F485227
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 295 | 902 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0007521|Ga0496126_0007521_7327_7848 |
| Length | 173 |
| Sequence | MARDPSVDGKDTGQRREVKMPGIIVGIDGSAHSRRALEWAVDEAAIRHMPLTVLTVNQALASCWTGEPVSYSGDQELTKKVRQAAQEETDSVLKKTNENSRPPSVVVRAVAGLPAKELLNASGDADMVVVGARGADGVKRLLLGSVSVAVTHHARCPVVVIPAGNPQQAYVGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 106 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 179 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.12 |
| Metatranscriptomes | 3.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.99 |
| Rhizosphere | 95.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10001092 | 3300003659 | Bacteria | 4557 |
| 2 | Ga0058861_12043780 | 3300004800 | Bacteria | 903 |
| 3 | Ga0058862_12706110 | 3300004803 | Unclassified | 747 |
| 4 | Ga0070683_100075781 | 3300005329 | Bacteria | 3144 |
| 5 | Ga0070683_100382345 | 3300005329 | Unclassified | 1341 |
| 6 | Ga0070683_100852711 | 3300005329 | Bacteria | 874 |
| 7 | Ga0070670_101404312 | 3300005331 | Unclassified | 640 |
| 8 | Ga0068869_100139532 | 3300005334 | Bacteria | 1870 |
| 9 | Ga0068869_101515775 | 3300005334 | Bacteria | 595 |
| 10 | Ga0070680_100259093 | 3300005336 | Unclassified | 1471 |
| 11 | Ga0070680_100277186 | 3300005336 | Bacteria | 1420 |
| 12 | Ga0070680_101431036 | 3300005336 | Unclassified | 598 |
| 13 | Ga0070682_100109485 | 3300005337 | Unclassified | 1839 |
| 14 | Ga0070682_100315416 | 3300005337 | Bacteria | 1152 |
| 15 | Ga0070682_100933297 | 3300005337 | Bacteria | 715 |
| 16 | Ga0068868_100202235 | 3300005338 | Bacteria | 1656 |
| 17 | Ga0068868_101493115 | 3300005338 | Bacteria | 632 |
| 18 | Ga0070660_100441711 | 3300005339 | Bacteria | 1079 |
| 19 | Ga0070691_10260930 | 3300005341 | Bacteria | 933 |
| 20 | Ga0070691_10698919 | 3300005341 | Bacteria | 608 |
| 21 | Ga0070687_100980794 | 3300005343 | Bacteria | 611 |
| 22 | Ga0070661_100392002 | 3300005344 | Bacteria | 1097 |
| 23 | Ga0070675_100510808 | 3300005354 | Bacteria | 1084 |
| 24 | Ga0070675_101891405 | 3300005354 | Unclassified | 550 |
| 25 | Ga0070671_100651498 | 3300005355 | Bacteria | 912 |
| 26 | Ga0070674_100222825 | 3300005356 | Bacteria | 1468 |
| 27 | Ga0070673_101313412 | 3300005364 | Unclassified | 679 |
| 28 | Ga0070673_101589695 | 3300005364 | Bacteria | 617 |
| 29 | Ga0070659_100142422 | 3300005366 | Bacteria | 1952 |
| 30 | Ga0070703_10296350 | 3300005406 | Bacteria | 673 |
| 31 | Ga0070709_10082338 | 3300005434 | Bacteria | 2102 |
| 32 | Ga0070714_100011586 | 3300005435 | Bacteria | 7000 |
| 33 | Ga0070714_100024414 | 3300005435 | Bacteria | 4978 |
| 34 | Ga0070714_100182401 | 3300005435 | Unclassified | 1911 |
| 35 | Ga0070714_100573750 | 3300005435 | Unclassified | 1082 |
| 36 | Ga0070714_100642932 | 3300005435 | Bacteria | 1021 |
| 37 | Ga0070714_100722612 | 3300005435 | Bacteria | 962 |
| 38 | Ga0070714_101044783 | 3300005435 | Bacteria | 795 |
| 39 | Ga0070714_101062692 | 3300005435 | Bacteria | 788 |
| 40 | Ga0070714_101419944 | 3300005435 | Archaea | 678 |
| 41 | Ga0070713_100043664 | 3300005436 | Bacteria | 3666 |
| 42 | Ga0070713_100090641 | 3300005436 | Bacteria | 2628 |
| 43 | Ga0070713_100120023 | 3300005436 | Bacteria | 2304 |
| 44 | Ga0070713_100224072 | 3300005436 | Bacteria | 1707 |
| 45 | Ga0070713_100244642 | 3300005436 | Bacteria | 1634 |
| 46 | Ga0070713_100560609 | 3300005436 | Bacteria | 1082 |
| 47 | Ga0070713_100776176 | 3300005436 | Bacteria | 918 |
| 48 | Ga0070710_10144798 | 3300005437 | Bacteria | 1460 |
| 49 | Ga0070710_10395102 | 3300005437 | Unclassified | 925 |
| 50 | Ga0070710_10894657 | 3300005437 | Bacteria | 640 |
| 51 | Ga0070711_100057214 | 3300005439 | Bacteria | 2699 |
| 52 | Ga0070711_100078518 | 3300005439 | Bacteria | 2345 |
| 53 | Ga0070705_100391413 | 3300005440 | Bacteria | 1026 |
| 54 | Ga0070705_101335415 | 3300005440 | Bacteria | 595 |
| 55 | Ga0070708_100047647 | 3300005445 | Bacteria | 3786 |
| 56 | Ga0070708_100385452 | 3300005445 | Bacteria | 1322 |
| 57 | Ga0070708_100441042 | 3300005445 | Bacteria | 1228 |
| 58 | Ga0070663_100417308 | 3300005455 | Bacteria | 1100 |
| 59 | Ga0070678_100245676 | 3300005456 | Unclassified | 1498 |
| 60 | Ga0070678_101165527 | 3300005456 | Bacteria | 713 |
| 61 | Ga0070678_101446089 | 3300005456 | Unclassified | 643 |
| 62 | Ga0070662_100767977 | 3300005457 | Bacteria | 818 |
| 63 | Ga0070681_10581936 | 3300005458 | Bacteria | 1033 |
| 64 | Ga0070681_11224918 | 3300005458 | Unclassified | 673 |
| 65 | Ga0070681_11417585 | 3300005458 | Bacteria | 618 |
| 66 | Ga0070706_100074346 | 3300005467 | Bacteria | 3145 |
| 67 | Ga0070706_100093017 | 3300005467 | Bacteria | 2797 |
| 68 | Ga0070706_100312463 | 3300005467 | Bacteria | 1466 |
| 69 | Ga0070706_100490871 | 3300005467 | Bacteria | 1143 |
| 70 | Ga0070706_100555779 | 3300005467 | Bacteria | 1067 |
| 71 | Ga0070707_100003731 | 3300005468 | Bacteria | 14373 |
| 72 | Ga0070707_100086187 | 3300005468 | Bacteria | 3037 |
| 73 | Ga0070707_100226629 | 3300005468 | Bacteria | 1820 |
| 74 | Ga0070707_100679550 | 3300005468 | Bacteria | 992 |
| 75 | Ga0070707_100747280 | 3300005468 | Bacteria | 941 |
| 76 | Ga0070707_100785135 | 3300005468 | Bacteria | 916 |
| 77 | Ga0070707_100886432 | 3300005468 | Unclassified | 857 |
| 78 | Ga0070707_101009222 | 3300005468 | Bacteria | 798 |
| 79 | Ga0070698_100003676 | 3300005471 | Bacteria | 16842 |
| 80 | Ga0070698_100006357 | 3300005471 | Bacteria | 12830 |
| 81 | Ga0070698_100008957 | 3300005471 | Bacteria | 10766 |
| 82 | Ga0070698_100011232 | 3300005471 | Bacteria | 9511 |
| 83 | Ga0070698_100150799 | 3300005471 | Bacteria | 2272 |
| 84 | Ga0070698_100858794 | 3300005471 | Bacteria | 852 |
| 85 | Ga0070699_100000405 | 3300005518 | Bacteria | 41700 |
| 86 | Ga0070699_100039229 | 3300005518 | Bacteria | 4101 |
| 87 | Ga0070699_100132548 | 3300005518 | Bacteria | 2197 |
| 88 | Ga0070699_100402056 | 3300005518 | Unclassified | 1238 |
| 89 | Ga0070679_100118973 | 3300005530 | Bacteria | 2626 |
| 90 | Ga0070679_100221190 | 3300005530 | Bacteria | 1854 |
| 91 | Ga0070684_100261088 | 3300005535 | Bacteria | 1584 |
| 92 | Ga0070684_100340859 | 3300005535 | Bacteria | 1378 |
| 93 | Ga0070684_100932886 | 3300005535 | Bacteria | 814 |
| 94 | Ga0070684_101253660 | 3300005535 | Unclassified | 697 |
| 95 | Ga0070697_100029395 | 3300005536 | Bacteria | 4406 |
| 96 | Ga0070697_101232048 | 3300005536 | Bacteria | 667 |
| 97 | Ga0068853_100061302 | 3300005539 | Bacteria | 3253 |
| 98 | Ga0070686_101162384 | 3300005544 | Bacteria | 640 |
| 99 | Ga0070696_100590070 | 3300005546 | Bacteria | 895 |
| 100 | Ga0070693_100348754 | 3300005547 | Bacteria | 1012 |
| 101 | Ga0070665_100307596 | 3300005548 | Bacteria | 1588 |
| 102 | Ga0070665_100312721 | 3300005548 | Bacteria | 1575 |
| 103 | Ga0070665_101417992 | 3300005548 | Bacteria | 703 |
| 104 | Ga0070704_100362466 | 3300005549 | Bacteria | 1226 |
| 105 | Ga0068855_100579982 | 3300005563 | Bacteria | 1211 |
| 106 | Ga0068855_101510327 | 3300005563 | Bacteria | 689 |
| 107 | Ga0070664_100750291 | 3300005564 | Bacteria | 911 |
| 108 | Ga0068857_100092718 | 3300005577 | Bacteria | 2704 |
| 109 | Ga0068857_100150823 | 3300005577 | Bacteria | 2106 |
| 110 | Ga0068857_100937112 | 3300005577 | Bacteria | 832 |
| 111 | Ga0068854_100447867 | 3300005578 | Bacteria | 1078 |
| 112 | Ga0068856_100445478 | 3300005614 | Bacteria | 1316 |
| 113 | Ga0068856_101258839 | 3300005614 | Bacteria | 755 |
| 114 | Ga0068856_101361486 | 3300005614 | Bacteria | 724 |
| 115 | Ga0070702_101078372 | 3300005615 | Bacteria | 640 |
| 116 | Ga0068859_100422296 | 3300005617 | Bacteria | 1429 |
| 117 | Ga0068859_101257195 | 3300005617 | Unclassified | 816 |
| 118 | Ga0068864_101587790 | 3300005618 | Bacteria | 658 |
| 119 | Ga0068864_102202494 | 3300005618 | Bacteria | 558 |
| 120 | Ga0068861_101318383 | 3300005719 | Bacteria | 702 |
| 121 | Ga0068851_10091240 | 3300005834 | Bacteria | 1604 |
| 122 | Ga0068863_100306613 | 3300005841 | Bacteria | 1540 |
| 123 | Ga0068863_101916837 | 3300005841 | Unclassified | 602 |
| 124 | Ga0068858_100185422 | 3300005842 | Bacteria | 1965 |
| 125 | Ga0068860_100707286 | 3300005843 | Bacteria | 1017 |
| 126 | Ga0068860_101471931 | 3300005843 | Unclassified | 702 |
| 127 | Ga0068860_101556756 | 3300005843 | Unclassified | 683 |
| 128 | Ga0081540_1001743 | 3300005983 | Bacteria | 18315 |
| 129 | Ga0081540_1048040 | 3300005983 | Bacteria | 2141 |
| 130 | Ga0070717_10035084 | 3300006028 | Bacteria | 4058 |
| 131 | Ga0070717_10065911 | 3300006028 | Bacteria | 3011 |
| 132 | Ga0070717_10185487 | 3300006028 | Bacteria | 1815 |
| 133 | Ga0070717_10783239 | 3300006028 | Bacteria | 867 |
| 134 | Ga0070717_11092002 | 3300006028 | Bacteria | 727 |
| 135 | Ga0070717_11143668 | 3300006028 | Bacteria | 709 |
| 136 | Ga0070715_10004114 | 3300006163 | Unclassified | 4726 |
| 137 | Ga0070715_10690291 | 3300006163 | Bacteria | 608 |
| 138 | Ga0070716_100081549 | 3300006173 | Bacteria | 1932 |
| 139 | Ga0070716_100107312 | 3300006173 | Bacteria | 1724 |
| 140 | Ga0070716_100815927 | 3300006173 | Bacteria | 723 |
| 141 | Ga0070716_100953421 | 3300006173 | Unclassified | 675 |
| 142 | Ga0070712_100036052 | 3300006175 | Bacteria | 3362 |
| 143 | Ga0070712_100132094 | 3300006175 | Bacteria | 1893 |
| 144 | Ga0070712_100207072 | 3300006175 | Bacteria | 1545 |
| 145 | Ga0070712_100281608 | 3300006175 | Bacteria | 1339 |
| 146 | Ga0070712_100322043 | 3300006175 | Bacteria | 1257 |
| 147 | Ga0070712_101617694 | 3300006175 | Bacteria | 567 |
| 148 | Ga0097621_100363651 | 3300006237 | Bacteria | 1289 |
| 149 | Ga0068871_100133473 | 3300006358 | Bacteria | 2107 |
| 150 | Ga0068871_101710712 | 3300006358 | Bacteria | 596 |
