373923_0056622 Ga0373923_0056622_409_861 142
249 3300035111 Ga0373923_0316615 Ga0373923_0316615_130_585 142
250 3300035111 Ga0373923_0564858 Ga0373923_0564858_19_474 142
251 3300035113 Ga0373936_0004218 Ga0373936_0004218_2388_2843 142
252 3300035113 Ga0373936_0110775 Ga0373936_0110775_552_1004 142
253 3300035117 Ga0373953_0000923 Ga0373953_0000923_1123_1575 142
254 3300035117 Ga0373953_0133458 Ga0373953_0133458_443_898 142
255 3300035117 Ga0373953_0167413 Ga0373953_0167413_248_700 142
256 3300035117 Ga0373953_0355166 Ga0373953_0355166_160_615 142
257 3300035118 Ga0373954_0011646 Ga0373954_0011646_510_962 142
258 3300035118 Ga0373954_0019992 Ga0373954_0019992_940_1395 142
259 3300035119 Ga0373956_0002523 Ga0373956_0002523_469_921 142
260 3300035119 Ga0373956_0056883 Ga0373956_0056883_162_617 142
261 3300035119 Ga0373956_0160706 Ga0373956_0160706_160_615 142
262 3300035120 Ga0373957_0000702 Ga0373957_0000702_1681_2133 142
263 3300035120 Ga0373957_0000994 Ga0373957_0000994_4405_4860 142
264 3300035120 Ga0373957_0048228 Ga0373957_0048228_1142_1597 142
265 3300035171 Ga0373946_0162184 Ga0373946_0162184_447_899 142
266 3300035172 Ga0373955_0000515 Ga0373955_0000515_9537_9989 142
267 3300035172 Ga0373955_0022057 Ga0373955_0022057_1865_2317 142
268 3300035172 Ga0373955_0262269 Ga0373955_0262269_160_615 142
269 3300035410 Ga0373924_0000549 Ga0373924_0000549_681_1133 142
270 3300035410 Ga0373924_0044440 Ga0373924_0044440_1053_1508 142
271 3300035410 Ga0373924_0099290 Ga0373924_0099290_463_915 142
272 3300035692 Ga0373935_0102985 Ga0373935_0102985_424_879 142
273 3300035692 Ga0373935_0227928 Ga0373935_0227928_788_1243 142
274 3300035724 Ga0373933_0000507 Ga0373933_0000507_6554_7006 142
275 3300035724 Ga0373933_0023500 Ga0373933_0023500_1051_1503 142
276 3300035724 Ga0373933_0042757 Ga0373933_0042757_595_1050 142
277 3300035724 Ga0373933_0354340 Ga0373933_0354340_365_820 142
278 3300035725 Ga0373947_0580152 Ga0373947_0580152_117_569 142
279 3300036242 Ga0310104_02245 Ga0310104_02245_21_461 142
280 3300036401 Ga0373937_0001460 Ga0373937_0001460_12764_13216 142
281 3300036401 Ga0373937_0164171 Ga0373937_0164171_162_617 142
282 3300036401 Ga0373937_0211646 Ga0373937_0211646_168_620 142
283 3300036401 Ga0373937_0241320 Ga0373937_0241320_1088_1543 142
284 3300036457 Ga0265778_061930 Ga0265778_061930_64_504 142
285 3300037068 Ga0373925_0227508 Ga0373925_0227508_95_547 142
286 3300046454 Ga0495592_0002671 Ga0495592_0002671_5583_6035 142
287 3300046454 Ga0495592_0004469 Ga0495592_0004469_2573_3025 142
288 3300046454 Ga0495592_0111874 Ga0495592_0111874_161_616 142
289 3300046459 Ga0495629_0001557 Ga0495629_0001557_17125_17580 142
290 3300046459 Ga0495629_0095977 Ga0495629_0095977_1391_1843 142
291 3300046462 Ga0495651_0000798 Ga0495651_0000798_17494_17946 142
292 3300046462 Ga0495651_0002496 Ga0495651_0002496_2573_3025 142
293 3300046462 Ga0495651_0027504 Ga0495651_0027504_2094_2549 142
294 3300046463 Ga0495653_0003377 Ga0495653_0003377_10496_10948 142
295 3300046463 Ga0495653_0008354 Ga0495653_0008354_5708_6160 142
296 3300046463 Ga0495653_0039019 Ga0495653_0039019_1629_2084 142
297 3300046473 Ga0495582_0008905 Ga0495582_0008905_4010_4465 142
298 3300046476 Ga0495662_0038680 Ga0495662_0038680_1315_1767 142
299 3300046476 Ga0495662_0187277 Ga0495662_0187277_157_612 142
300 3300046477 Ga0495664_0059757 Ga0495664_0059757_987_1439 142
301 3300046477 Ga0495664_0110325 Ga0495664_0110325_762_1217 142
302 3300046511 Ga0495608_0000630 Ga0495608_0000630_17314_17766 142
303 3300046511 Ga0495608_0071331 Ga0495608_0071331_625_1077 142
304 3300046514 Ga0495618_0006927 Ga0495618_0006927_4981_5436 142
305 3300046514 Ga0495618_0069043 Ga0495618_0069043_23_475 142
306 3300046516 Ga0495628_0001397 Ga0495628_0001397_4205_4657 142
307 3300046516 Ga0495628_0007939 Ga0495628_0007939_6241_6693 142
308 3300046516 Ga0495628_0080452 Ga0495628_0080452_449_904 142
309 3300046517 Ga0495630_0015723 Ga0495630_0015723_2355_2807 142
310 3300046517 Ga0495630_0082836 Ga0495630_0082836_790_1245 142
311 3300046517 Ga0495630_1333270 Ga0495630_1333270_60_515 142
312 3300046526 Ga0495666_0404550 Ga0495666_0404550_37_489 142
313 3300046529 Ga0495652_0003271 Ga0495652_0003271_9128_9580 142
314 3300046529 Ga0495652_0003576 Ga0495652_0003576_7005_7457 142
315 3300046529 Ga0495652_0702169 Ga0495652_0702169_65_520 142
316 3300046531 Ga0495665_0007582 Ga0495665_0007582_270_725 142
317 3300046531 Ga0495665_0424489 Ga0495665_0424489_93_545 142
318 3300046533 Ga0495640_0007314 Ga0495640_0007314_585_1040 142
319 3300046533 Ga0495640_0009834 Ga0495640_0009834_1729_2181 142
320 3300046535 Ga0495586_0034210 Ga0495586_0034210_1385_1837 142
321 3300046536 Ga0495587_0000605 Ga0495587_0000605_17447_17899 142
322 3300046536 Ga0495587_0017195 Ga0495587_0017195_540_992 142
323 3300046536 Ga0495587_0019208 Ga0495587_0019208_2828_3283 142
324 3300046543 Ga0495645_0001541 Ga0495645_0001541_5779_6231 142
325 3300046543 Ga0495645_0275153 Ga0495645_0275153_493_948 142
326 3300046559 Ga0495667_0000537 Ga0495667_0000537_6475_6927 142
327 3300046559 Ga0495667_0001852 Ga0495667_0001852_2373_2825 142
328 3300046559 Ga0495667_0030746 Ga0495667_0030746_1559_2014 142
329 3300046642 Ga0495634_0253555 Ga0495634_0253555_601_1053 142