| 151 | Ga0075428_100212893 | 3300006844 | Unclassified | 2088 |
| 152 | Ga0075431_100626913 | 3300006847 | Unclassified | 1057 |
| 153 | Ga0075433_10128788 | 3300006852 | Unclassified | 2248 |
| 154 | Ga0075433_11422670 | 3300006852 | Bacteria | 600 |
| 155 | Ga0075434_100146391 | 3300006871 | Bacteria | 2382 |
| 156 | Ga0075434_100515993 | 3300006871 | Bacteria | 1216 |
| 157 | Ga0075434_100810258 | 3300006871 | Unclassified | 952 |
| 158 | Ga0068865_100028789 | 3300006881 | Bacteria | 3680 |
| 159 | Ga0075436_100252256 | 3300006914 | Bacteria | 1257 |
| 160 | Ga0075436_100550978 | 3300006914 | Unclassified | 846 |
| 161 | Ga0097620_100422283 | 3300006931 | Bacteria | 1429 |
| 162 | Ga0097620_101257251 | 3300006931 | Unclassified | 816 |
| 163 | Ga0075435_100286519 | 3300007076 | Unclassified | 1407 |
| 164 | Ga0075435_100365353 | 3300007076 | Unclassified | 1238 |
| 165 | Ga0075435_101482424 | 3300007076 | Unclassified | 595 |
| 166 | Ga0075435_101852209 | 3300007076 | Unclassified | 530 |
| 167 | Ga0105250_10077867 | 3300009092 | Bacteria | 1342 |
| 168 | Ga0105240_10348767 | 3300009093 | Bacteria | 1680 |
| 169 | Ga0105240_10398695 | 3300009093 | Bacteria | 1550 |
| 170 | Ga0105240_10972950 | 3300009093 | Bacteria | 909 |
| 171 | Ga0111539_11089217 | 3300009094 | Unclassified | 928 |
| 172 | Ga0111539_13510366 | 3300009094 | Bacteria | 503 |
| 173 | Ga0105245_10973672 | 3300009098 | Bacteria | 892 |
| 174 | Ga0105245_11152039 | 3300009098 | Bacteria | 822 |
| 175 | Ga0105247_10430328 | 3300009101 | Unclassified | 947 |
| 176 | Ga0105247_10700423 | 3300009101 | Bacteria | 762 |
| 177 | Ga0114129_10018632 | 3300009147 | Bacteria | 9882 |
| 178 | Ga0105243_10071648 | 3300009148 | Bacteria | 2803 |
| 179 | Ga0105241_10176838 | 3300009174 | Bacteria | 1767 |
| 180 | Ga0105241_10830963 | 3300009174 | Bacteria | 853 |
| 181 | Ga0105242_10819844 | 3300009176 | Bacteria | 923 |
| 182 | Ga0105248_10797356 | 3300009177 | Unclassified | 1066 |
| 183 | Ga0105237_10917324 | 3300009545 | Bacteria | 883 |
| 184 | Ga0105238_10149293 | 3300009551 | Bacteria | 2313 |
| 185 | Ga0105238_11304333 | 3300009551 | Bacteria | 752 |
| 186 | Ga0105238_11304335 | 3300009551 | Bacteria | 752 |
| 187 | Ga0105249_10249872 | 3300009553 | Bacteria | 1758 |
| 188 | Ga0105249_11967813 | 3300009553 | Unclassified | 657 |
| 189 | Ga0099796_10080203 | 3300010159 | Bacteria | 1195 |
| 190 | Ga0105239_11672622 | 3300010375 | Unclassified | 736 |
| 191 | Ga0105246_10011576 | 3300011119 | Bacteria | 5475 |
| 192 | Ga0105246_10523851 | 3300011119 | Unclassified | 1011 |
| 193 | Ga0157342_1009931 | 3300012507 | Bacteria | 965 |
| 194 | Ga0157373_10092891 | 3300013100 | Bacteria | 2125 |
| 195 | Ga0157371_10181709 | 3300013102 | Bacteria | 1504 |
| 196 | Ga0157370_10122936 | 3300013104 | Bacteria | 2423 |
| 197 | Ga0157370_10268413 | 3300013104 | Bacteria | 1577 |
| 198 | Ga0157370_11142876 | 3300013104 | Bacteria | 703 |
| 199 | Ga0157369_10659842 | 3300013105 | Unclassified | 1078 |
| 200 | Ga0157369_10668021 | 3300013105 | Bacteria | 1071 |
| 201 | Ga0157369_11136163 | 3300013105 | Bacteria | 798 |
| 202 | Ga0157369_11204219 | 3300013105 | Bacteria | 773 |
| 203 | Ga0157369_11747414 | 3300013105 | Bacteria | 632 |
| 204 | Ga0157374_10448039 | 3300013296 | Bacteria | 1292 |
| 205 | Ga0157374_10872999 | 3300013296 | Bacteria | 917 |
| 206 | Ga0157378_10318606 | 3300013297 | Bacteria | 1510 |
| 207 | Ga0157378_11401071 | 3300013297 | Bacteria | 742 |
| 208 | Ga0163162_10616706 | 3300013306 | Bacteria | 1210 |
| 209 | Ga0163162_11470083 | 3300013306 | Unclassified | 776 |
| 210 | Ga0163162_11744644 | 3300013306 | Unclassified | 711 |
| 211 | Ga0157372_10393051 | 3300013307 | Bacteria | 1616 |
| 212 | Ga0157372_10635203 | 3300013307 | Unclassified | 1244 |
| 213 | Ga0157372_11226822 | 3300013307 | Unclassified | 866 |
| 214 | Ga0157372_12353686 | 3300013307 | Unclassified | 612 |
| 215 | Ga0157375_12038382 | 3300013308 | Unclassified | 682 |
| 216 | Ga0157375_12065253 | 3300013308 | Unclassified | 678 |
| 217 | Ga0163163_10361023 | 3300014325 | Bacteria | 1509 |
| 218 | Ga0157377_10644064 | 3300014745 | Bacteria | 762 |
| 219 | Ga0157379_10591307 | 3300014968 | Bacteria | 1035 |
| 220 | Ga0157379_10728805 | 3300014968 | Bacteria | 932 |
| 221 | Ga0157379_11971263 | 3300014968 | Bacteria | 576 |
| 222 | Ga0157376_11360918 | 3300014969 | Bacteria | 741 |
| 223 | Ga0197907_10032160 | 3300020069 | Bacteria | 1453 |
| 224 | Ga0197907_10861133 | 3300020069 | Bacteria | 1175 |
| 225 | Ga0197907_10924303 | 3300020069 | Bacteria | 1493 |
| 226 | Ga0206356_10039166 | 3300020070 | Unclassified | 844 |
| 227 | Ga0206356_11395269 | 3300020070 | Bacteria | 597 |
| 228 | Ga0206349_1814736 | 3300020075 | Bacteria | 900 |
| 229 | Ga0206355_1681200 | 3300020076 | Unclassified | 704 |
| 230 | Ga0206351_10213855 | 3300020077 | Unclassified | 758 |
| 231 | Ga0206351_10244370 | 3300020077 | Bacteria | 504 |
| 232 | Ga0206352_10526204 | 3300020078 | Bacteria | 540 |
| 233 | Ga0206352_11106613 | 3300020078 | Bacteria | 610 |
| 234 | Ga0206352_11335809 | 3300020078 | Bacteria | 668 |
| 235 | Ga0206350_10136229 | 3300020080 | Bacteria | 1124 |
| 236 | Ga0206350_11119363 | 3300020080 | Unclassified | 740 |
| 237 | Ga0206350_11310291 | 3300020080 | Bacteria | 743 |
| 238 | Ga0206350_11351073 | 3300020080 | Bacteria | 956 |
| 239 | Ga0206354_10541864 | 3300020081 | Bacteria | 773 |
| 240 | Ga0206354_11573652 | 3300020081 | Bacteria | 1621 |
| 241 | Ga0206353_10209463 | 3300020082 | Bacteria | 705 |
| 242 | Ga0206353_11391335 | 3300020082 | Bacteria | 2815 |
| 243 | Ga0154015_1066765 | 3300020610 | Unclassified | 627 |
| 244 | Ga0213875_10000312 | 3300021388 | Bacteria | 46369 |
| 245 | Ga0213875_10004119 | 3300021388 | Bacteria | 8061 |
| 246 | Ga0224712_10300427 | 3300022467 | Unclassified | 751 |
| 247 | Ga0224712_10521254 | 3300022467 | Bacteria | 576 |
| 248 | Ga0207656_10412629 | 3300025321 | Unclassified | 680 |
| 249 | Ga0207653_10133864 | 3300025885 | Bacteria | 902 |
| 250 | Ga0207653_10373377 | 3300025885 | Bacteria | 558 |
| 251 | Ga0207692_10001693 | 3300025898 | Bacteria | 8328 |
| 252 | Ga0207692_10040840 | 3300025898 | Bacteria | 2292 |
| 253 | Ga0207692_10069804 | 3300025898 | Bacteria | 1847 |
| 254 | Ga0207692_10211134 | 3300025898 | Bacteria | 1146 |
| 255 | Ga0207692_10325830 | 3300025898 | Unclassified | 941 |
| 256 | Ga0207692_10754394 | 3300025898 | Bacteria | 634 |
| 257 | Ga0207692_11014266 | 3300025898 | Bacteria | 548 |
| 258 | Ga0207710_10358472 | 3300025900 | Bacteria | 744 |
| 259 | Ga0207710_10446397 | 3300025900 | Bacteria | 667 |
| 260 | Ga0207688_10246000 | 3300025901 | Bacteria | 1082 |
| 261 | Ga0207680_10895081 | 3300025903 | Unclassified | 636 |
| 262 | Ga0207647_10066847 | 3300025904 | Bacteria | 2179 |
| 263 | Ga0207685_10000213 | 3300025905 | Bacteria | 8954 |
| 264 | Ga0207685_10248683 | 3300025905 | Unclassified | 859 |
| 265 | Ga0207699_10004260 | 3300025906 | Bacteria | 6841 |
| 266 | Ga0207699_10020249 | 3300025906 | Bacteria | 3561 |
| 267 | Ga0207699_10055907 | 3300025906 | Bacteria | 2350 |
| 268 | Ga0207699_10140995 | 3300025906 | Unclassified | 1584 |
| 269 | Ga0207699_10515578 | 3300025906 | Unclassified | 864 |
| 270 | Ga0207684_10042592 | 3300025910 | Bacteria | 3849 |
| 271 | Ga0207684_10064256 | 3300025910 | Bacteria | 3116 |
| 272 | Ga0207684_10174450 | 3300025910 | Bacteria | 1853 |
| 273 | Ga0207684_10391147 | 3300025910 | Bacteria | 1195 |
| 274 | Ga0207654_10203593 | 3300025911 | Bacteria | 1305 |
| 275 | Ga0207707_10465904 | 3300025912 | Unclassified | 1080 |
| 276 | Ga0207695_10534452 | 3300025913 | Bacteria | 1054 |
| 277 | Ga0207671_10597283 | 3300025914 | Unclassified | 880 |
| 278 | Ga0207693_10485565 | 3300025915 | Unclassified | 965 |
| 279 | Ga0207693_10579703 | 3300025915 | Bacteria | 874 |
| 280 | Ga0207693_10666239 | 3300025915 | Bacteria | 808 |
| 281 | Ga0207693_10829362 | 3300025915 | Unclassified | 712 |
| 282 | Ga0207663_10001922 | 3300025916 | Bacteria | 9839 |
| 283 | Ga0207663_10126743 | 3300025916 | Bacteria | 1757 |
| 284 | Ga0207663_10281209 | 3300025916 | Bacteria | 1236 |
| 285 | Ga0207663_10357438 | 3300025916 | Bacteria | 1107 |
| 286 | Ga0207663_10829456 | 3300025916 | Bacteria | 737 |
| 287 | Ga0207663_11148745 | 3300025916 | Unclassified | 625 |
| 288 | Ga0207660_10177213 | 3300025917 | Bacteria | 1654 |
| 289 | Ga0207660_10292633 | 3300025917 | Bacteria | 1295 |
| 290 | Ga0207660_10423097 | 3300025917 | Bacteria | 1075 |
| 291 | Ga0207662_10054165 | 3300025918 | Bacteria | 2391 |
| 292 | Ga0207657_10009522 | 3300025919 | Bacteria | 9756 |
| 293 | Ga0207657_10058280 | 3300025919 | Bacteria | 3324 |
| 294 | Ga0207649_10053478 | 3300025920 | Bacteria | 2509 |
| 295 | Ga0207652_10069883 | 3300025921 | Bacteria | 3049 |
| 296 | Ga0207652_11877724 | 3300025921 | Unclassified | 504 |
| 297 | Ga0207646_10015499 | 3300025922 | Bacteria | 7197 |
| 298 | Ga0207646_10049954 | 3300025922 | Bacteria | 3744 |
| 299 | Ga0207646_10196833 | 3300025922 | Bacteria | 1820 |
| 300 | Ga0207646_10467288 | 3300025922 | Bacteria | 1138 |
| 301 | Ga0207646_10646855 | 3300025922 | Bacteria | 947 |
| 302 | Ga0207694_10670273 | 3300025924 | Bacteria | 874 |
| 303 | Ga0207694_10736727 | 3300025924 | Bacteria | 832 |
| 304 | Ga0207659_10150235 | 3300025926 | Bacteria | 1818 |
| 305 | Ga0207659_11099803 | 3300025926 | Bacteria | 684 |
| 306 | Ga0207687_10361043 | 3300025927 | Bacteria | 1186 |
| 307 | Ga0207700_10007608 | 3300025928 | Bacteria | 6644 |
| 308 | Ga0207700_10011082 | 3300025928 | Bacteria | 5732 |
| 309 | Ga0207700_10028774 | 3300025928 | Bacteria | 3913 |
| 310 | Ga0207700_10053874 | 3300025928 | Bacteria | 3016 |
| 311 | Ga0207700_10085135 | 3300025928 | Bacteria | 2480 |
| 312 | Ga0207700_10187131 | 3300025928 | Bacteria | 1738 |
| 313 | Ga0207700_10230825 | 3300025928 | Bacteria | 1573 |
| 314 | Ga0207700_10239984 | 3300025928 | Bacteria | 1544 |
| 315 | Ga0207700_11246577 | 3300025928 | Bacteria | 663 |
| 316 | Ga0207664_10039123 | 3300025929 | Bacteria | 3681 |
| 317 | Ga0207664_10089946 | 3300025929 | Bacteria | 2515 |
| 318 | Ga0207664_10112691 | 3300025929 | Bacteria | 2264 |
| 319 | Ga0207664_10119876 | 3300025929 | Bacteria | 2200 |
| 320 | Ga0207664_10147936 | 3300025929 | Bacteria | 1993 |
| 321 | Ga0207664_10187820 | 3300025929 | Bacteria | 1777 |
| 322 | Ga0207664_10203924 | 3300025929 | Bacteria | 1708 |
| 323 | Ga0207664_10392896 | 3300025929 | Bacteria | 1233 |
| 324 | Ga0207644_10785168 | 3300025931 | Bacteria | 796 |
| 325 | Ga0207644_10966538 | 3300025931 | Bacteria | 714 |
| 326 | Ga0207690_10275050 | 3300025932 | Bacteria | 1310 |
| 327 | Ga0207706_10079698 | 3300025933 | Bacteria | 2879 |
| 328 | Ga0207686_10427430 | 3300025934 | Bacteria | 1014 |
| 329 | Ga0207670_11479671 | 3300025936 | Bacteria | 577 |
| 330 | Ga0207669_10835396 | 3300025937 | Bacteria | 766 |
| 331 | Ga0207704_10441898 | 3300025938 | Bacteria | 1036 |
| 332 | Ga0207665_10011289 | 3300025939 | Bacteria | 5862 |
| 333 | Ga0207665_10441729 | 3300025939 | Bacteria | 997 |
| 334 | Ga0207665_10824288 | 3300025939 | Unclassified | 734 |
| 335 | Ga0207665_11124624 | 3300025939 | Unclassified | 626 |
| 336 | Ga0207691_11002390 | 3300025940 | Bacteria | 697 |
| 337 | Ga0207689_10067729 | 3300025942 | Bacteria | 2934 |
| 338 | Ga0207661_10021010 | 3300025944 | Bacteria | 4888 |
| 339 | Ga0207661_10090467 | 3300025944 | Bacteria | 2548 |
| 340 | Ga0207661_10188507 | 3300025944 | Bacteria | 1807 |
| 341 | Ga0207661_11123924 | 3300025944 | Bacteria | 723 |
| 342 | Ga0207661_11187068 | 3300025944 | Bacteria | 702 |
| 343 | Ga0207679_10659019 | 3300025945 | Bacteria | 947 |
| 344 | Ga0207667_11133427 | 3300025949 | Bacteria | 764 |
| 345 | Ga0207712_11083251 | 3300025961 | Bacteria | 713 |
| 346 | Ga0207668_10958664 | 3300025972 | Bacteria | 763 |
| 347 | Ga0207668_11136578 | 3300025972 | Bacteria | 701 |
| 348 | Ga0207640_10613787 | 3300025981 | Unclassified | 922 |
| 349 | Ga0207677_11417353 | 3300026023 | Unclassified | 640 |
| 350 | Ga0207703_11039607 | 3300026035 | Unclassified | 786 |
| 351 | Ga0207678_10013839 | 3300026067 | Bacteria | 7088 |
| 352 | Ga0207678_10100422 | 3300026067 | Bacteria | 2472 |
| 353 | Ga0207678_10397255 | 3300026067 | Bacteria | 1193 |
| 354 | Ga0207708_10307659 | 3300026075 | Bacteria | 1290 |
| 355 | Ga0207702_10241806 | 3300026078 | Bacteria | 1691 |
| 356 | Ga0207702_10715297 | 3300026078 | Unclassified | 987 |
| 357 | Ga0207702_12103158 | 3300026078 | Bacteria | 554 |
| 358 | Ga0207702_12425335 | 3300026078 | Unclassified | 511 |
| 359 | Ga0207641_10444188 | 3300026088 | Bacteria | 1252 |
| 360 | Ga0207676_11560025 | 3300026095 | Bacteria | 658 |
| 361 | Ga0207674_10097284 | 3300026116 | Bacteria | 2927 |
| 362 | Ga0207674_10119813 | 3300026116 | Bacteria | 2600 |
| 363 | Ga0207674_10124222 | 3300026116 | Bacteria | 2547 |
| 364 | Ga0207674_11314288 | 3300026116 | Unclassified | 692 |
| 365 | Ga0207675_100052218 | 3300026118 | Bacteria | 3815 |
| 366 | Ga0207675_100456499 | 3300026118 | Bacteria | 1267 |
| 367 | Ga0207683_11546339 | 3300026121 | Bacteria | 612 |
| 368 | Ga0207683_11566398 | 3300026121 | Bacteria | 608 |
| 369 | Ga0207698_10621326 | 3300026142 | Bacteria | 1067 |
| 370 | Ga0207698_11351965 | 3300026142 | Unclassified | 727 |
| 371 | Ga0207698_11946099 | 3300026142 | Bacteria | 602 |
| 372 | Ga0207428_10674306 | 3300027907 | Unclassified | 741 |
| 373 | Ga0265357_1001605 | 3300028023 | Bacteria | 1698 |
| 374 | Ga0268266_10084515 | 3300028379 | Bacteria | 2772 |
| 375 | Ga0268264_11863866 | 3300028381 | Bacteria | 611 |
| 376 | Ga0265322_10040260 | 3300028654 | Bacteria | 1330 |
| 377 | Ga0265338_10001197 | 3300028800 | Bacteria | 42864 |
| 378 | Ga0265338_10311204 | 3300028800 | Bacteria | 1142 |
| 379 | Ga0265762_1013027 | 3300030760 | Bacteria | 1496 |
| 380 | Ga0265763_1000424 | 3300030763 | Bacteria | 2510 |
| 381 | Ga0265764_100491 | 3300030882 | Unclassified | 1498 |
| 382 | Ga0265320_10210696 | 3300031240 | Bacteria | 866 |
| 383 | Ga0265325_10147857 | 3300031241 | Bacteria | 1113 |
| 384 | Ga0373948_0024187 | 3300034817 | Bacteria | 1184 |
| 385 | Ga0373948_0031650 | 3300034817 | Bacteria | 1070 |
| 386 | Ga0373938_0010587 | 3300034957 | Bacteria | 1699 |
| 387 | Ga0373938_0203447 | 3300034957 | Bacteria | 549 |
| 388 | Ga0373926_0189688 | 3300035083 | Bacteria | 789 |
| 389 | Ga0373934_0000178 | 3300035086 | Bacteria | 23259 |
| 390 | Ga0373934_0000453 | 3300035086 | Bacteria | 14355 |
| 391 | Ga0373934_0043283 | 3300035086 | Bacteria | 1780 |
| 392 | Ga0373934_0092380 | 3300035086 | Bacteria | 1220 |
| 393 | Ga0373934_0117000 | 3300035086 | Bacteria | 1083 |
| 394 | Ga0373934_0148985 | 3300035086 | Bacteria | 958 |
| 395 | Ga0373940_0069726 | 3300035088 | Unclassified | 1021 |
| 396 | Ga0373940_0073419 | 3300035088 | Unclassified | 1000 |
| 397 | Ga0373940_0194261 | 3300035088 | Unclassified | 665 |
| 398 | Ga0373949_0013622 | 3300035090 | Bacteria | 1805 |
| 399 | Ga0373949_0016761 | 3300035090 | Bacteria | 1645 |
| 400 | Ga0373951_0010086 | 3300035091 | Bacteria | 2120 |
| 401 | Ga0373952_0102240 | 3300035092 | Bacteria | 757 |
| 402 | Ga0373923_0004236 | 3300035111 | Bacteria | 4736 |
| 403 | Ga0373923_0056622 | 3300035111 | Bacteria | 1656 |
| 404 | Ga0373923_0136030 | 3300035111 | Bacteria | 1108 |
| 405 | Ga0373923_0179470 | 3300035111 | Bacteria | 972 |
| 406 | Ga0373923_0313732 | 3300035111 | Bacteria | 744 |
| 407 | Ga0373923_0316615 | 3300035111 | Bacteria | 740 |
| 408 | Ga0373923_0394451 | 3300035111 | Unclassified | 665 |
| 409 | Ga0373923_0480089 | 3300035111 | Unclassified | 605 |
| 410 | Ga0373923_0564858 | 3300035111 | Bacteria | 558 |
| 411 | Ga0373936_0004218 | 3300035113 | Bacteria | 5422 |
| 412 | Ga0373936_0110775 | 3300035113 | Bacteria | 1165 |
| 413 | Ga0373936_0246688 | 3300035113 | Bacteria | 797 |
| 414 | Ga0373936_0252938 | 3300035113 | Bacteria | 787 |
| 415 | Ga0373939_0071112 | 3300035114 | Bacteria | 1133 |
| 416 | Ga0373939_0327359 | 3300035114 | Bacteria | 618 |
| 417 | Ga0373941_0006980 | 3300035115 | Unclassified | 2744 |
| 418 | Ga0373941_0120095 | 3300035115 | Bacteria | 936 |
| 419 | Ga0373945_0029669 | 3300035116 | Bacteria | 1923 |
| 420 | Ga0373953_0000084 | 3300035117 | Bacteria | 22481 |
| 421 | Ga0373953_0000923 | 3300035117 | Bacteria | 8227 |
| 422 | Ga0373953_0031819 | 3300035117 | Bacteria | 2054 |
| 423 | Ga0373953_0098302 | 3300035117 | Bacteria | 1230 |
| 424 | Ga0373953_0133458 | 3300035117 | Bacteria | 1059 |
| 425 | Ga0373953_0167413 | 3300035117 | Bacteria | 946 |
| 426 | Ga0373953_0355166 | 3300035117 | Bacteria | 642 |
| 427 | Ga0373954_0003839 | 3300035118 | Bacteria | 6426 |
| 428 | Ga0373954_0011646 | 3300035118 | Unclassified | 3902 |
| 429 | Ga0373954_0019992 | 3300035118 | Bacteria | 3023 |
| 430 | Ga0373954_0041490 | 3300035118 | Bacteria | 2146 |
| 431 | Ga0373954_0532331 | 3300035118 | Unclassified | 582 |
| 432 | Ga0373956_0000007 | 3300035119 | Bacteria | 63448 |
| 433 | Ga0373956_0002523 | 3300035119 | Bacteria | 7452 |
| 434 | Ga0373956_0026014 | 3300035119 | Bacteria | 2533 |
| 435 | Ga0373956_0056883 | 3300035119 | Bacteria | 1766 |
| 436 | Ga0373956_0062845 | 3300035119 | Bacteria | 1683 |
| 437 | Ga0373956_0160706 | 3300035119 | Bacteria | 1058 |
| 438 | Ga0373956_0338483 | 3300035119 | Bacteria | 717 |
| 439 | Ga0373957_0000024 | 3300035120 | Bacteria | 39141 |
| 440 | Ga0373957_0000702 | 3300035120 | Bacteria | 8677 |
| 441 | Ga0373957_0000994 | 3300035120 | Bacteria | 7461 |
| 442 | Ga0373957_0048228 | 3300035120 | Bacteria | 1622 |
| 443 | Ga0373957_0105863 | 3300035120 | Bacteria | 1129 |
| 444 | Ga0373957_0343265 | 3300035120 | Bacteria | 637 |
| 445 | Ga0373957_0460855 | 3300035120 | Unclassified | 551 |
| 446 | Ga0373960_0115475 | 3300035121 | Bacteria | 885 |
| 447 | Ga0373943_0788562 | 3300035170 | Unclassified | 565 |
| 448 | Ga0373946_0162184 | 3300035171 | Bacteria | 1050 |
| 449 | Ga0373946_0213227 | 3300035171 | Bacteria | 930 |
| 450 | Ga0373955_0000007 | 3300035172 | Bacteria | 87917 |
| 451 | Ga0373955_0000515 | 3300035172 | Bacteria | 16465 |
| 452 | Ga0373955_0008335 | 3300035172 | Bacteria | 4810 |
| 453 | Ga0373955_0022057 | 3300035172 | Bacteria | 3224 |
| 454 | Ga0373955_0066861 | 3300035172 | Bacteria | 1999 |
| 455 | Ga0373955_0127993 | 3300035172 | Bacteria | 1480 |
| 456 | Ga0373955_0206105 | 3300035172 | Bacteria | 1171 |
| 457 | Ga0373955_0262269 | 3300035172 | Bacteria | 1037 |
| 458 | Ga0373942_0047809 | 3300035207 | Bacteria | 1190 |
| 459 | Ga0373961_0029012 | 3300035241 | Bacteria | 1530 |
| 460 | Ga0373961_0160668 | 3300035241 | Bacteria | 771 |
| 461 | Ga0373962_0009476 | 3300035242 | Bacteria | 2414 |
| 462 | Ga0373924_0000549 | 3300035410 | Bacteria | 11538 |
| 463 | Ga0373924_0003234 | 3300035410 | Bacteria | 5572 |
| 464 | Ga0373924_0005522 | 3300035410 | Bacteria | 4483 |
| 465 | Ga0373924_0008042 | 3300035410 | Bacteria | 3818 |
| 466 | Ga0373924_0021111 | 3300035410 | Bacteria | 2538 |
| 467 | Ga0373924_0044440 | 3300035410 | Bacteria | 1825 |
| 468 | Ga0373924_0099290 | 3300035410 | Bacteria | 1251 |
| 469 | Ga0373924_0335527 | 3300035410 | Unclassified | 673 |
| 470 | Ga0373931_0007289 | 3300035691 | Bacteria | 5203 |
| 471 | Ga0373931_0588235 | 3300035691 | Unclassified | 726 |
| 472 | Ga0373935_0042315 | 3300035692 | Unclassified | 2864 |
| 473 | Ga0373935_0058944 | 3300035692 | Bacteria | 2453 |