330 3300046642 Ga0495634_0575132 Ga0495634_0575132_128_583 142
331 3300046663 Ga0495635_0010898 Ga0495635_0010898_416_868 142
332 3300046663 Ga0495635_0043166 Ga0495635_0043166_776_1231 142
333 3300046663 Ga0495635_0477239 Ga0495635_0477239_219_674 142
334 3300046675 Ga0495657_0001623 Ga0495657_0001623_12284_12736 142
335 3300046675 Ga0495657_0019891 Ga0495657_0019891_3187_3639 142
336 3300046675 Ga0495657_0025659 Ga0495657_0025659_2162_2617 142
337 3300046678 Ga0495599_0000408 Ga0495599_0000408_17569_18021 142
338 3300046678 Ga0495599_0000918 Ga0495599_0000918_9811_10263 142
339 3300046678 Ga0495599_0068859 Ga0495599_0068859_1593_2048 142
340 3300046678 Ga0495599_0270759 Ga0495599_0270759_416_871 142
341 3300046679 Ga0495623_0003230 Ga0495623_0003230_3774_4226 142
342 3300046679 Ga0495623_0021765 Ga0495623_0021765_740_1192 142
343 3300046679 Ga0495623_0044612 Ga0495623_0044612_443_898 142
344 3300046679 Ga0495623_0220595 Ga0495623_0220595_182_637 142
345 3300046680 Ga0495646_0011988 Ga0495646_0011988_77_532 142
346 3300046680 Ga0495646_0013443 Ga0495646_0013443_1904_2356 142
347 3300046680 Ga0495646_0019395 Ga0495646_0019395_2336_2788 142
348 3300046683 Ga0495658_0019344 Ga0495658_0019344_2667_3122 142
349 3300046689 Ga0495613_0040724 Ga0495613_0040724_1563_2018 142
350 3300046689 Ga0495613_0303649 Ga0495613_0303649_301_753 142
351 3300046809 Ga0495600_0012611 Ga0495600_0012611_741_1193 142
352 3300046809 Ga0495600_0096300 Ga0495600_0096300_307_759 142
353 3300046809 Ga0495600_0126883 Ga0495600_0126883_443_898 142
354 3300047315 Ga0495581_0007642 Ga0495581_0007642_69_524 142
355 3300047315 Ga0495581_0065108 Ga0495581_0065108_1552_2004 142
356 3300047317 Ga0495604_0001543 Ga0495604_0001543_1020_1472 142
357 3300047317 Ga0495604_0004407 Ga0495604_0004407_9510_9962 142
358 3300047317 Ga0495604_0049504 Ga0495604_0049504_162_617 142
359 3300047317 Ga0495604_0309630 Ga0495604_0309630_160_615 142
360 3300047319 Ga0495674_0011185 Ga0495674_0011185_5649_6101 142
361 3300047319 Ga0495674_0100855 Ga0495674_0100855_443_898 142
362 3300047319 Ga0495674_0156110 Ga0495674_0156110_1304_1759 142
363 3300047319 Ga0495674_1301116 Ga0495674_1301116_56_511 142
364 3300047321 Ga0495676_0830946 Ga0495676_0830946_55_510 142
365 3300047322 Ga0495680_0003448 Ga0495680_0003448_6569_7021 142
366 3300047322 Ga0495680_0009581 Ga0495680_0009581_2354_2806 142
367 3300047322 Ga0495680_0031915 Ga0495680_0031915_2162_2617 142
368 3300047444 Ga0495675_0006489 Ga0495675_0006489_1187_1639 142
369 3300047444 Ga0495675_0027380 Ga0495675_0027380_1213_1668 142
370 3300047444 Ga0495675_0064506 Ga0495675_0064506_1737_2189 142
371 3300047471 Ga0495684_0003448 Ga0495684_0003448_7204_7656 142
372 3300047471 Ga0495684_0037269 Ga0495684_0037269_2094_2549 142
373 3300047471 Ga0495684_0499929 Ga0495684_0499929_357_809 142
374 3300047471 Ga0495684_0532602 Ga0495684_0532602_112_567 142
375 3300047673 Ga0495593_0037411 Ga0495593_0037411_1756_2211 142
376 3300048088 Ga0495602_0001263 Ga0495602_0001263_17899_18351 142
377 3300048088 Ga0495602_0021230 Ga0495602_0021230_683_1135 142
378 3300048088 Ga0495602_0123138 Ga0495602_0123138_162_617 142
379 3300048088 Ga0495602_0359072 Ga0495602_0359072_435_890 142
380 3300048089 Ga0495614_0054616 Ga0495614_0054616_1112_1567 142
381 3300049576 Ga0501040_1049803 Ga0501040_1049803_97_549 142
382 3300050507 nmdc:mga05p37_22004_c1 nmdc:mga05p37_22004_c1_5019_5471 142
383 3300050510 nmdc:mga06r32_500290_c1 nmdc:mga06r32_500290_c1_168_620 142
384 3300050512 nmdc:mga0n895_384159_c1 nmdc:mga0n895_384159_c1_893_1345 142
385 3300050512 nmdc:mga0n895_91844_c1 nmdc:mga0n895_91844_c1_1694_2146 142
386 3300050513 nmdc:mga0rr50_46566_c1 nmdc:mga0rr50_46566_c1_2206_2658 142
387 3300050514 nmdc:mga08x19_82232_c1 nmdc:mga08x19_82232_c1_1407_1859 142
388 3300050515 nmdc:mga0a205_12757_c1 nmdc:mga0a205_12757_c1_2854_3306 142
389 3300053077 Ga0495601_0001455 Ga0495601_0001455_1991_2443 142
390 3300053084 Ga0495595_0000843 Ga0495595_0000843_8622_9074 142
391 3300053084 Ga0495595_0007342 Ga0495595_0007342_905_1357 142
392 3300053084 Ga0495595_0043393 Ga0495595_0043393_271_726 142
393 3300053085 Ga0495619_0080308 Ga0495619_0080308_1052_1504 142
394 3300003659 JGI25404J52841_10001092 JGI25404J52841_100010925 143
395 3300004800 Ga0058861_12043780 Ga0058861_120437801 143
396 3300004803 Ga0058862_12706110 Ga0058862_127061101 143
397 3300005329 Ga0070683_100075781 Ga0070683_1000757812 143
398 3300005329 Ga0070683_100382345 Ga0070683_1003823451 143
399 3300005329 Ga0070683_100852711 Ga0070683_1008527111 143
400 3300005331 Ga0070670_101404312 Ga0070670_1014043121 143
401 3300005334 Ga0068869_100139532 Ga0068869_1001395322 143
402 3300005334 Ga0068869_101515775 Ga0068869_1015157751 143
403 3300005336 Ga0070680_101431036 Ga0070680_1014310361 143
404 3300005337 Ga0070682_100315416 Ga0070682_1003154161 143
405 3300005337 Ga0070682_100933297 Ga0070682_1009332971 143
406 3300005338 Ga0068868_100202235 Ga0068868_1002022352 143
407 3300005338 Ga0068868_101493115 Ga0068868_1014931151 143
408 3300005341 Ga0070691_10698919 Ga0070691_106989191 143
409 3300005344 Ga0070661_100392002 Ga0070661_1003920022 143
410 3300005354 Ga0070675_100510808 Ga0070675_1005108082 143
411 3300005356 Ga0070674_100222825 Ga0070674_1002228252 143
412 3300005364 Ga0070673_101313412 Ga0070673_1013134122 143
413 3300005364 Ga0070673_101589695 Ga0070673_1015896951 143
414 3300005434 Ga0070709_10082338 Ga0070709_100823382 143
415 3300005435 Ga0070714_100024414 Ga0070714_1000244143 143
416 3300005435 Ga0070714_100722612 Ga0070714_1007226122 143
417 3300005435 Ga0070714_101044783 Ga0070714_1010447832 143
418 3300005435 Ga0070714_101062692 Ga0070714_1010626922 143
419 3300005435 Ga0070714_101419944 Ga0070714_1014199441 143
420 3300005436 Ga0070713_100043664 Ga0070713_1000436642 143
421 3300005436 Ga0070713_100120023 Ga0070713_1001200233 143
422 3300005436 Ga0070713_100244642 Ga0070713_1002446422 143
423 3300005436 Ga0070713_100560609 Ga0070713_1005606092 143
424 3300005436 Ga0070713_100776176 Ga0070713_1007761761 143
425 3300005437 Ga0070710_10144798 Ga0070710_101447982 143
426 3300005437 Ga0070710_10395102 Ga0070710_103951022 143
427 3300005437 Ga0070710_10894657 Ga0070710_108946571 143
428 3300005439 Ga0070711_100078518 Ga0070711_1000785182 143
429 3300005440 Ga0070705_101335415 Ga0070705_1013354151 143
430 3300005445 Ga0070708_100047647 Ga0070708_1000476473 143
431 3300005445 Ga0070708_100441042 Ga0070708_1004410422 143
432 3300005455 Ga0070663_100417308 Ga0070663_1004173081 143
433 3300005456 Ga0070678_100245676 Ga0070678_1002456762 143
434 3300005456 Ga0070678_101165527 Ga0070678_1011655272 143
435 3300005456 Ga0070678_101446089 Ga0070678_1014460891 143
436 3300005457 Ga0070662_100767977 Ga0070662_1007679772 143
437 3300005458 Ga0070681_10581936 Ga0070681_105819361 143
438 3300005458 Ga0070681_11224918 Ga0070681_112249181 143
439 3300005458 Ga0070681_11417585 Ga0070681_114175851 143
440 3300005467 Ga0070706_100093017 Ga0070706_1000930172 143
441 3300005467 Ga0070706_100312463 Ga0070706_1003124632 143
442 3300005467 Ga0070706_100490871 Ga0070706_1004908712 143
443 3300005467 Ga0070706_100555779 Ga0070706_1005557791 143
444 3300005468 Ga0070707_100003731 Ga0070707_1000037314 143
445 3300005468 Ga0070707_100086187 Ga0070707_1000861876 143
446 3300005468 Ga0070707_100226629 Ga0070707_1002266293 143
447 3300005468 Ga0070707_100679550 Ga0070707_1006795501 143
448 3300005468 Ga0070707_100747280 Ga0070707_1007472801 143
449 3300005468 Ga0070707_100886432 Ga0070707_1008864321 143
450 3300005471 Ga0070698_100003676 Ga0070698_10000367615 143
451 3300005471 Ga0070698_100008957 Ga0070698_1000089575 143
452 3300005471 Ga0070698_100011232 Ga0070698_1000112327 143
453 3300005471 Ga0070698_100150799 Ga0070698_1001507995 143
454 3300005471 Ga0070698_100858794 Ga0070698_1008587943 143
455 3300005518 Ga0070699_100000405 Ga0070699_10000040529 143
456 3300005518 Ga0070699_100132548 Ga0070699_1001325481 143
457 3300005530 Ga0070679_100221190 Ga0070679_1002211902 143
458 3300005535 Ga0070684_100261088 Ga0070684_1002610881 143
459 3300005535 Ga0070684_100340859 Ga0070684_1003408592 143
460 3300005535 Ga0070684_100932886 Ga0070684_1009328861 143
461 3300005535 Ga0070684_101253660 Ga0070684_1012536602 143
462 3300005536 Ga0070697_100029395 Ga0070697_1000293951 143
463 3300005539 Ga0068853_100061302 Ga0068853_1000613025 143
464 3300005544 Ga0070686_101162384 Ga0070686_1011623841 143
465 3300005546 Ga0070696_100590070 Ga0070696_1005900701 143
466 3300005547 Ga0070693_100348754 Ga0070693_1003487541 143
467 3300005548 Ga0070665_100307596 Ga0070665_1003075962 143
468 3300005548 Ga0070665_101417992 Ga0070665_1014179921 143
469 3300005549 Ga0070704_100362466 Ga0070704_1003624662 143
470 3300005563 Ga0068855_100579982 Ga0068855_1005799822 143
471 3300005563 Ga0068855_101510327 Ga0068855_1015103272 143
472 3300005577 Ga0068857_100092718 Ga0068857_1000927182 143
473 3300005577 Ga0068857_100150823 Ga0068857_1001508234 143
474 3300005578 Ga0068854_100447867 Ga0068854_1004478672 143
475 3300005614 Ga0068856_101258839 Ga0068856_1012588391 143
476 3300005614 Ga0068856_101361486 Ga0068856_1013614862 143
477 3300005615 Ga0070702_101078372 Ga0070702_1010783721 143
478 3300005617 Ga0068859_100422296 Ga0068859_1004222962 143
479 3300005617 Ga0068859_101257195 Ga0068859_1012571952 143
480 3300005618 Ga0068864_102202494 Ga0068864_1022024941 143
481 3300005719 Ga0068861_101318383 Ga0068861_1013183832 143
482 3300005834 Ga0068851_10091240 Ga0068851_100912402 143
483 3300005841 Ga0068863_100306613 Ga0068863_1003066132 143
484 3300005841 Ga0068863_101916837 Ga0068863_1019168372 143
485 3300005842 Ga0068858_100185422 Ga0068858_1001854222 143
486 3300005843 Ga0068860_100707286 Ga0068860_1007072862 143
487 3300005843 Ga0068860_101471931 Ga0068860_1014719311 143
488 3300005843 Ga0068860_101556756 Ga0068860_1015567561 143
489 3300005983 Ga0081540_1001743 Ga0081540_100174311 143
490 3300006028 Ga0070717_10035084 Ga0070717_100350843 143
491 3300006028 Ga0070717_10065911 Ga0070717_100659114 143
492 3300006028 Ga0070717_10185487 Ga0070717_101854875 143
493 3300006028 Ga0070717_10783239 Ga0070717_107832392 143
494 3300006163 Ga0070715_10690291 Ga0070715_106902911 143
495 3300006173 Ga0070716_100107312 Ga0070716_1001073122 143
496 3300006173 Ga0070716_100815927 Ga0070716_1008159272 143
497 3300006175 Ga0070712_100036052 Ga0070712_1000360521 143
498 3300006175 Ga0070712_100132094 Ga0070712_1001320944 143