| 474 | Ga0373935_0102985 | 3300035692 | Bacteria | 1884 |
| 475 | Ga0373935_0129031 | 3300035692 | Bacteria | 1697 |
| 476 | Ga0373935_0227928 | 3300035692 | Bacteria | 1296 |
| 477 | Ga0373935_0232599 | 3300035692 | Bacteria | 1284 |
| 478 | Ga0373935_0357506 | 3300035692 | Unclassified | 1042 |
| 479 | Ga0373935_0792642 | 3300035692 | Unclassified | 699 |
| 480 | Ga0373935_1025005 | 3300035692 | Bacteria | 613 |
| 481 | Ga0373927_0040668 | 3300035695 | Bacteria | 3016 |
| 482 | Ga0373933_0000002 | 3300035724 | Bacteria | 151785 |
| 483 | Ga0373933_0000507 | 3300035724 | Bacteria | 24320 |
| 484 | Ga0373933_0010125 | 3300035724 | Bacteria | 5162 |
| 485 | Ga0373933_0016037 | 3300035724 | Bacteria | 4185 |
| 486 | Ga0373933_0023500 | 3300035724 | Bacteria | 3522 |
| 487 | Ga0373933_0042757 | 3300035724 | Bacteria | 2678 |
| 488 | Ga0373933_0099864 | 3300035724 | Bacteria | 1799 |
| 489 | Ga0373933_0187527 | 3300035724 | Bacteria | 1320 |
| 490 | Ga0373933_0354340 | 3300035724 | Bacteria | 953 |
| 491 | Ga0373933_0377478 | 3300035724 | Bacteria | 923 |
| 492 | Ga0373933_0555170 | 3300035724 | Unclassified | 753 |
| 493 | Ga0373947_0045765 | 3300035725 | Bacteria | 2619 |
| 494 | Ga0373947_0580152 | 3300035725 | Bacteria | 764 |
| 495 | Ga0373947_0613926 | 3300035725 | Bacteria | 741 |
| 496 | Ga0310104_02245 | 3300036242 | Bacteria | 1649 |
| 497 | Ga0373937_0000014 | 3300036401 | Bacteria | 151785 |
| 498 | Ga0373937_0001460 | 3300036401 | Bacteria | 19784 |
| 499 | Ga0373937_0045905 | 3300036401 | Bacteria | 3993 |
| 500 | Ga0373937_0047413 | 3300036401 | Bacteria | 3931 |
| 501 | Ga0373937_0129547 | 3300036401 | Bacteria | 2356 |
| 502 | Ga0373937_0164171 | 3300036401 | Bacteria | 2082 |
| 503 | Ga0373937_0211646 | 3300036401 | Unclassified | 1824 |
| 504 | Ga0373937_0241320 | 3300036401 | Bacteria | 1702 |
| 505 | Ga0373937_0251406 | 3300036401 | Bacteria | 1666 |
| 506 | Ga0373937_0314424 | 3300036401 | Bacteria | 1481 |
| 507 | Ga0373937_0472999 | 3300036401 | Bacteria | 1190 |
| 508 | Ga0373937_1277377 | 3300036401 | Bacteria | 682 |
| 509 | Ga0265778_005647 | 3300036457 | Unclassified | 1328 |
| 510 | Ga0265778_061930 | 3300036457 | Unclassified | 524 |
| 511 | Ga0373925_0000373 | 3300037068 | Bacteria | 46652 |
| 512 | Ga0373925_0001704 | 3300037068 | Bacteria | 18516 |
| 513 | Ga0373925_0014582 | 3300037068 | Bacteria | 5679 |
| 514 | Ga0373925_0020188 | 3300037068 | Bacteria | 4849 |
| 515 | Ga0373925_0044387 | 3300037068 | Bacteria | 3300 |
| 516 | Ga0373925_0068135 | 3300037068 | Bacteria | 2685 |
| 517 | Ga0373925_0227508 | 3300037068 | Bacteria | 1490 |
| 518 | Ga0373925_1148892 | 3300037068 | Unclassified | 638 |
| 519 | Ga0395898_0128858 | 3300037466 | Bacteria | 2424 |
| 520 | Ga0395898_0771912 | 3300037466 | Bacteria | 902 |
| 521 | Ga0436364_0037108 | 3300037853 | Bacteria | 71393 |
| 522 | Ga0436364_0787453 | 3300037853 | Bacteria | 1290 |
| 523 | Ga0436364_1101267 | 3300037853 | Bacteria | 67281 |
| 524 | Ga0466963_0051020 | 3300044694 | Bacteria | 2741 |
| 525 | Ga0466958_0236814 | 3300045836 | Bacteria | 1166 |
| 526 | Ga0466967_0093023 | 3300045976 | Bacteria | 2743 |
| 527 | Ga0495592_0000077 | 3300046454 | Bacteria | 85837 |
| 528 | Ga0495592_0002671 | 3300046454 | Bacteria | 12603 |
| 529 | Ga0495592_0004469 | 3300046454 | Bacteria | 10228 |
| 530 | Ga0495592_0019917 | 3300046454 | Bacteria | 5101 |
| 531 | Ga0495592_0111874 | 3300046454 | Bacteria | 1931 |
| 532 | Ga0495592_0207603 | 3300046454 | Bacteria | 1317 |
| 533 | Ga0495592_0218829 | 3300046454 | Bacteria | 1274 |
| 534 | Ga0495592_0328586 | 3300046454 | Bacteria | 986 |
| 535 | Ga0495592_0811343 | 3300046454 | Bacteria | 555 |
| 536 | Ga0495592_0837131 | 3300046454 | Unclassified | 544 |
| 537 | Ga0495603_0015082 | 3300046455 | Bacteria | 4674 |
| 538 | Ga0495629_0001557 | 3300046459 | Bacteria | 18015 |
| 539 | Ga0495629_0003864 | 3300046459 | Bacteria | 11294 |
| 540 | Ga0495629_0095977 | 3300046459 | Unclassified | 2068 |
| 541 | Ga0495641_0004654 | 3300046461 | Bacteria | 9591 |
| 542 | Ga0495641_0446907 | 3300046461 | Unclassified | 588 |
| 543 | Ga0495651_0000019 | 3300046462 | Bacteria | 120970 |
| 544 | Ga0495651_0000798 | 3300046462 | Bacteria | 24389 |
| 545 | Ga0495651_0002496 | 3300046462 | Bacteria | 14228 |
| 546 | Ga0495651_0010232 | 3300046462 | Bacteria | 7200 |
| 547 | Ga0495651_0011292 | 3300046462 | Bacteria | 6864 |
| 548 | Ga0495651_0027504 | 3300046462 | Bacteria | 4429 |
| 549 | Ga0495651_0087391 | 3300046462 | Bacteria | 2344 |
| 550 | Ga0495651_0099790 | 3300046462 | Bacteria | 2164 |
| 551 | Ga0495651_0345108 | 3300046462 | Bacteria | 985 |
| 552 | Ga0495651_0626085 | 3300046462 | Unclassified | 677 |
| 553 | Ga0495653_0000252 | 3300046463 | Bacteria | 42994 |
| 554 | Ga0495653_0003377 | 3300046463 | Bacteria | 12834 |
| 555 | Ga0495653_0004643 | 3300046463 | Bacteria | 11110 |
| 556 | Ga0495653_0008354 | 3300046463 | Bacteria | 8485 |
| 557 | Ga0495653_0010757 | 3300046463 | Bacteria | 7492 |
| 558 | Ga0495653_0017464 | 3300046463 | Bacteria | 5834 |
| 559 | Ga0495653_0039019 | 3300046463 | Bacteria | 3723 |
| 560 | Ga0495653_0117177 | 3300046463 | Bacteria | 1903 |
| 561 | Ga0495653_0165935 | 3300046463 | Bacteria | 1528 |
| 562 | Ga0495653_0303146 | 3300046463 | Bacteria | 1041 |
| 563 | Ga0495653_0517388 | 3300046463 | Unclassified | 742 |
| 564 | Ga0495653_0570295 | 3300046463 | Unclassified | 698 |
| 565 | Ga0495580_0009989 | 3300046472 | Bacteria | 7421 |
| 566 | Ga0495580_0353633 | 3300046472 | Bacteria | 995 |
| 567 | Ga0495582_0003757 | 3300046473 | Bacteria | 8560 |
| 568 | Ga0495582_0008905 | 3300046473 | Bacteria | 5538 |
| 569 | Ga0495582_0052093 | 3300046473 | Bacteria | 2257 |
| 570 | Ga0495639_0023727 | 3300046475 | Bacteria | 2697 |
| 571 | Ga0495662_0015519 | 3300046476 | Bacteria | 3697 |
| 572 | Ga0495662_0038680 | 3300046476 | Bacteria | 2306 |
| 573 | Ga0495662_0187277 | 3300046476 | Bacteria | 1020 |
| 574 | Ga0495664_0013599 | 3300046477 | Bacteria | 4615 |
| 575 | Ga0495664_0027093 | 3300046477 | Bacteria | 3341 |
| 576 | Ga0495664_0059757 | 3300046477 | Unclassified | 2269 |
| 577 | Ga0495664_0110325 | 3300046477 | Bacteria | 1660 |
| 578 | Ga0495664_0181731 | 3300046477 | Bacteria | 1275 |
| 579 | Ga0495664_0216956 | 3300046477 | Bacteria | 1158 |
| 580 | Ga0495664_0241888 | 3300046477 | Archaea | 1092 |
| 581 | Ga0495664_0263247 | 3300046477 | Bacteria | 1042 |
| 582 | Ga0495664_0526357 | 3300046477 | Bacteria | 705 |
| 583 | Ga0495594_0058118 | 3300046499 | Bacteria | 2136 |
| 584 | Ga0495608_0000028 | 3300046511 | Bacteria | 151829 |
| 585 | Ga0495608_0000630 | 3300046511 | Bacteria | 24324 |
| 586 | Ga0495608_0001073 | 3300046511 | Bacteria | 19281 |
| 587 | Ga0495608_0030352 | 3300046511 | Bacteria | 3660 |
| 588 | Ga0495608_0071331 | 3300046511 | Unclassified | 2266 |
| 589 | Ga0495608_0120100 | 3300046511 | Bacteria | 1686 |
| 590 | Ga0495608_0151698 | 3300046511 | Bacteria | 1477 |
| 591 | Ga0495608_0292448 | 3300046511 | Bacteria | 1009 |
| 592 | Ga0495618_0006927 | 3300046514 | Bacteria | 6867 |
| 593 | Ga0495618_0069043 | 3300046514 | Unclassified | 2247 |
| 594 | Ga0495618_0139021 | 3300046514 | Bacteria | 1553 |
| 595 | Ga0495618_0210974 | 3300046514 | Bacteria | 1227 |
| 596 | Ga0495618_0242575 | 3300046514 | Bacteria | 1132 |
| 597 | Ga0495618_0265639 | 3300046514 | Bacteria | 1073 |
| 598 | Ga0495618_0297745 | 3300046514 | Bacteria | 1003 |
| 599 | Ga0495628_0000337 | 3300046516 | Bacteria | 42541 |
| 600 | Ga0495628_0001397 | 3300046516 | Bacteria | 22153 |
| 601 | Ga0495628_0002940 | 3300046516 | Bacteria | 15281 |
| 602 | Ga0495628_0007939 | 3300046516 | Bacteria | 9142 |
| 603 | Ga0495628_0025055 | 3300046516 | Bacteria | 4877 |
| 604 | Ga0495628_0073798 | 3300046516 | Bacteria | 2658 |
| 605 | Ga0495628_0080452 | 3300046516 | Bacteria | 2532 |
| 606 | Ga0495628_0176967 | 3300046516 | Bacteria | 1615 |
| 607 | Ga0495628_0221717 | 3300046516 | Bacteria | 1420 |
| 608 | Ga0495628_0240418 | 3300046516 | Bacteria | 1354 |
| 609 | Ga0495628_0479676 | 3300046516 | Bacteria | 900 |
| 610 | Ga0495628_0797776 | 3300046516 | Bacteria | 661 |
| 611 | Ga0495630_0015723 | 3300046517 | Bacteria | 5529 |
| 612 | Ga0495630_0017241 | 3300046517 | Bacteria | 5289 |
| 613 | Ga0495630_0018016 | 3300046517 | Bacteria | 5181 |
| 614 | Ga0495630_0082836 | 3300046517 | Bacteria | 2421 |
| 615 | Ga0495630_0364152 | 3300046517 | Bacteria | 1107 |
| 616 | Ga0495630_0871694 | 3300046517 | Bacteria | 686 |
| 617 | Ga0495630_0891594 | 3300046517 | Bacteria | 678 |
| 618 | Ga0495630_1313459 | 3300046517 | Unclassified | 545 |
| 619 | Ga0495630_1333270 | 3300046517 | Bacteria | 540 |
| 620 | Ga0495666_0404550 | 3300046526 | Bacteria | 613 |
| 621 | Ga0495652_0000031 | 3300046529 | Bacteria | 151765 |
| 622 | Ga0495652_0003271 | 3300046529 | Bacteria | 16138 |
| 623 | Ga0495652_0003576 | 3300046529 | Bacteria | 15253 |
| 624 | Ga0495652_0007308 | 3300046529 | Bacteria | 10187 |
| 625 | Ga0495652_0112765 | 3300046529 | Bacteria | 2184 |
| 626 | Ga0495652_0137619 | 3300046529 | Bacteria | 1924 |
| 627 | Ga0495652_0158058 | 3300046529 | Unclassified | 1763 |
| 628 | Ga0495652_0180700 | 3300046529 | Bacteria | 1619 |
| 629 | Ga0495652_0344535 | 3300046529 | Bacteria | 1069 |
| 630 | Ga0495652_0381455 | 3300046529 | Bacteria | 1002 |
| 631 | Ga0495652_0702169 | 3300046529 | Bacteria | 681 |
| 632 | Ga0495652_0844350 | 3300046529 | Unclassified | 607 |
| 633 | Ga0495665_0007582 | 3300046531 | Bacteria | 5877 |
| 634 | Ga0495665_0009220 | 3300046531 | Bacteria | 5346 |
| 635 | Ga0495665_0171308 | 3300046531 | Bacteria | 1130 |
| 636 | Ga0495665_0424489 | 3300046531 | Bacteria | 673 |
| 637 | Ga0495640_0007314 | 3300046533 | Bacteria | 8692 |
| 638 | Ga0495640_0009138 | 3300046533 | Bacteria | 7737 |
| 639 | Ga0495640_0009834 | 3300046533 | Bacteria | 7423 |
| 640 | Ga0495640_0020499 | 3300046533 | Bacteria | 4865 |
| 641 | Ga0495640_0036929 | 3300046533 | Bacteria | 3449 |
| 642 | Ga0495640_0111789 | 3300046533 | Bacteria | 1784 |
| 643 | Ga0495640_0125737 | 3300046533 | Bacteria | 1663 |
| 644 | Ga0495640_0570823 | 3300046533 | Unclassified | 685 |
| 645 | Ga0495586_0034210 | 3300046535 | Unclassified | 2729 |
| 646 | Ga0495586_0042447 | 3300046535 | Bacteria | 2449 |
| 647 | Ga0495586_0047495 | 3300046535 | Bacteria | 2318 |
| 648 | Ga0495586_0235443 | 3300046535 | Bacteria | 1043 |
| 649 | Ga0495586_0321362 | 3300046535 | Bacteria | 888 |
| 650 | Ga0495586_0461387 | 3300046535 | Bacteria | 732 |
| 651 | Ga0495587_0000023 | 3300046536 | Bacteria | 151763 |
| 652 | Ga0495587_0000605 | 3300046536 | Bacteria | 24467 |
| 653 | Ga0495587_0017195 | 3300046536 | Bacteria | 4496 |
| 654 | Ga0495587_0019208 | 3300046536 | Bacteria | 4233 |
| 655 | Ga0495587_0038095 | 3300046536 | Bacteria | 2884 |
| 656 | Ga0495587_0080734 | 3300046536 | Bacteria | 1884 |
| 657 | Ga0495587_0150278 | 3300046536 | Bacteria | 1327 |
| 658 | Ga0495587_0168066 | 3300046536 | Bacteria | 1246 |
| 659 | Ga0495587_0246748 | 3300046536 | Bacteria | 1004 |
| 660 | Ga0495587_0485569 | 3300046536 | Unclassified | 683 |
| 661 | Ga0495645_0001541 | 3300046543 | Bacteria | 15575 |
| 662 | Ga0495645_0165556 | 3300046543 | Bacteria | 1525 |
| 663 | Ga0495645_0167115 | 3300046543 | Bacteria | 1516 |
| 664 | Ga0495645_0200680 | 3300046543 | Bacteria | 1353 |
| 665 | Ga0495645_0275153 | 3300046543 | Bacteria | 1109 |
| 666 | Ga0495645_0358643 | 3300046543 | Bacteria | 937 |
| 667 | Ga0495645_0608445 | 3300046543 | Bacteria | 671 |
| 668 | Ga0495645_0811952 | 3300046543 | Bacteria | 560 |
| 669 | Ga0495667_0000054 | 3300046559 | Bacteria | 105009 |
| 670 | Ga0495667_0000537 | 3300046559 | Bacteria | 24240 |
| 671 | Ga0495667_0001852 | 3300046559 | Bacteria | 14028 |
| 672 | Ga0495667_0006609 | 3300046559 | Bacteria | 7873 |
| 673 | Ga0495667_0014908 | 3300046559 | Bacteria | 5252 |
| 674 | Ga0495667_0025502 | 3300046559 | Bacteria | 3983 |
| 675 | Ga0495667_0030746 | 3300046559 | Bacteria | 3607 |
| 676 | Ga0495667_0176125 | 3300046559 | Bacteria | 1373 |
| 677 | Ga0495667_0249565 | 3300046559 | Bacteria | 1129 |
| 678 | Ga0495667_0433992 | 3300046559 | Bacteria | 826 |
| 679 | Ga0495667_0785427 | 3300046559 | Bacteria | 587 |
| 680 | Ga0495667_0990582 | 3300046559 | Bacteria | 513 |
| 681 | Ga0495634_0007391 | 3300046642 | Bacteria | 8266 |
| 682 | Ga0495634_0047022 | 3300046642 | Bacteria | 2909 |
| 683 | Ga0495634_0073656 | 3300046642 | Bacteria | 2245 |
| 684 | Ga0495634_0253555 | 3300046642 | Bacteria | 1075 |
| 685 | Ga0495634_0575132 | 3300046642 | Bacteria | 655 |
| 686 | Ga0495635_0007332 | 3300046663 | Bacteria | 7697 |
| 687 | Ga0495635_0010898 | 3300046663 | Bacteria | 6373 |
| 688 | Ga0495635_0028679 | 3300046663 | Bacteria | 3869 |
| 689 | Ga0495635_0043166 | 3300046663 | Bacteria | 3111 |
| 690 | Ga0495635_0052383 | 3300046663 | Bacteria | 2812 |
| 691 | Ga0495635_0056438 | 3300046663 | Bacteria | 2703 |
| 692 | Ga0495635_0224288 | 3300046663 | Bacteria | 1270 |
| 693 | Ga0495635_0477239 | 3300046663 | Bacteria | 822 |
| 694 | Ga0495588_0354385 | 3300046674 | Unclassified | 771 |
| 695 | Ga0495588_0698851 | 3300046674 | Unclassified | 530 |
| 696 | Ga0495657_0000022 | 3300046675 | Bacteria | 151837 |
| 697 | Ga0495657_0001623 | 3300046675 | Bacteria | 19291 |
| 698 | Ga0495657_0019891 | 3300046675 | Bacteria | 4837 |
| 699 | Ga0495657_0025659 | 3300046675 | Bacteria | 4182 |
| 700 | Ga0495657_0031326 | 3300046675 | Bacteria | 3717 |
| 701 | Ga0495657_0034083 | 3300046675 | Bacteria | 3539 |
| 702 | Ga0495657_0081932 | 3300046675 | Bacteria | 2086 |
| 703 | Ga0495657_0141062 | 3300046675 | Bacteria | 1502 |
| 704 | Ga0495657_0160676 | 3300046675 | Bacteria | 1390 |
| 705 | Ga0495657_0290507 | 3300046675 | Bacteria | 976 |
| 706 | Ga0495657_0309586 | 3300046675 | Bacteria | 940 |
| 707 | Ga0495599_0000125 | 3300046678 | Bacteria | 50781 |
| 708 | Ga0495599_0000408 | 3300046678 | Bacteria | 24589 |
| 709 | Ga0495599_0000918 | 3300046678 | Bacteria | 16473 |
| 710 | Ga0495599_0068859 | 3300046678 | Bacteria | 2209 |
| 711 | Ga0495599_0139996 | 3300046678 | Bacteria | 1501 |
| 712 | Ga0495599_0227269 | 3300046678 | Bacteria | 1140 |
| 713 | Ga0495599_0270759 | 3300046678 | Bacteria | 1030 |
| 714 | Ga0495599_0342355 | 3300046678 | Bacteria | 897 |
| 715 | Ga0495599_0364063 | 3300046678 | Unclassified | 865 |
| 716 | Ga0495599_0553227 | 3300046678 | Unclassified | 673 |
| 717 | Ga0495623_0000797 | 3300046679 | Bacteria | 21197 |
| 718 | Ga0495623_0003230 | 3300046679 | Bacteria | 10766 |
| 719 | Ga0495623_0021765 | 3300046679 | Bacteria | 4141 |
| 720 | Ga0495623_0044612 | 3300046679 | Bacteria | 2816 |
| 721 | Ga0495623_0078087 | 3300046679 | Bacteria | 2052 |
| 722 | Ga0495623_0220595 | 3300046679 | Bacteria | 1080 |
| 723 | Ga0495646_0011988 | 3300046680 | Bacteria | 5513 |
| 724 | Ga0495646_0013443 | 3300046680 | Bacteria | 5204 |
| 725 | Ga0495646_0018933 | 3300046680 | Bacteria | 4359 |
| 726 | Ga0495646_0019395 | 3300046680 | Bacteria | 4306 |
| 727 | Ga0495646_0028041 | 3300046680 | Bacteria | 3528 |
| 728 | Ga0495646_0040386 | 3300046680 | Bacteria | 2874 |
| 729 | Ga0495646_0373425 | 3300046680 | Bacteria | 744 |
| 730 | Ga0495647_0060509 | 3300046681 | Bacteria | 1493 |
| 731 | Ga0495658_0005016 | 3300046683 | Bacteria | 6500 |
| 732 | Ga0495658_0019344 | 3300046683 | Bacteria | 3553 |
| 733 | Ga0495658_0184159 | 3300046683 | Bacteria | 1296 |
| 734 | Ga0495658_0645519 | 3300046683 | Bacteria | 678 |
| 735 | Ga0495613_0010040 | 3300046689 | Bacteria | 7033 |
| 736 | Ga0495613_0040724 | 3300046689 | Bacteria | 3441 |
| 737 | Ga0495613_0303649 | 3300046689 | Bacteria | 1104 |
| 738 | Ga0495613_0879351 | 3300046689 | Bacteria | 581 |
| 739 | Ga0495624_0062162 | 3300046690 | Bacteria | 2337 |
| 740 | Ga0495624_0096475 | 3300046690 | Bacteria | 1821 |
| 741 | Ga0495624_0591969 | 3300046690 | Bacteria | 661 |
| 742 | Ga0495600_0002853 | 3300046809 | Bacteria | 10060 |
| 743 | Ga0495600_0012611 | 3300046809 | Bacteria | 5291 |
| 744 | Ga0495600_0040792 | 3300046809 | Bacteria | 3024 |
| 745 | Ga0495600_0063555 | 3300046809 | Bacteria | 2412 |
| 746 | Ga0495600_0069165 | 3300046809 | Bacteria | 2307 |
| 747 | Ga0495600_0096300 | 3300046809 | Unclassified | 1929 |
| 748 | Ga0495600_0126883 | 3300046809 | Bacteria | 1659 |
| 749 | Ga0495600_0159285 | 3300046809 | Bacteria | 1459 |
| 750 | Ga0495581_0005608 | 3300047315 | Bacteria | 7275 |
| 751 | Ga0495581_0007642 | 3300047315 | Bacteria | 6255 |
| 752 | Ga0495581_0065108 | 3300047315 | Bacteria | 2107 |
| 753 | Ga0495581_0360629 | 3300047315 | Bacteria | 848 |
| 754 | Ga0495604_0000022 | 3300047317 | Bacteria | 151744 |
| 755 | Ga0495604_0001543 | 3300047317 | Bacteria | 18968 |
| 756 | Ga0495604_0002956 | 3300047317 | Bacteria | 13606 |
| 757 | Ga0495604_0004407 | 3300047317 | Bacteria | 11141 |
| 758 | Ga0495604_0010952 | 3300047317 | Bacteria | 7199 |
| 759 | Ga0495604_0049504 | 3300047317 | Bacteria | 3264 |
| 760 | Ga0495604_0107071 | 3300047317 | Bacteria | 2044 |
| 761 | Ga0495604_0246550 | 3300047317 | Unclassified | 1219 |
| 762 | Ga0495604_0272387 | 3300047317 | Bacteria | 1146 |
| 763 | Ga0495604_0309630 | 3300047317 | Bacteria | 1058 |
| 764 | Ga0495674_0003502 | 3300047319 | Bacteria | 15276 |
| 765 | Ga0495674_0011185 | 3300047319 | Bacteria | 8474 |
| 766 | Ga0495674_0017960 | 3300047319 | Bacteria | 6585 |
| 767 | Ga0495674_0052414 | 3300047319 | Bacteria | 3590 |
| 768 | Ga0495674_0100855 | 3300047319 | Bacteria | 2456 |
| 769 | Ga0495674_0119975 | 3300047319 | Bacteria | 2222 |
| 770 | Ga0495674_0122790 | 3300047319 | Bacteria | 2193 |
| 771 | Ga0495674_0156110 | 3300047319 | Bacteria | 1911 |
| 772 | Ga0495674_0514326 | 3300047319 | Bacteria | 956 |
| 773 | Ga0495674_0610323 | 3300047319 | Bacteria | 863 |
| 774 | Ga0495674_0748919 | 3300047319 | Bacteria | 763 |
| 775 | Ga0495674_1301116 | 3300047319 | Bacteria | 545 |
| 776 | Ga0495676_0123102 | 3300047321 | Bacteria | 1883 |
| 777 | Ga0495676_0471218 | 3300047321 | Bacteria | 827 |
| 778 | Ga0495676_0830946 | 3300047321 | Bacteria | 594 |
| 779 | Ga0495680_0000154 | 3300047322 | Bacteria | 69567 |
| 780 | Ga0495680_0001902 | 3300047322 | Bacteria | 21925 |
| 781 | Ga0495680_0003448 | 3300047322 | Bacteria | 15586 |
| 782 | Ga0495680_0009581 | 3300047322 | Bacteria | 8699 |
| 783 | Ga0495680_0012869 | 3300047322 | Bacteria | 7331 |
| 784 | Ga0495680_0031915 | 3300047322 | Bacteria | 4281 |
| 785 | Ga0495680_0035570 | 3300047322 | Bacteria | 4010 |
| 786 | Ga0495680_0044489 | 3300047322 | Bacteria | 3510 |
| 787 | Ga0495680_0472025 | 3300047322 | Bacteria | 855 |
| 788 | Ga0495680_0756159 | 3300047322 | Bacteria | 638 |
| 789 | Ga0495675_0000235 | 3300047444 | Bacteria | 39995 |
| 790 | Ga0495675_0006489 | 3300047444 | Bacteria | 7159 |
| 791 | Ga0495675_0027380 | 3300047444 | Bacteria | 3631 |
| 792 | Ga0495675_0060940 | 3300047444 | Bacteria | 2391 |
| 793 | Ga0495675_0064506 | 3300047444 | Unclassified | 2317 |
| 794 | Ga0495675_0079269 | 3300047444 | Bacteria | 2068 |
| 795 | Ga0495675_0093748 | 3300047444 | Bacteria | 1883 |
| 796 | Ga0495675_0716074 | 3300047444 | Unclassified | 559 |
| 797 | Ga0495684_0002498 | 3300047471 | Bacteria | 14648 |
| 798 | Ga0495684_0003448 | 3300047471 | Bacteria | 12381 |
| 799 | Ga0495684_0006901 | 3300047471 | Bacteria | 8815 |
| 800 | Ga0495684_0037269 | 3300047471 | Bacteria | 3729 |
| 801 | Ga0495684_0057283 | 3300047471 | Bacteria | 2970 |