499 3300006175 Ga0070712_100207072 Ga0070712_1002070722 143
500 3300006175 Ga0070712_100281608 Ga0070712_1002816082 143
501 3300006175 Ga0070712_100322043 Ga0070712_1003220431 143
502 3300006175 Ga0070712_101617694 Ga0070712_1016176941 143
503 3300006237 Ga0097621_100363651 Ga0097621_1003636512 143
504 3300006358 Ga0068871_101710712 Ga0068871_1017107122 143
505 3300006852 Ga0075433_11422670 Ga0075433_114226701 143
506 3300006871 Ga0075434_100515993 Ga0075434_1005159931 143
507 3300006881 Ga0068865_100028789 Ga0068865_1000287892 143
508 3300006931 Ga0097620_100422283 Ga0097620_1004222832 143
509 3300006931 Ga0097620_101257251 Ga0097620_1012572512 143
510 3300007076 Ga0075435_101852209 Ga0075435_1018522091 143
511 3300009092 Ga0105250_10077867 Ga0105250_100778672 143
512 3300009093 Ga0105240_10398695 Ga0105240_103986952 143
513 3300009093 Ga0105240_10972950 Ga0105240_109729501 143
514 3300009094 Ga0111539_13510366 Ga0111539_135103661 143
515 3300009098 Ga0105245_10973672 Ga0105245_109736721 143
516 3300009098 Ga0105245_11152039 Ga0105245_111520392 143
517 3300009101 Ga0105247_10430328 Ga0105247_104303281 143
518 3300009101 Ga0105247_10700423 Ga0105247_107004231 143
519 3300009148 Ga0105243_10071648 Ga0105243_100716483 143
520 3300009174 Ga0105241_10176838 Ga0105241_101768382 143
521 3300009174 Ga0105241_10830963 Ga0105241_108309631 143
522 3300009176 Ga0105242_10819844 Ga0105242_108198441 143
523 3300009545 Ga0105237_10917324 Ga0105237_109173241 143
524 3300009551 Ga0105238_10149293 Ga0105238_101492931 143
525 3300009551 Ga0105238_11304333 Ga0105238_113043331 143
526 3300009551 Ga0105238_11304335 Ga0105238_113043351 143
527 3300009553 Ga0105249_10249872 Ga0105249_102498721 143
528 3300009553 Ga0105249_11967813 Ga0105249_119678131 143
529 3300010159 Ga0099796_10080203 Ga0099796_100802032 143
530 3300011119 Ga0105246_10011576 Ga0105246_100115765 143
531 3300011119 Ga0105246_10523851 Ga0105246_105238512 143
532 3300012507 Ga0157342_1009931 Ga0157342_10099312 143
533 3300013100 Ga0157373_10092891 Ga0157373_100928912 143
534 3300013102 Ga0157371_10181709 Ga0157371_101817092 143
535 3300013104 Ga0157370_10122936 Ga0157370_101229363 143
536 3300013104 Ga0157370_11142876 Ga0157370_111428761 143
537 3300013105 Ga0157369_10659842 Ga0157369_106598421 143
538 3300013105 Ga0157369_10668021 Ga0157369_106680212 143
539 3300013105 Ga0157369_11136163 Ga0157369_111361631 143
540 3300013105 Ga0157369_11204219 Ga0157369_112042191 143
541 3300013296 Ga0157374_10448039 Ga0157374_104480392 143
542 3300013296 Ga0157374_10872999 Ga0157374_108729992 143
543 3300013297 Ga0157378_10318606 Ga0157378_103186062 143
544 3300013306 Ga0163162_10616706 Ga0163162_106167061 143
545 3300013306 Ga0163162_11470083 Ga0163162_114700831 143
546 3300013307 Ga0157372_10635203 Ga0157372_106352032 143
547 3300013307 Ga0157372_12353686 Ga0157372_123536862 143
548 3300013308 Ga0157375_12038382 Ga0157375_120383821 143
549 3300013308 Ga0157375_12065253 Ga0157375_120652531 143
550 3300014325 Ga0163163_10361023 Ga0163163_103610232 143
551 3300014745 Ga0157377_10644064 Ga0157377_106440641 143
552 3300014968 Ga0157379_10591307 Ga0157379_105913072 143
553 3300014968 Ga0157379_10728805 Ga0157379_107288052 143
554 3300020069 Ga0197907_10032160 Ga0197907_100321602 143
555 3300020069 Ga0197907_10861133 Ga0197907_108611332 143
556 3300020069 Ga0197907_10924303 Ga0197907_109243033 143
557 3300020070 Ga0206356_10039166 Ga0206356_100391661 143
558 3300020070 Ga0206356_11395269 Ga0206356_113952692 143
559 3300020075 Ga0206349_1814736 Ga0206349_18147362 143
560 3300020076 Ga0206355_1681200 Ga0206355_16812001 143
561 3300020077 Ga0206351_10213855 Ga0206351_102138551 143
562 3300020077 Ga0206351_10244370 Ga0206351_102443701 143
563 3300020078 Ga0206352_10526204 Ga0206352_105262041 143
564 3300020078 Ga0206352_11106613 Ga0206352_111066131 143
565 3300020078 Ga0206352_11335809 Ga0206352_113358091 143
566 3300020080 Ga0206350_10136229 Ga0206350_101362292 143
567 3300020080 Ga0206350_11119363 Ga0206350_111193632 143
568 3300020080 Ga0206350_11310291 Ga0206350_113102911 143
569 3300020080 Ga0206350_11351073 Ga0206350_113510731 143
570 3300020081 Ga0206354_10541864 Ga0206354_105418642 143
571 3300020081 Ga0206354_11573652 Ga0206354_115736522 143
572 3300020082 Ga0206353_10209463 Ga0206353_102094632 143
573 3300020610 Ga0154015_1066765 Ga0154015_10667651 143
574 3300021388 Ga0213875_10004119 Ga0213875_100041192 143
575 3300022467 Ga0224712_10300427 Ga0224712_103004271 143
576 3300025321 Ga0207656_10412629 Ga0207656_104126291 143
577 3300025885 Ga0207653_10133864 Ga0207653_101338642 143
578 3300025898 Ga0207692_10069804 Ga0207692_100698041 143
579 3300025898 Ga0207692_10211134 Ga0207692_102111342 143
580 3300025898 Ga0207692_10325830 Ga0207692_103258301 143
581 3300025898 Ga0207692_10754394 Ga0207692_107543941 143
582 3300025898 Ga0207692_11014266 Ga0207692_110142661 143
583 3300025900 Ga0207710_10358472 Ga0207710_103584721 143
584 3300025900 Ga0207710_10446397 Ga0207710_104463971 143
585 3300025901 Ga0207688_10246000 Ga0207688_102460002 143
586 3300025903 Ga0207680_10895081 Ga0207680_108950811 143
587 3300025904 Ga0207647_10066847 Ga0207647_100668473 143
588 3300025905 Ga0207685_10248683 Ga0207685_102486831 143
589 3300025906 Ga0207699_10020249 Ga0207699_100202496 143