| 802 | Ga0495684_0499929 | 3300047471 | Unclassified | 836 |
| 803 | Ga0495684_0532602 | 3300047471 | Bacteria | 802 |
| 804 | Ga0495684_0648246 | 3300047471 | Bacteria | 706 |
| 805 | Ga0495684_0673310 | 3300047471 | Bacteria | 689 |
| 806 | Ga0495684_0935619 | 3300047471 | Unclassified | 555 |
| 807 | Ga0495593_0003416 | 3300047673 | Bacteria | 9511 |
| 808 | Ga0495593_0037411 | 3300047673 | Bacteria | 2625 |
| 809 | Ga0495593_0038128 | 3300047673 | Bacteria | 2596 |
| 810 | Ga0495602_0000251 | 3300048088 | Bacteria | 50166 |
| 811 | Ga0495602_0001263 | 3300048088 | Bacteria | 24919 |
| 812 | Ga0495602_0021230 | 3300048088 | Bacteria | 6398 |
| 813 | Ga0495602_0031790 | 3300048088 | Bacteria | 4983 |
| 814 | Ga0495602_0078803 | 3300048088 | Bacteria | 2781 |
| 815 | Ga0495602_0109463 | 3300048088 | Bacteria | 2247 |
| 816 | Ga0495602_0123138 | 3300048088 | Bacteria | 2082 |
| 817 | Ga0495602_0308311 | 3300048088 | Bacteria | 1156 |
| 818 | Ga0495602_0359072 | 3300048088 | Bacteria | 1049 |
| 819 | Ga0495602_0416945 | 3300048088 | Bacteria | 954 |
| 820 | Ga0495602_0490428 | 3300048088 | Bacteria | 860 |
| 821 | Ga0495602_0563992 | 3300048088 | Bacteria | 787 |
| 822 | Ga0495614_0022156 | 3300048089 | Bacteria | 2743 |
| 823 | Ga0495614_0054616 | 3300048089 | Bacteria | 1713 |
| 824 | Ga0496100_0348139 | 3300048903 | Bacteria | 1118 |
| 825 | Ga0496100_1068297 | 3300048903 | Bacteria | 636 |
| 826 | Ga0496100_1177138 | 3300048903 | Unclassified | 604 |
| 827 | Ga0496101_0020360 | 3300048904 | Bacteria | 4539 |
| 828 | Ga0496101_0284736 | 3300048904 | Unclassified | 1292 |
| 829 | Ga0496102_0383507 | 3300048905 | Bacteria | 1322 |
| 830 | Ga0496103_0189036 | 3300048906 | Unclassified | 1324 |
| 831 | Ga0496103_0480845 | 3300048906 | Bacteria | 795 |
| 832 | Ga0496104_0033323 | 3300048907 | Unclassified | 4797 |
| 833 | Ga0496104_1001737 | 3300048907 | Bacteria | 739 |
| 834 | Ga0496105_0003676 | 3300048908 | Bacteria | 11410 |
| 835 | Ga0496105_0296952 | 3300048908 | Bacteria | 1299 |
| 836 | Ga0496105_0734781 | 3300048908 | Unclassified | 755 |
| 837 | Ga0496106_0017660 | 3300048909 | Bacteria | 5277 |
| 838 | Ga0496106_0248619 | 3300048909 | Bacteria | 1421 |
| 839 | Ga0496106_0776858 | 3300048909 | Unclassified | 760 |
| 840 | Ga0496107_0045925 | 3300048910 | Unclassified | 3143 |
| 841 | Ga0496108_0009624 | 3300048911 | Bacteria | 7834 |
| 842 | Ga0496108_0822512 | 3300048911 | Unclassified | 800 |
| 843 | Ga0496108_1287560 | 3300048911 | Unclassified | 615 |
| 844 | Ga0496109_0059843 | 3300048912 | Unclassified | 3480 |
| 845 | Ga0496109_0332485 | 3300048912 | Bacteria | 1434 |
| 846 | Ga0496110_0023186 | 3300048913 | Bacteria | 5278 |
| 847 | Ga0496110_0986764 | 3300048913 | Unclassified | 749 |
| 848 | Ga0496111_0090092 | 3300048914 | Unclassified | 2247 |
| 849 | Ga0496111_0180004 | 3300048914 | Bacteria | 1571 |
| 850 | Ga0496112_0018059 | 3300048915 | Bacteria | 6638 |
| 851 | Ga0496112_0383225 | 3300048915 | Bacteria | 1347 |
| 852 | Ga0496112_0474127 | 3300048915 | Bacteria | 1188 |
| 853 | Ga0496112_0596566 | 3300048915 | Bacteria | 1036 |
| 854 | Ga0496113_0043910 | 3300048916 | Unclassified | 3309 |
| 855 | Ga0496113_0688241 | 3300048916 | Unclassified | 816 |
| 856 | Ga0496114_0008516 | 3300048917 | Bacteria | 8130 |
| 857 | Ga0496114_0619402 | 3300048917 | Bacteria | 953 |
| 858 | Ga0496115_0011257 | 3300048918 | Bacteria | 6703 |
| 859 | Ga0496115_0074354 | 3300048918 | Bacteria | 2759 |
| 860 | Ga0496126_0007521 | 3300048929 | Bacteria | 11929 |
| 861 | Ga0496126_0009157 | 3300048929 | Bacteria | 10567 |
| 862 | Ga0496126_0027096 | 3300048929 | Bacteria | 5482 |
| 863 | Ga0501040_1049803 | 3300049576 | Unclassified | 591 |
| 864 | nmdc:mga05p37_2166644_c1 | 3300050507 | Bacteria | 518 |
| 865 | nmdc:mga05p37_22004_c1 | 3300050507 | Bacteria | 7725 |
| 866 | nmdc:mga06r32_500290_c1 | 3300050510 | Unclassified | 1192 |
| 867 | nmdc:mga0n895_31385_c1 | 3300050512 | Bacteria | 5087 |
| 868 | nmdc:mga0n895_384159_c1 | 3300050512 | Bacteria | 1421 |
| 869 | nmdc:mga0n895_91844_c1 | 3300050512 | Bacteria | 3039 |
| 870 | nmdc:mga0rr50_216559_c1 | 3300050513 | Unclassified | 1580 |
| 871 | nmdc:mga0rr50_23633_c1 | 3300050513 | Bacteria | 4242 |
| 872 | nmdc:mga0rr50_453393_c1 | 3300050513 | Bacteria | 1087 |
| 873 | nmdc:mga0rr50_46566_c1 | 3300050513 | Unclassified | 3194 |
| 874 | nmdc:mga08x19_120296_c1 | 3300050514 | Bacteria | 1760 |
| 875 | nmdc:mga08x19_82232_c1 | 3300050514 | Unclassified | 2116 |
| 876 | nmdc:mga0a205_12757_c1 | 3300050515 | Bacteria | 7791 |
| 877 | nmdc:mga0a205_169598_c1 | 3300050515 | Bacteria | 2078 |
| 878 | nmdc:mga0a205_225589_c1 | 3300050515 | Unclassified | 1758 |
| 879 | Ga0495601_0001455 | 3300053077 | Bacteria | 13046 |
| 880 | Ga0495601_0053364 | 3300053077 | Bacteria | 2555 |
| 881 | Ga0495601_0366732 | 3300053077 | Unclassified | 935 |
| 882 | Ga0495612_0037716 | 3300053078 | Bacteria | 1963 |
| 883 | Ga0495612_0112059 | 3300053078 | Bacteria | 1168 |
| 884 | Ga0495612_0192636 | 3300053078 | Bacteria | 898 |
| 885 | Ga0495612_0426118 | 3300053078 | Unclassified | 605 |
| 886 | Ga0495595_0000843 | 3300053084 | Bacteria | 11740 |
| 887 | Ga0495595_0006287 | 3300053084 | Bacteria | 4837 |
| 888 | Ga0495595_0007342 | 3300053084 | Bacteria | 4512 |
| 889 | Ga0495595_0024435 | 3300053084 | Bacteria | 2669 |
| 890 | Ga0495595_0043393 | 3300053084 | Bacteria | 2062 |
| 891 | Ga0495595_0143843 | 3300053084 | Bacteria | 1171 |
| 892 | Ga0495595_0387754 | 3300053084 | Unclassified | 707 |
| 893 | Ga0495619_0035776 | 3300053085 | Bacteria | 3231 |
| 894 | Ga0495619_0060984 | 3300053085 | Bacteria | 2509 |
| 895 | Ga0495619_0080308 | 3300053085 | Unclassified | 2195 |
| 896 | Ga0495619_0371497 | 3300053085 | Archaea | 988 |
| 897 | Ga0495619_0873685 | 3300053085 | Unclassified | 606 |
| 898 | Ga0495619_1141415 | 3300053085 | Bacteria | 517 |
| 899 | Ga0587084_022021 | 3300059477 | Bacteria | 961 |
| 900 | Ga0587066_054018 | 3300059490 | Bacteria | 800 |
| 901 | Ga0587115_088045 | 3300059626 | Unclassified | 560 |
| 902 | Ga0587067_008625 | 3300059640 | Unclassified | 1495 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046529 | Ga0495652_0344535 | Ga0495652_0344535_46_414 | 117 |
| 2 | 3300046543 | Ga0495645_0165556 | Ga0495645_0165556_1096_1464 | 117 |
| 3 | 3300035725 | Ga0373947_0613926 | Ga0373947_0613926_19_384 | 119 |
| 4 | 3300013297 | Ga0157378_11401071 | Ga0157378_114010711 | 120 |
| 5 | 3300046472 | Ga0495580_0353633 | Ga0495580_0353633_575_961 | 120 |
| 6 | 3300035086 | Ga0373934_0000453 | Ga0373934_0000453_47_436 | 121 |
| 7 | 3300046535 | Ga0495586_0042447 | Ga0495586_0042447_2037_2429 | 121 |
| 8 | 3300046559 | Ga0495667_0785427 | Ga0495667_0785427_149_541 | 121 |
| 9 | 3300053078 | Ga0495612_0112059 | Ga0495612_0112059_38_430 | 121 |
| 10 | 3300010375 | Ga0105239_11672622 | Ga0105239_116726221 | 122 |
| 11 | 3300046543 | Ga0495645_0811952 | Ga0495645_0811952_32_418 | 125 |
| 12 | 3300035724 | Ga0373933_0187527 | Ga0373933_0187527_409_894 | 136 |
| 13 | 3300025926 | Ga0207659_11099803 | Ga0207659_110998031 | 137 |
| 14 | 3300025915 | Ga0207693_10579703 | Ga0207693_105797032 | 138 |
| 15 | 3300025916 | Ga0207663_10829456 | Ga0207663_108294562 | 138 |
| 16 | 3300035086 | Ga0373934_0043283 | Ga0373934_0043283_529_960 | 138 |
| 17 | 3300035113 | Ga0373936_0252938 | Ga0373936_0252938_19_450 | 138 |
| 18 | 3300035116 | Ga0373945_0029669 | Ga0373945_0029669_693_1124 | 138 |
| 19 | 3300035119 | Ga0373956_0062845 | Ga0373956_0062845_992_1423 | 138 |
| 20 | 3300035170 | Ga0373943_0788562 | Ga0373943_0788562_101_532 | 138 |
| 21 | 3300035172 | Ga0373955_0008335 | Ga0373955_0008335_2082_2513 | 138 |
| 22 | 3300035410 | Ga0373924_0008042 | Ga0373924_0008042_1058_1489 | 138 |
| 23 | 3300035692 | Ga0373935_0129031 | Ga0373935_0129031_1235_1666 | 138 |
| 24 | 3300035724 | Ga0373933_0016037 | Ga0373933_0016037_2236_2667 | 138 |
| 25 | 3300036401 | Ga0373937_0047413 | Ga0373937_0047413_126_557 | 138 |
| 26 | 3300037068 | Ga0373925_0068135 | Ga0373925_0068135_1222_1653 | 138 |
| 27 | 3300046454 | Ga0495592_0019917 | Ga0495592_0019917_2390_2821 | 138 |
| 28 | 3300046454 | Ga0495592_0811343 | Ga0495592_0811343_84_515 | 138 |
| 29 | 3300046462 | Ga0495651_0010232 | Ga0495651_0010232_6753_7184 | 138 |
| 30 | 3300046463 | Ga0495653_0017464 | Ga0495653_0017464_3862_4293 | 138 |
| 31 | 3300046473 | Ga0495582_0052093 | Ga0495582_0052093_1110_1541 | 138 |
| 32 | 3300046477 | Ga0495664_0013599 | Ga0495664_0013599_90_521 | 138 |
| 33 | 3300046511 | Ga0495608_0001073 | Ga0495608_0001073_1625_2056 | 138 |
| 34 | 3300046514 | Ga0495618_0210974 | Ga0495618_0210974_20_451 | 138 |
| 35 | 3300046514 | Ga0495618_0265639 | Ga0495618_0265639_223_654 | 138 |
| 36 | 3300046516 | Ga0495628_0002940 | Ga0495628_0002940_2315_2746 | 138 |
| 37 | 3300046517 | Ga0495630_0018016 | Ga0495630_0018016_801_1232 | 138 |
| 38 | 3300046529 | Ga0495652_0381455 | Ga0495652_0381455_300_731 | 138 |
| 39 | 3300046531 | Ga0495665_0171308 | Ga0495665_0171308_355_786 | 138 |
| 40 | 3300046533 | Ga0495640_0111789 | Ga0495640_0111789_852_1283 | 138 |
| 41 | 3300046535 | Ga0495586_0047495 | Ga0495586_0047495_443_874 | 138 |
| 42 | 3300046536 | Ga0495587_0080734 | Ga0495587_0080734_678_1109 | 138 |
| 43 | 3300046543 | Ga0495645_0167115 | Ga0495645_0167115_979_1410 | 138 |
| 44 | 3300046559 | Ga0495667_0006609 | Ga0495667_0006609_1304_1735 | 138 |
| 45 | 3300046642 | Ga0495634_0047022 | Ga0495634_0047022_2378_2809 | 138 |
| 46 | 3300046663 | Ga0495635_0052383 | Ga0495635_0052383_2283_2714 | 138 |
| 47 | 3300046674 | Ga0495588_0698851 | Ga0495588_0698851_16_447 | 138 |
| 48 | 3300046675 | Ga0495657_0031326 | Ga0495657_0031326_1178_1609 | 138 |