590 3300025906 Ga0207699_10055907 Ga0207699_100559072 143
591 3300025906 Ga0207699_10140995 Ga0207699_101409952 143
592 3300025906 Ga0207699_10515578 Ga0207699_105155781 143
593 3300025910 Ga0207684_10042592 Ga0207684_100425921 143
594 3300025910 Ga0207684_10174450 Ga0207684_101744502 143
595 3300025910 Ga0207684_10391147 Ga0207684_103911472 143
596 3300025911 Ga0207654_10203593 Ga0207654_102035932 143
597 3300025913 Ga0207695_10534452 Ga0207695_105344521 143
598 3300025914 Ga0207671_10597283 Ga0207671_105972832 143
599 3300025915 Ga0207693_10485565 Ga0207693_104855652 143
600 3300025915 Ga0207693_10666239 Ga0207693_106662392 143
601 3300025915 Ga0207693_10829362 Ga0207693_108293621 143
602 3300025916 Ga0207663_10126743 Ga0207663_101267432 143
603 3300025916 Ga0207663_10357438 Ga0207663_103574382 143
604 3300025916 Ga0207663_11148745 Ga0207663_111487451 143
605 3300025917 Ga0207660_10177213 Ga0207660_101772132 143
606 3300025917 Ga0207660_10292633 Ga0207660_102926332 143
607 3300025918 Ga0207662_10054165 Ga0207662_100541652 143
608 3300025919 Ga0207657_10009522 Ga0207657_100095225 143
609 3300025920 Ga0207649_10053478 Ga0207649_100534782 143
610 3300025921 Ga0207652_10069883 Ga0207652_100698833 143
611 3300025921 Ga0207652_11877724 Ga0207652_118777241 143
612 3300025922 Ga0207646_10015499 Ga0207646_100154996 143
613 3300025922 Ga0207646_10049954 Ga0207646_100499545 143
614 3300025922 Ga0207646_10196833 Ga0207646_101968332 143
615 3300025922 Ga0207646_10467288 Ga0207646_104672882 143
616 3300025924 Ga0207694_10670273 Ga0207694_106702731 143
617 3300025924 Ga0207694_10736727 Ga0207694_107367271 143
618 3300025926 Ga0207659_10150235 Ga0207659_101502352 143
619 3300025927 Ga0207687_10361043 Ga0207687_103610431 143
620 3300025928 Ga0207700_10011082 Ga0207700_100110827 143
621 3300025928 Ga0207700_10028774 Ga0207700_100287746 143
622 3300025928 Ga0207700_10085135 Ga0207700_100851354 143
623 3300025928 Ga0207700_10187131 Ga0207700_101871312 143
624 3300025928 Ga0207700_10239984 Ga0207700_102399842 143
625 3300025928 Ga0207700_11246577 Ga0207700_112465771 143
626 3300025929 Ga0207664_10089946 Ga0207664_100899463 143
627 3300025929 Ga0207664_10119876 Ga0207664_101198762 143
628 3300025929 Ga0207664_10147936 Ga0207664_101479363 143
629 3300025929 Ga0207664_10187820 Ga0207664_101878201 143
630 3300025929 Ga0207664_10203924 Ga0207664_102039243 143
631 3300025931 Ga0207644_10785168 Ga0207644_107851682 143
632 3300025933 Ga0207706_10079698 Ga0207706_100796981 143
633 3300025934 Ga0207686_10427430 Ga0207686_104274302 143
634 3300025936 Ga0207670_11479671 Ga0207670_114796711 143
635 3300025937 Ga0207669_10835396 Ga0207669_108353962 143
636 3300025938 Ga0207704_10441898 Ga0207704_104418982 143
637 3300025939 Ga0207665_10011289 Ga0207665_100112894 143
638 3300025939 Ga0207665_11124624 Ga0207665_111246242 143
639 3300025940 Ga0207691_11002390 Ga0207691_110023902 143
640 3300025942 Ga0207689_10067729 Ga0207689_100677295 143
641 3300025944 Ga0207661_10021010 Ga0207661_100210104 143
642 3300025944 Ga0207661_10188507 Ga0207661_101885071 143
643 3300025944 Ga0207661_11123924 Ga0207661_111239241 143
644 3300025944 Ga0207661_11187068 Ga0207661_111870682 143
645 3300025945 Ga0207679_10659019 Ga0207679_106590191 143
646 3300025949 Ga0207667_11133427 Ga0207667_111334271 143
647 3300025961 Ga0207712_11083251 Ga0207712_110832511 143
648 3300025972 Ga0207668_10958664 Ga0207668_109586641 143
649 3300025972 Ga0207668_11136578 Ga0207668_111365781 143
650 3300025981 Ga0207640_10613787 Ga0207640_106137871 143
651 3300026023 Ga0207677_11417353 Ga0207677_114173531 143
652 3300026035 Ga0207703_11039607 Ga0207703_110396071 143
653 3300026067 Ga0207678_10013839 Ga0207678_100138392 143
654 3300026075 Ga0207708_10307659 Ga0207708_103076592 143
655 3300026078 Ga0207702_10715297 Ga0207702_107152972 143
656 3300026078 Ga0207702_12103158 Ga0207702_121031581 143
657 3300026088 Ga0207641_10444188 Ga0207641_104441882 143
658 3300026116 Ga0207674_10119813 Ga0207674_101198135 143
659 3300026116 Ga0207674_10124222 Ga0207674_101242221 143
660 3300026116 Ga0207674_11314288 Ga0207674_113142882 143
661 3300026118 Ga0207675_100052218 Ga0207675_1000522182 143
662 3300026118 Ga0207675_100456499 Ga0207675_1004564991 143
663 3300026121 Ga0207683_11546339 Ga0207683_115463392 143
664 3300026121 Ga0207683_11566398 Ga0207683_115663981 143
665 3300026142 Ga0207698_11351965 Ga0207698_113519651 143
666 3300026142 Ga0207698_11946099 Ga0207698_119460991 143
667 3300028023 Ga0265357_1001605 Ga0265357_10016051 143
668 3300028381 Ga0268264_11863866 Ga0268264_118638661 143
669 3300028654 Ga0265322_10040260 Ga0265322_100402602 143
670 3300028800 Ga0265338_10001197 Ga0265338_1000119731 143
671 3300028800 Ga0265338_10311204 Ga0265338_103112041 143
672 3300030760 Ga0265762_1013027 Ga0265762_10130271 143
673 3300030763 Ga0265763_1000424 Ga0265763_10004242 143
674 3300030882 Ga0265764_100491 Ga0265764_1004913 143
675 3300031240 Ga0265320_10210696 Ga0265320_102106962 143
676 3300031241 Ga0265325_10147857 Ga0265325_101478572 143
677 3300034817 Ga0373948_0024187 Ga0373948_0024187_300_731 143
678 3300034957 Ga0373938_0010587 Ga0373938_0010587_1002_1433 143
679 3300035083 Ga0373926_0189688 Ga0373926_0189688_263_697 143
680 3300035086 Ga0373934_0000178 Ga0373934_0000178_13791_14228 143
681 3300035086 Ga0373934_0117000 Ga0373934_0117000_482_922 143
682 3300035086 Ga0373934_0148985 Ga0373934_0148985_11_463 143
683 3300035088 Ga0373940_0194261 Ga0373940_0194261_158_589 143
684 3300035090 Ga0373949_0013622 Ga0373949_0013622_925_1356 143
685 3300035111 Ga0373923_0136030 Ga0373923_0136030_117_569 143
686 3300035111 Ga0373923_0179470 Ga0373923_0179470_62_502 143
687 3300035111 Ga0373923_0313732 Ga0373923_0313732_150_581 143
688 3300035111 Ga0373923_0394451 Ga0373923_0394451_140_571 143
689 3300035111 Ga0373923_0480089 Ga0373923_0480089_56_490 143
690 3300035114 Ga0373939_0071112 Ga0373939_0071112_608_1039 143
691 3300035114 Ga0373939_0327359 Ga0373939_0327359_109_540 143
692 3300035115 Ga0373941_0120095 Ga0373941_0120095_309_740 143
693 3300035117 Ga0373953_0000084 Ga0373953_0000084_20423_20860 143
694 3300035117 Ga0373953_0031819 Ga0373953_0031819_1298_1738 143
695 3300035117 Ga0373953_0098302 Ga0373953_0098302_138_572 143
696 3300035118 Ga0373954_0003839 Ga0373954_0003839_2804_3241 143
697 3300035118 Ga0373954_0041490 Ga0373954_0041490_168_608 143
698 3300035118 Ga0373954_0532331 Ga0373954_0532331_108_539 143
699 3300035119 Ga0373956_0000007 Ga0373956_0000007_29088_29525 143
700 3300035119 Ga0373956_0026014 Ga0373956_0026014_342_794 143
701 3300035119 Ga0373956_0338483 Ga0373956_0338483_173_607 143
702 3300035120 Ga0373957_0000024 Ga0373957_0000024_9821_10258 143
703 3300035120 Ga0373957_0105863 Ga0373957_0105863_221_661 143
704 3300035120 Ga0373957_0343265 Ga0373957_0343265_91_525 143
705 3300035120 Ga0373957_0460855 Ga0373957_0460855_53_484 143
706 3300035171 Ga0373946_0213227 Ga0373946_0213227_440_880 143
707 3300035172 Ga0373955_0000007 Ga0373955_0000007_25757_26194 143
708 3300035172 Ga0373955_0066861 Ga0373955_0066861_14_445 143
709 3300035172 Ga0373955_0127993 Ga0373955_0127993_840_1292 143
710 3300035172 Ga0373955_0206105 Ga0373955_0206105_350_790 143
711 3300035207 Ga0373942_0047809 Ga0373942_0047809_130_561 143
712 3300035241 Ga0373961_0029012 Ga0373961_0029012_38_469 143
713 3300035410 Ga0373924_0003234 Ga0373924_0003234_760_1200 143
714 3300035410 Ga0373924_0005522 Ga0373924_0005522_105_539 143
715 3300035410 Ga0373924_0021111 Ga0373924_0021111_1722_2159 143
716 3300035410 Ga0373924_0335527 Ga0373924_0335527_187_618 143
717 3300035691 Ga0373931_0588235 Ga0373931_0588235_156_587 143
718 3300035692 Ga0373935_0058944 Ga0373935_0058944_1958_2410 143
719 3300035692 Ga0373935_0232599 Ga0373935_0232599_575_1015 143
720 3300035692 Ga0373935_0357506 Ga0373935_0357506_455_886 143
721 3300035692 Ga0373935_0792642 Ga0373935_0792642_105_536 143
722 3300035692 Ga0373935_1025005 Ga0373935_1025005_101_541 143
723 3300035695 Ga0373927_0040668 Ga0373927_0040668_90_542 143
724 3300035724 Ga0373933_0000002 Ga0373933_0000002_89599_90036 143
725 3300035724 Ga0373933_0010125 Ga0373933_0010125_3182_3622 143
726 3300035724 Ga0373933_0099864 Ga0373933_0099864_871_1323 143
727 3300035724 Ga0373933_0377478 Ga0373933_0377478_137_589 143
728 3300035724 Ga0373933_0555170 Ga0373933_0555170_211_642 143
729 3300035725 Ga0373947_0045765 Ga0373947_0045765_1587_2039 143
730 3300036401 Ga0373937_0000014 Ga0373937_0000014_61750_62187 143
731 3300036401 Ga0373937_0045905 Ga0373937_0045905_2679_3131 143
732 3300036401 Ga0373937_0129547 Ga0373937_0129547_1578_2030 143
733 3300036401 Ga0373937_0251406 Ga0373937_0251406_21_452 143
734 3300036401 Ga0373937_0314424 Ga0373937_0314424_944_1378 143
735 3300036401 Ga0373937_0472999 Ga0373937_0472999_532_972 143
736 3300036401 Ga0373937_1277377 Ga0373937_1277377_145_579 143
737 3300036457 Ga0265778_005647 Ga0265778_005647_867_1307 143
738 3300037068 Ga0373925_0000373 Ga0373925_0000373_7958_8407 143
739 3300037068 Ga0373925_0001704 Ga0373925_0001704_2957_3394 143
740 3300037068 Ga0373925_0014582 Ga0373925_0014582_366_818 143
741 3300037068 Ga0373925_0044387 Ga0373925_0044387_1664_2107 143
742 3300037068 Ga0373925_1148892 Ga0373925_1148892_156_608 143
743 3300037853 Ga0436364_0037108 Ga0436364_0037108_6662_7102 143
744 3300037853 Ga0436364_0787453 Ga0436364_0787453_331_768 143
745 3300046454 Ga0495592_0000077 Ga0495592_0000077_23651_24088 143
746 3300046454 Ga0495592_0207603 Ga0495592_0207603_760_1200 143
747 3300046454 Ga0495592_0218829 Ga0495592_0218829_53_487 143
748 3300046454 Ga0495592_0837131 Ga0495592_0837131_14_445 143
749 3300046461 Ga0495641_0446907 Ga0495641_0446907_81_515 143
750 3300046462 Ga0495651_0000019 Ga0495651_0000019_61750_62187 143
751 3300046462 Ga0495651_0011292 Ga0495651_0011292_6067_6519 143
752 3300046462 Ga0495651_0087391 Ga0495651_0087391_370_801 143
753 3300046462 Ga0495651_0345108 Ga0495651_0345108_492_932 143
754 3300046462 Ga0495651_0626085 Ga0495651_0626085_178_612 143
755 3300046463 Ga0495653_0000252 Ga0495653_0000252_7557_7994 143
756 3300046463 Ga0495653_0010757 Ga0495653_0010757_353_805 143
757 3300046463 Ga0495653_0117177 Ga0495653_0117177_1229_1660 143
758 3300046463 Ga0495653_0165935 Ga0495653_0165935_945_1385 143
759 3300046463 Ga0495653_0303146 Ga0495653_0303146_530_982 143
760 3300046463 Ga0495653_0517388 Ga0495653_0517388_152_712 143
761 3300046463 Ga0495653_0570295 Ga0495653_0570295_93_527 143