| 49 | 3300046678 | Ga0495599_0553227 | Ga0495599_0553227_122_553 | 138 |
| 50 | 3300046679 | Ga0495623_0078087 | Ga0495623_0078087_824_1255 | 138 |
| 51 | 3300046680 | Ga0495646_0018933 | Ga0495646_0018933_699_1130 | 138 |
| 52 | 3300046683 | Ga0495658_0184159 | Ga0495658_0184159_337_768 | 138 |
| 53 | 3300046690 | Ga0495624_0062162 | Ga0495624_0062162_502_933 | 138 |
| 54 | 3300046809 | Ga0495600_0002853 | Ga0495600_0002853_8874_9305 | 138 |
| 55 | 3300047315 | Ga0495581_0360629 | Ga0495581_0360629_361_792 | 138 |
| 56 | 3300047317 | Ga0495604_0010952 | Ga0495604_0010952_2665_3096 | 138 |
| 57 | 3300047319 | Ga0495674_0052414 | Ga0495674_0052414_2657_3088 | 138 |
| 58 | 3300047319 | Ga0495674_0748919 | Ga0495674_0748919_120_551 | 138 |
| 59 | 3300047322 | Ga0495680_0001902 | Ga0495680_0001902_3700_4131 | 138 |
| 60 | 3300047444 | Ga0495675_0079269 | Ga0495675_0079269_815_1246 | 138 |
| 61 | 3300047471 | Ga0495684_0006901 | Ga0495684_0006901_6157_6588 | 138 |
| 62 | 3300047673 | Ga0495593_0038128 | Ga0495593_0038128_1101_1532 | 138 |
| 63 | 3300048088 | Ga0495602_0109463 | Ga0495602_0109463_33_464 | 138 |
| 64 | 3300048088 | Ga0495602_0416945 | Ga0495602_0416945_21_452 | 138 |
| 65 | 3300053077 | Ga0495601_0366732 | Ga0495601_0366732_24_455 | 138 |
| 66 | 3300053084 | Ga0495595_0006287 | Ga0495595_0006287_2630_3061 | 138 |
| 67 | 3300053085 | Ga0495619_0035776 | Ga0495619_0035776_683_1114 | 138 |
| 68 | 3300053085 | Ga0495619_1141415 | Ga0495619_1141415_60_491 | 138 |
| 69 | 3300047319 | Ga0495674_0514326 | Ga0495674_0514326_465_893 | 140 |
| 70 | 3300005336 | Ga0070680_100259093 | Ga0070680_1002590932 | 141 |
| 71 | 3300005336 | Ga0070680_100277186 | Ga0070680_1002771862 | 141 |
| 72 | 3300005337 | Ga0070682_100109485 | Ga0070682_1001094853 | 141 |
| 73 | 3300005339 | Ga0070660_100441711 | Ga0070660_1004417112 | 141 |
| 74 | 3300005341 | Ga0070691_10260930 | Ga0070691_102609301 | 141 |
| 75 | 3300005343 | Ga0070687_100980794 | Ga0070687_1009807941 | 141 |
| 76 | 3300005355 | Ga0070671_100651498 | Ga0070671_1006514981 | 141 |
| 77 | 3300005366 | Ga0070659_100142422 | Ga0070659_1001424222 | 141 |
| 78 | 3300005406 | Ga0070703_10296350 | Ga0070703_102963501 | 141 |
| 79 | 3300005435 | Ga0070714_100011586 | Ga0070714_1000115864 | 141 |
| 80 | 3300005435 | Ga0070714_100573750 | Ga0070714_1005737501 | 141 |
| 81 | 3300005435 | Ga0070714_100642932 | Ga0070714_1006429321 | 141 |
| 82 | 3300005436 | Ga0070713_100224072 | Ga0070713_1002240722 | 141 |
| 83 | 3300005440 | Ga0070705_100391413 | Ga0070705_1003914132 | 141 |
| 84 | 3300005445 | Ga0070708_100385452 | Ga0070708_1003854522 | 141 |
| 85 | 3300005467 | Ga0070706_100074346 | Ga0070706_1000743461 | 141 |
| 86 | 3300005468 | Ga0070707_100785135 | Ga0070707_1007851352 | 141 |
| 87 | 3300005468 | Ga0070707_101009222 | Ga0070707_1010092222 | 141 |
| 88 | 3300005471 | Ga0070698_100006357 | Ga0070698_10000635712 | 141 |
| 89 | 3300005518 | Ga0070699_100039229 | Ga0070699_1000392297 | 141 |
| 90 | 3300005518 | Ga0070699_100402056 | Ga0070699_1004020563 | 141 |
| 91 | 3300005530 | Ga0070679_100118973 | Ga0070679_1001189734 | 141 |
| 92 | 3300005536 | Ga0070697_101232048 | Ga0070697_1012320481 | 141 |
| 93 | 3300005548 | Ga0070665_100312721 | Ga0070665_1003127213 | 141 |
| 94 | 3300005564 | Ga0070664_100750291 | Ga0070664_1007502911 | 141 |
| 95 | 3300005577 | Ga0068857_100937112 | Ga0068857_1009371122 | 141 |
| 96 | 3300005614 | Ga0068856_100445478 | Ga0068856_1004454781 | 141 |
| 97 | 3300005618 | Ga0068864_101587790 | Ga0068864_1015877902 | 141 |
| 98 | 3300006028 | Ga0070717_11143668 | Ga0070717_111436681 | 141 |
| 99 | 3300006163 | Ga0070715_10004114 | Ga0070715_100041145 | 141 |
| 100 | 3300006173 | Ga0070716_100081549 | Ga0070716_1000815493 | 141 |
| 101 | 3300006358 | Ga0068871_100133473 | Ga0068871_1001334731 | 141 |
| 102 | 3300006871 | Ga0075434_100146391 | Ga0075434_1001463912 | 141 |
| 103 | 3300006914 | Ga0075436_100252256 | Ga0075436_1002522562 | 141 |
| 104 | 3300007076 | Ga0075435_100286519 | Ga0075435_1002865192 | 141 |
| 105 | 3300009093 | Ga0105240_10348767 | Ga0105240_103487672 | 141 |
| 106 | 3300009177 | Ga0105248_10797356 | Ga0105248_107973561 | 141 |
| 107 | 3300013104 | Ga0157370_10268413 | Ga0157370_102684132 | 141 |
| 108 | 3300013105 | Ga0157369_11747414 | Ga0157369_117474141 | 141 |
| 109 | 3300013307 | Ga0157372_10393051 | Ga0157372_103930512 | 141 |
| 110 | 3300013307 | Ga0157372_11226822 | Ga0157372_112268222 | 141 |
| 111 | 3300014968 | Ga0157379_11971263 | Ga0157379_119712631 | 141 |
| 112 | 3300014969 | Ga0157376_11360918 | Ga0157376_113609182 | 141 |
| 113 | 3300020082 | Ga0206353_11391335 | Ga0206353_113913355 | 141 |
| 114 | 3300021388 | Ga0213875_10000312 | Ga0213875_1000031218 | 141 |
| 115 | 3300022467 | Ga0224712_10521254 | Ga0224712_105212542 | 141 |
| 116 | 3300025885 | Ga0207653_10373377 | Ga0207653_103733771 | 141 |
| 117 | 3300025898 | Ga0207692_10001693 | Ga0207692_100016935 | 141 |
| 118 | 3300025898 | Ga0207692_10040840 | Ga0207692_100408403 | 141 |
| 119 | 3300025905 | Ga0207685_10000213 | Ga0207685_100002137 | 141 |
| 120 | 3300025906 | Ga0207699_10004260 | Ga0207699_100042605 | 141 |
| 121 | 3300025910 | Ga0207684_10064256 | Ga0207684_100642561 | 141 |
| 122 | 3300025912 | Ga0207707_10465904 | Ga0207707_104659042 | 141 |
| 123 | 3300025916 | Ga0207663_10001922 | Ga0207663_100019228 | 141 |
| 124 | 3300025917 | Ga0207660_10423097 | Ga0207660_104230971 | 141 |
| 125 | 3300025919 | Ga0207657_10058280 | Ga0207657_100582806 | 141 |
| 126 | 3300025922 | Ga0207646_10646855 | Ga0207646_106468551 | 141 |
| 127 | 3300025928 | Ga0207700_10007608 | Ga0207700_100076083 | 141 |
| 128 | 3300025928 | Ga0207700_10230825 | Ga0207700_102308252 | 141 |
| 129 | 3300025929 | Ga0207664_10039123 | Ga0207664_100391234 | 141 |
| 130 | 3300025929 | Ga0207664_10112691 | Ga0207664_101126914 | 141 |
| 131 | 3300025931 | Ga0207644_10966538 | Ga0207644_109665381 | 141 |
| 132 | 3300025932 | Ga0207690_10275050 | Ga0207690_102750502 | 141 |
| 133 | 3300025939 | Ga0207665_10441729 | Ga0207665_104417291 | 141 |
| 134 | 3300025944 | Ga0207661_10090467 | Ga0207661_100904672 | 141 |
| 135 | 3300026067 | Ga0207678_10100422 | Ga0207678_101004224 | 141 |
| 136 | 3300026067 | Ga0207678_10397255 | Ga0207678_103972552 | 141 |
| 137 | 3300026078 | Ga0207702_10241806 | Ga0207702_102418063 | 141 |
| 138 | 3300026078 | Ga0207702_12425335 | Ga0207702_124253351 | 141 |
| 139 | 3300026095 | Ga0207676_11560025 | Ga0207676_115600251 | 141 |
| 140 | 3300026116 | Ga0207674_10097284 | Ga0207674_100972844 | 141 |
| 141 | 3300026142 | Ga0207698_10621326 | Ga0207698_106213262 | 141 |
| 142 | 3300028379 | Ga0268266_10084515 | Ga0268266_100845153 | 141 |
| 143 | 3300034817 | Ga0373948_0031650 | Ga0373948_0031650_280_729 | 141 |
| 144 | 3300034957 | Ga0373938_0203447 | Ga0373938_0203447_51_500 | 141 |
| 145 | 3300035088 | Ga0373940_0069726 | Ga0373940_0069726_115_564 | 141 |
| 146 | 3300035090 | Ga0373949_0016761 | Ga0373949_0016761_828_1277 | 141 |
| 147 | 3300035091 | Ga0373951_0010086 | Ga0373951_0010086_216_665 | 141 |
| 148 | 3300035092 | Ga0373952_0102240 | Ga0373952_0102240_130_579 | 141 |
| 149 | 3300035113 | Ga0373936_0246688 | Ga0373936_0246688_21_470 | 141 |
| 150 | 3300035115 | Ga0373941_0006980 | Ga0373941_0006980_1026_1475 | 141 |
| 151 | 3300035121 | Ga0373960_0115475 | Ga0373960_0115475_241_690 | 141 |
| 152 | 3300035241 | Ga0373961_0160668 | Ga0373961_0160668_107_556 | 141 |
| 153 | 3300035242 | Ga0373962_0009476 | Ga0373962_0009476_543_992 | 141 |
| 154 | 3300035691 | Ga0373931_0007289 | Ga0373931_0007289_3277_3726 | 141 |
| 155 | 3300035692 | Ga0373935_0042315 | Ga0373935_0042315_296_745 | 141 |
| 156 | 3300037068 | Ga0373925_0020188 | Ga0373925_0020188_2469_2918 | 141 |
| 157 | 3300037466 | Ga0395898_0128858 | Ga0395898_0128858_856_1290 | 141 |
| 158 | 3300037466 | Ga0395898_0771912 | Ga0395898_0771912_38_472 | 141 |
| 159 | 3300037853 | Ga0436364_1101267 | Ga0436364_1101267_51051_51512 | 141 |
| 160 | 3300044694 | Ga0466963_0051020 | Ga0466963_0051020_1327_1761 | 141 |
| 161 | 3300045836 | Ga0466958_0236814 | Ga0466958_0236814_536_970 | 141 |
| 162 | 3300045976 | Ga0466967_0093023 | Ga0466967_0093023_1683_2117 | 141 |
| 163 | 3300046454 | Ga0495592_0328586 | Ga0495592_0328586_170_619 | 141 |
| 164 | 3300046455 | Ga0495603_0015082 | Ga0495603_0015082_1033_1482 | 141 |
| 165 | 3300046459 | Ga0495629_0003864 | Ga0495629_0003864_5076_5525 | 141 |
| 166 | 3300046461 | Ga0495641_0004654 | Ga0495641_0004654_4912_5361 | 141 |
| 167 | 3300046462 | Ga0495651_0099790 | Ga0495651_0099790_299_748 | 141 |
| 168 | 3300046463 | Ga0495653_0004643 | Ga0495653_0004643_6069_6518 | 141 |
| 169 | 3300046472 | Ga0495580_0009989 | Ga0495580_0009989_5275_5724 | 141 |
| 170 | 3300046473 | Ga0495582_0003757 | Ga0495582_0003757_3954_4403 | 141 |
| 171 | 3300046475 | Ga0495639_0023727 | Ga0495639_0023727_572_1021 | 141 |
| 172 | 3300046476 | Ga0495662_0015519 | Ga0495662_0015519_1471_1920 | 141 |
| 173 | 3300046499 | Ga0495594_0058118 | Ga0495594_0058118_1610_2059 | 141 |
| 174 | 3300046511 | Ga0495608_0030352 | Ga0495608_0030352_1439_1888 | 141 |
| 175 | 3300046516 | Ga0495628_0073798 | Ga0495628_0073798_756_1205 | 141 |
| 176 | 3300046517 | Ga0495630_0017241 | Ga0495630_0017241_3463_3912 | 141 |
| 177 | 3300046531 | Ga0495665_0009220 | Ga0495665_0009220_491_940 | 141 |
| 178 | 3300046533 | Ga0495640_0009138 | Ga0495640_0009138_4132_4581 | 141 |
| 179 | 3300046559 | Ga0495667_0014908 | Ga0495667_0014908_2123_2572 | 141 |
| 180 | 3300046642 | Ga0495634_0007391 | Ga0495634_0007391_3951_4400 | 141 |
| 181 | 3300046663 | Ga0495635_0007332 | Ga0495635_0007332_3545_3994 | 141 |
| 182 | 3300046674 | Ga0495588_0354385 | Ga0495588_0354385_249_698 | 141 |