762 3300046477 Ga0495664_0027093 Ga0495664_0027093_360_812 143
763 3300046477 Ga0495664_0181731 Ga0495664_0181731_535_1008 143
764 3300046477 Ga0495664_0216956 Ga0495664_0216956_285_725 143
765 3300046477 Ga0495664_0241888 Ga0495664_0241888_409_861 143
766 3300046477 Ga0495664_0263247 Ga0495664_0263247_411_851 143
767 3300046477 Ga0495664_0526357 Ga0495664_0526357_61_492 143
768 3300046511 Ga0495608_0000028 Ga0495608_0000028_89591_90028 143
769 3300046511 Ga0495608_0120100 Ga0495608_0120100_1099_1533 143
770 3300046511 Ga0495608_0151698 Ga0495608_0151698_822_1262 143
771 3300046511 Ga0495608_0292448 Ga0495608_0292448_187_627 143
772 3300046514 Ga0495618_0139021 Ga0495618_0139021_625_1065 143
773 3300046514 Ga0495618_0242575 Ga0495618_0242575_401_832 143
774 3300046514 Ga0495618_0297745 Ga0495618_0297745_196_648 143
775 3300046516 Ga0495628_0000337 Ga0495628_0000337_32023_32460 143
776 3300046516 Ga0495628_0025055 Ga0495628_0025055_3825_4277 143
777 3300046516 Ga0495628_0176967 Ga0495628_0176967_1169_1600 143
778 3300046516 Ga0495628_0221717 Ga0495628_0221717_345_797 143
779 3300046516 Ga0495628_0240418 Ga0495628_0240418_691_1125 143
780 3300046516 Ga0495628_0479676 Ga0495628_0479676_86_517 143
781 3300046516 Ga0495628_0797776 Ga0495628_0797776_22_474 143
782 3300046517 Ga0495630_0364152 Ga0495630_0364152_270_710 143
783 3300046517 Ga0495630_0871694 Ga0495630_0871694_151_582 143
784 3300046517 Ga0495630_0891594 Ga0495630_0891594_81_512 143
785 3300046517 Ga0495630_1313459 Ga0495630_1313459_94_531 143
786 3300046529 Ga0495652_0000031 Ga0495652_0000031_89579_90016 143
787 3300046529 Ga0495652_0007308 Ga0495652_0007308_2101_2553 143
788 3300046529 Ga0495652_0112765 Ga0495652_0112765_877_1317 143
789 3300046529 Ga0495652_0137619 Ga0495652_0137619_1298_1732 143
790 3300046529 Ga0495652_0158058 Ga0495652_0158058_1174_1650 143
791 3300046529 Ga0495652_0180700 Ga0495652_0180700_984_1415 143
792 3300046529 Ga0495652_0844350 Ga0495652_0844350_48_479 143
793 3300046533 Ga0495640_0020499 Ga0495640_0020499_2500_2952 143
794 3300046533 Ga0495640_0036929 Ga0495640_0036929_648_1100 143
795 3300046533 Ga0495640_0125737 Ga0495640_0125737_754_1194 143
796 3300046533 Ga0495640_0570823 Ga0495640_0570823_53_484 143
797 3300046535 Ga0495586_0235443 Ga0495586_0235443_129_560 143
798 3300046535 Ga0495586_0321362 Ga0495586_0321362_376_807 143
799 3300046535 Ga0495586_0461387 Ga0495586_0461387_200_640 143
800 3300046536 Ga0495587_0000023 Ga0495587_0000023_61728_62165 143
801 3300046536 Ga0495587_0038095 Ga0495587_0038095_2244_2675 143
802 3300046536 Ga0495587_0150278 Ga0495587_0150278_201_641 143
803 3300046536 Ga0495587_0168066 Ga0495587_0168066_466_918 143
804 3300046536 Ga0495587_0246748 Ga0495587_0246748_399_830 143
805 3300046536 Ga0495587_0485569 Ga0495587_0485569_87_521 143
806 3300046543 Ga0495645_0200680 Ga0495645_0200680_629_1081 143
807 3300046543 Ga0495645_0358643 Ga0495645_0358643_462_896 143
808 3300046543 Ga0495645_0608445 Ga0495645_0608445_81_521 143
809 3300046559 Ga0495667_0000054 Ga0495667_0000054_89591_90028 143
810 3300046559 Ga0495667_0025502 Ga0495667_0025502_611_1042 143
811 3300046559 Ga0495667_0176125 Ga0495667_0176125_876_1328 143
812 3300046559 Ga0495667_0249565 Ga0495667_0249565_619_1059 143
813 3300046559 Ga0495667_0433992 Ga0495667_0433992_323_775 143
814 3300046559 Ga0495667_0990582 Ga0495667_0990582_18_449 143
815 3300046642 Ga0495634_0073656 Ga0495634_0073656_118_558 143
816 3300046663 Ga0495635_0028679 Ga0495635_0028679_3406_3858 143
817 3300046663 Ga0495635_0056438 Ga0495635_0056438_1389_1841 143
818 3300046663 Ga0495635_0224288 Ga0495635_0224288_367_807 143
819 3300046675 Ga0495657_0000022 Ga0495657_0000022_89599_90036 143
820 3300046675 Ga0495657_0034083 Ga0495657_0034083_374_826 143
821 3300046675 Ga0495657_0081932 Ga0495657_0081932_1568_1999 143
822 3300046675 Ga0495657_0141062 Ga0495657_0141062_209_649 143
823 3300046675 Ga0495657_0160676 Ga0495657_0160676_252_692 143
824 3300046675 Ga0495657_0290507 Ga0495657_0290507_86_520 143
825 3300046675 Ga0495657_0309586 Ga0495657_0309586_155_586 143
826 3300046678 Ga0495599_0000125 Ga0495599_0000125_36240_36677 143
827 3300046678 Ga0495599_0139996 Ga0495599_0139996_624_1076 143
828 3300046678 Ga0495599_0227269 Ga0495599_0227269_621_1061 143
829 3300046678 Ga0495599_0342355 Ga0495599_0342355_249_689 143
830 3300046679 Ga0495623_0000797 Ga0495623_0000797_9155_9592 143
831 3300046680 Ga0495646_0028041 Ga0495646_0028041_2414_2851 143
832 3300046680 Ga0495646_0373425 Ga0495646_0373425_235_675 143
833 3300046683 Ga0495658_0645519 Ga0495658_0645519_188_619 143
834 3300046689 Ga0495613_0879351 Ga0495613_0879351_76_516 143
835 3300046690 Ga0495624_0591969 Ga0495624_0591969_35_475 143
836 3300046809 Ga0495600_0040792 Ga0495600_0040792_1004_1441 143
837 3300046809 Ga0495600_0063555 Ga0495600_0063555_344_796 143
838 3300046809 Ga0495600_0159285 Ga0495600_0159285_862_1302 143
839 3300047317 Ga0495604_0000022 Ga0495604_0000022_89558_89995 143
840 3300047317 Ga0495604_0002956 Ga0495604_0002956_2067_2519 143
841 3300047317 Ga0495604_0107071 Ga0495604_0107071_1375_1806 143
842 3300047317 Ga0495604_0246550 Ga0495604_0246550_635_1069 143
843 3300047317 Ga0495604_0272387 Ga0495604_0272387_563_1003 143
844 3300047319 Ga0495674_0003502 Ga0495674_0003502_4790_5242 143
845 3300047319 Ga0495674_0119975 Ga0495674_0119975_823_1263 143
846 3300047319 Ga0495674_0122790 Ga0495674_0122790_1523_1963 143
847 3300047319 Ga0495674_0610323 Ga0495674_0610323_185_619 143
848 3300047321 Ga0495676_0471218 Ga0495676_0471218_188_640 143
849 3300047322 Ga0495680_0000154 Ga0495680_0000154_37128_37565 143
850 3300047322 Ga0495680_0035570 Ga0495680_0035570_2754_3194 143
851 3300047322 Ga0495680_0044489 Ga0495680_0044489_498_932 143
852 3300047322 Ga0495680_0472025 Ga0495680_0472025_154_585 143
853 3300047322 Ga0495680_0756159 Ga0495680_0756159_157_588 143
854 3300047444 Ga0495675_0000235 Ga0495675_0000235_17739_18176 143
855 3300047444 Ga0495675_0060940 Ga0495675_0060940_1307_1738 143
856 3300047444 Ga0495675_0093748 Ga0495675_0093748_1347_1799 143
857 3300047444 Ga0495675_0716074 Ga0495675_0716074_93_527 143
858 3300047471 Ga0495684_0057283 Ga0495684_0057283_2170_2622 143
859 3300047471 Ga0495684_0648246 Ga0495684_0648246_118_558 143
860 3300047471 Ga0495684_0673310 Ga0495684_0673310_230_661 143
861 3300047471 Ga0495684_0935619 Ga0495684_0935619_39_470 143
862 3300048088 Ga0495602_0000251 Ga0495602_0000251_1019_1456 143
863 3300048088 Ga0495602_0031790 Ga0495602_0031790_3580_4011 143
864 3300048088 Ga0495602_0078803 Ga0495602_0078803_2260_2712 143
865 3300048088 Ga0495602_0308311 Ga0495602_0308311_657_1130 143
866 3300048088 Ga0495602_0490428 Ga0495602_0490428_267_701 143
867 3300048088 Ga0495602_0563992 Ga0495602_0563992_81_521 143
868 3300048903 Ga0496100_1068297 Ga0496100_1068297_77_508 143
869 3300048903 Ga0496100_1177138 Ga0496100_1177138_146_577 143
870 3300048904 Ga0496101_0284736 Ga0496101_0284736_769_1200 143
871 3300048905 Ga0496102_0383507 Ga0496102_0383507_709_1140 143
872 3300048906 Ga0496103_0480845 Ga0496103_0480845_193_624 143
873 3300048907 Ga0496104_1001737 Ga0496104_1001737_112_543 143
874 3300048908 Ga0496105_0296952 Ga0496105_0296952_813_1244 143
875 3300048908 Ga0496105_0734781 Ga0496105_0734781_185_616 143
876 3300048909 Ga0496106_0248619 Ga0496106_0248619_441_872 143
877 3300048909 Ga0496106_0776858 Ga0496106_0776858_107_538 143
878 3300048911 Ga0496108_0822512 Ga0496108_0822512_207_638 143
879 3300048911 Ga0496108_1287560 Ga0496108_1287560_41_472 143
880 3300048912 Ga0496109_0332485 Ga0496109_0332485_342_773 143
881 3300048913 Ga0496110_0986764 Ga0496110_0986764_123_554 143
882 3300048914 Ga0496111_0180004 Ga0496111_0180004_855_1286 143
883 3300048915 Ga0496112_0474127 Ga0496112_0474127_566_997 143
884 3300048915 Ga0496112_0596566 Ga0496112_0596566_75_506 143
885 3300048916 Ga0496113_0688241 Ga0496113_0688241_257_688 143
886 3300048917 Ga0496114_0619402 Ga0496114_0619402_305_736 143
887 3300048918 Ga0496115_0074354 Ga0496115_0074354_1350_1787 143
888 3300048929 Ga0496126_0007521 Ga0496126_0007521_7327_7848 143
889 3300048929 Ga0496126_0027096 Ga0496126_0027096_1493_1930 143
890 3300050513 nmdc:mga0rr50_453393_c1 nmdc:mga0rr50_453393_c1_490_921 143
891 3300050515 nmdc:mga0a205_169598_c1 nmdc:mga0a205_169598_c1_1413_1844 143
892 3300053077 Ga0495601_0053364 Ga0495601_0053364_941_1393 143
893 3300053078 Ga0495612_0037716 Ga0495612_0037716_900_1352 143
894 3300053078 Ga0495612_0192636 Ga0495612_0192636_61_534 143
895 3300053078 Ga0495612_0426118 Ga0495612_0426118_48_482 143
896 3300053084 Ga0495595_0024435 Ga0495595_0024435_243_680 143
897 3300053084 Ga0495595_0143843 Ga0495595_0143843_118_549 143
898 3300053085 Ga0495619_0371497 Ga0495619_0371497_306_758 143
899 3300053085 Ga0495619_0873685 Ga0495619_0873685_79_510 143
900 3300059477 Ga0587084_022021 Ga0587084_022021_34_465 143
901 3300059490 Ga0587066_054018 Ga0587066_054018_257_688 143
902 3300059626 Ga0587115_088045 Ga0587115_088045_111_542 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

20

162

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8276 4 140
3cis-assembly3.cif.gz_F the crystal structure of rv2623 from mycobacterium tuberculosis 0.8099 1 141
2z08-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.8085 4 139
2jax-assembly1.cif.gz_A-2 universal stress protein rv2623 from mycobaterium tuberculosis 0.797 3 142
6hcd-assembly2.cif.gz_D structure of universal stress protein from archaeoglobus fulgidus 0.7858 1 138
ID Description Score Start End Superfamily
af_P9WFD7_1_148_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8439 3 138 3.40.50.620
af_P9WFD7_1_148_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8013 3 138 3.40.50.620
2jaxA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7933 3 139 3.40.50.620
af_P9WFD9_1_145_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7899 2 143 3.40.50.620
af_Q5A0W0_283_438_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7896 2 143 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A358SK79-F1-model_v4 Universal stress protein UspA 0.8986 1 143
AF-A0A358SK79-F1-model_v4 Universal stress protein UspA 0.8926 1 143
AF-A0A498DQY1-F1-model_v4 Universal stress protein 0.8644 4 143
AF-A0A1I4HM48-F1-model_v4 Universal stress protein family protein 0.8637 2 143
AF-A0A229RHI3-F1-model_v4 Universal stress protein 0.8565 2 141

Feature Viewer

pLDDT pTM Quality
73.83 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map