| 183 | 3300046678 | Ga0495599_0364063 | Ga0495599_0364063_73_522 | 141 |
| 184 | 3300046680 | Ga0495646_0040386 | Ga0495646_0040386_1553_2002 | 141 |
| 185 | 3300046681 | Ga0495647_0060509 | Ga0495647_0060509_684_1133 | 141 |
| 186 | 3300046683 | Ga0495658_0005016 | Ga0495658_0005016_2926_3375 | 141 |
| 187 | 3300046689 | Ga0495613_0010040 | Ga0495613_0010040_2297_2746 | 141 |
| 188 | 3300046690 | Ga0495624_0096475 | Ga0495624_0096475_13_462 | 141 |
| 189 | 3300046809 | Ga0495600_0069165 | Ga0495600_0069165_397_846 | 141 |
| 190 | 3300047315 | Ga0495581_0005608 | Ga0495581_0005608_2866_3315 | 141 |
| 191 | 3300047319 | Ga0495674_0017960 | Ga0495674_0017960_4447_4896 | 141 |
| 192 | 3300047321 | Ga0495676_0123102 | Ga0495676_0123102_177_626 | 141 |
| 193 | 3300047322 | Ga0495680_0012869 | Ga0495680_0012869_2713_3162 | 141 |
| 194 | 3300047471 | Ga0495684_0002498 | Ga0495684_0002498_12420_12869 | 141 |
| 195 | 3300047673 | Ga0495593_0003416 | Ga0495593_0003416_4288_4737 | 141 |
| 196 | 3300048089 | Ga0495614_0022156 | Ga0495614_0022156_922_1371 | 141 |
| 197 | 3300048903 | Ga0496100_0348139 | Ga0496100_0348139_326_775 | 141 |
| 198 | 3300048904 | Ga0496101_0020360 | Ga0496101_0020360_3968_4417 | 141 |
| 199 | 3300048906 | Ga0496103_0189036 | Ga0496103_0189036_687_1136 | 141 |
| 200 | 3300048907 | Ga0496104_0033323 | Ga0496104_0033323_2057_2506 | 141 |
| 201 | 3300048908 | Ga0496105_0003676 | Ga0496105_0003676_6245_6694 | 141 |
| 202 | 3300048909 | Ga0496106_0017660 | Ga0496106_0017660_701_1150 | 141 |
| 203 | 3300048910 | Ga0496107_0045925 | Ga0496107_0045925_426_875 | 141 |
| 204 | 3300048911 | Ga0496108_0009624 | Ga0496108_0009624_1341_1790 | 141 |
| 205 | 3300048912 | Ga0496109_0059843 | Ga0496109_0059843_1707_2156 | 141 |
| 206 | 3300048913 | Ga0496110_0023186 | Ga0496110_0023186_4065_4514 | 141 |
| 207 | 3300048914 | Ga0496111_0090092 | Ga0496111_0090092_1332_1781 | 141 |
| 208 | 3300048915 | Ga0496112_0018059 | Ga0496112_0018059_5892_6341 | 141 |
| 209 | 3300048915 | Ga0496112_0383225 | Ga0496112_0383225_656_1090 | 141 |
| 210 | 3300048916 | Ga0496113_0043910 | Ga0496113_0043910_2213_2662 | 141 |
| 211 | 3300048917 | Ga0496114_0008516 | Ga0496114_0008516_2692_3141 | 141 |
| 212 | 3300048918 | Ga0496115_0011257 | Ga0496115_0011257_4198_4647 | 141 |
| 213 | 3300048929 | Ga0496126_0009157 | Ga0496126_0009157_7653_8141 | 141 |
| 214 | 3300050507 | nmdc:mga05p37_2166644_c1 | nmdc:mga05p37_2166644_c1_41_481 | 141 |
| 215 | 3300050512 | nmdc:mga0n895_31385_c1 | nmdc:mga0n895_31385_c1_1642_2082 | 141 |
| 216 | 3300050513 | nmdc:mga0rr50_216559_c1 | nmdc:mga0rr50_216559_c1_864_1304 | 141 |
| 217 | 3300050513 | nmdc:mga0rr50_23633_c1 | nmdc:mga0rr50_23633_c1_1630_2079 | 141 |
| 218 | 3300050514 | nmdc:mga08x19_120296_c1 | nmdc:mga08x19_120296_c1_317_757 | 141 |
| 219 | 3300050515 | nmdc:mga0a205_225589_c1 | nmdc:mga0a205_225589_c1_296_745 | 141 |
| 220 | 3300053084 | Ga0495595_0387754 | Ga0495595_0387754_71_520 | 141 |
| 221 | 3300053085 | Ga0495619_0060984 | Ga0495619_0060984_1604_2053 | 141 |
| 222 | 3300059640 | Ga0587067_008625 | Ga0587067_008625_995_1429 | 141 |
| 223 | 3300005354 | Ga0070675_101891405 | Ga0070675_1018914051 | 142 |
| 224 | 3300005435 | Ga0070714_100182401 | Ga0070714_1001824012 | 142 |
| 225 | 3300005436 | Ga0070713_100090641 | Ga0070713_1000906412 | 142 |
| 226 | 3300005439 | Ga0070711_100057214 | Ga0070711_1000572143 | 142 |
| 227 | 3300005983 | Ga0081540_1048040 | Ga0081540_10480403 | 142 |
| 228 | 3300006028 | Ga0070717_11092002 | Ga0070717_110920022 | 142 |
| 229 | 3300006173 | Ga0070716_100953421 | Ga0070716_1009534211 | 142 |
| 230 | 3300006844 | Ga0075428_100212893 | Ga0075428_1002128932 | 142 |
| 231 | 3300006847 | Ga0075431_100626913 | Ga0075431_1006269131 | 142 |
| 232 | 3300006852 | Ga0075433_10128788 | Ga0075433_101287882 | 142 |
| 233 | 3300006871 | Ga0075434_100810258 | Ga0075434_1008102582 | 142 |
| 234 | 3300006914 | Ga0075436_100550978 | Ga0075436_1005509782 | 142 |
| 235 | 3300007076 | Ga0075435_100365353 | Ga0075435_1003653532 | 142 |
| 236 | 3300007076 | Ga0075435_101482424 | Ga0075435_1014824241 | 142 |
| 237 | 3300009094 | Ga0111539_11089217 | Ga0111539_110892171 | 142 |
| 238 | 3300009147 | Ga0114129_10018632 | Ga0114129_1001863210 | 142 |
| 239 | 3300013306 | Ga0163162_11744644 | Ga0163162_117446441 | 142 |
| 240 | 3300025916 | Ga0207663_10281209 | Ga0207663_102812092 | 142 |
| 241 | 3300025928 | Ga0207700_10053874 | Ga0207700_100538741 | 142 |
| 242 | 3300025929 | Ga0207664_10392896 | Ga0207664_103928962 | 142 |
| 243 | 3300025939 | Ga0207665_10824288 | Ga0207665_108242881 | 142 |
| 244 | 3300027907 | Ga0207428_10674306 | Ga0207428_106743061 | 142 |
| 245 | 3300035086 | Ga0373934_0092380 | Ga0373934_0092380_604_1059 | 142 |
| 246 | 3300035088 | Ga0373940_0073419 | Ga0373940_0073419_367_819 | 142 |
| 247 | 3300035111 | Ga0373923_0004236 | Ga0373923_0004236_487_942 | 142 |
| 248 | 3300035111 | Ga0373923_0056622 | Ga0373923_0056622_409_861 | 142 |
| 249 | 3300035111 | Ga0373923_0316615 | Ga0373923_0316615_130_585 | 142 |
| 250 | 3300035111 | Ga0373923_0564858 | Ga0373923_0564858_19_474 | 142 |
| 251 | 3300035113 | Ga0373936_0004218 | Ga0373936_0004218_2388_2843 | 142 |
| 252 | 3300035113 | Ga0373936_0110775 | Ga0373936_0110775_552_1004 | 142 |
| 253 | 3300035117 | Ga0373953_0000923 | Ga0373953_0000923_1123_1575 | 142 |
| 254 | 3300035117 | Ga0373953_0133458 | Ga0373953_0133458_443_898 | 142 |
| 255 | 3300035117 | Ga0373953_0167413 | Ga0373953_0167413_248_700 | 142 |
| 256 | 3300035117 | Ga0373953_0355166 | Ga0373953_0355166_160_615 | 142 |
| 257 | 3300035118 | Ga0373954_0011646 | Ga0373954_0011646_510_962 | 142 |
| 258 | 3300035118 | Ga0373954_0019992 | Ga0373954_0019992_940_1395 | 142 |
| 259 | 3300035119 | Ga0373956_0002523 | Ga0373956_0002523_469_921 | 142 |
| 260 | 3300035119 | Ga0373956_0056883 | Ga0373956_0056883_162_617 | 142 |
| 261 | 3300035119 | Ga0373956_0160706 | Ga0373956_0160706_160_615 | 142 |
| 262 | 3300035120 | Ga0373957_0000702 | Ga0373957_0000702_1681_2133 | 142 |
| 263 | 3300035120 | Ga0373957_0000994 | Ga0373957_0000994_4405_4860 | 142 |
| 264 | 3300035120 | Ga0373957_0048228 | Ga0373957_0048228_1142_1597 | 142 |
| 265 | 3300035171 | Ga0373946_0162184 | Ga0373946_0162184_447_899 | 142 |
| 266 | 3300035172 | Ga0373955_0000515 | Ga0373955_0000515_9537_9989 | 142 |
| 267 | 3300035172 | Ga0373955_0022057 | Ga0373955_0022057_1865_2317 | 142 |
| 268 | 3300035172 | Ga0373955_0262269 | Ga0373955_0262269_160_615 | 142 |
| 269 | 3300035410 | Ga0373924_0000549 | Ga0373924_0000549_681_1133 | 142 |
| 270 | 3300035410 | Ga0373924_0044440 | Ga0373924_0044440_1053_1508 | 142 |
| 271 | 3300035410 | Ga0373924_0099290 | Ga0373924_0099290_463_915 | 142 |
| 272 | 3300035692 | Ga0373935_0102985 | Ga0373935_0102985_424_879 | 142 |
| 273 | 3300035692 | Ga0373935_0227928 | Ga0373935_0227928_788_1243 | 142 |
| 274 | 3300035724 | Ga0373933_0000507 | Ga0373933_0000507_6554_7006 | 142 |
| 275 | 3300035724 | Ga0373933_0023500 | Ga0373933_0023500_1051_1503 | 142 |
| 276 | 3300035724 | Ga0373933_0042757 | Ga0373933_0042757_595_1050 | 142 |
| 277 | 3300035724 | Ga0373933_0354340 | Ga0373933_0354340_365_820 | 142 |
| 278 | 3300035725 | Ga0373947_0580152 | Ga0373947_0580152_117_569 | 142 |
| 279 | 3300036242 | Ga0310104_02245 | Ga0310104_02245_21_461 | 142 |
| 280 | 3300036401 | Ga0373937_0001460 | Ga0373937_0001460_12764_13216 | 142 |
| 281 | 3300036401 | Ga0373937_0164171 | Ga0373937_0164171_162_617 | 142 |
| 282 | 3300036401 | Ga0373937_0211646 | Ga0373937_0211646_168_620 | 142 |
| 283 | 3300036401 | Ga0373937_0241320 | Ga0373937_0241320_1088_1543 | 142 |
| 284 | 3300036457 | Ga0265778_061930 | Ga0265778_061930_64_504 | 142 |
| 285 | 3300037068 | Ga0373925_0227508 | Ga0373925_0227508_95_547 | 142 |
| 286 | 3300046454 | Ga0495592_0002671 | Ga0495592_0002671_5583_6035 | 142 |
| 287 | 3300046454 | Ga0495592_0004469 | Ga0495592_0004469_2573_3025 | 142 |
| 288 | 3300046454 | Ga0495592_0111874 | Ga0495592_0111874_161_616 | 142 |
| 289 | 3300046459 | Ga0495629_0001557 | Ga0495629_0001557_17125_17580 | 142 |
| 290 | 3300046459 | Ga0495629_0095977 | Ga0495629_0095977_1391_1843 | 142 |
| 291 | 3300046462 | Ga0495651_0000798 | Ga0495651_0000798_17494_17946 | 142 |
| 292 | 3300046462 | Ga0495651_0002496 | Ga0495651_0002496_2573_3025 | 142 |
| 293 | 3300046462 | Ga0495651_0027504 | Ga0495651_0027504_2094_2549 | 142 |
| 294 | 3300046463 | Ga0495653_0003377 | Ga0495653_0003377_10496_10948 | 142 |
| 295 | 3300046463 | Ga0495653_0008354 | Ga0495653_0008354_5708_6160 | 142 |
| 296 | 3300046463 | Ga0495653_0039019 | Ga0495653_0039019_1629_2084 | 142 |
| 297 | 3300046473 | Ga0495582_0008905 | Ga0495582_0008905_4010_4465 | 142 |
| 298 | 3300046476 | Ga0495662_0038680 | Ga0495662_0038680_1315_1767 | 142 |
| 299 | 3300046476 | Ga0495662_0187277 | Ga0495662_0187277_157_612 | 142 |
| 300 | 3300046477 | Ga0495664_0059757 | Ga0495664_0059757_987_1439 | 142 |
| 301 | 3300046477 | Ga0495664_0110325 | Ga0495664_0110325_762_1217 | 142 |
| 302 | 3300046511 | Ga0495608_0000630 | Ga0495608_0000630_17314_17766 | 142 |
| 303 | 3300046511 | Ga0495608_0071331 | Ga0495608_0071331_625_1077 | 142 |
| 304 | 3300046514 | Ga0495618_0006927 | Ga0495618_0006927_4981_5436 | 142 |
| 305 | 3300046514 | Ga0495618_0069043 | Ga0495618_0069043_23_475 | 142 |
| 306 | 3300046516 | Ga0495628_0001397 | Ga0495628_0001397_4205_4657 | 142 |
| 307 | 3300046516 | Ga0495628_0007939 | Ga0495628_0007939_6241_6693 | 142 |
| 308 | 3300046516 | Ga0495628_0080452 | Ga0495628_0080452_449_904 | 142 |
| 309 | 3300046517 | Ga0495630_0015723 | Ga0495630_0015723_2355_2807 | 142 |
| 310 | 3300046517 | Ga0495630_0082836 | Ga0495630_0082836_790_1245 | 142 |
| 311 | 3300046517 | Ga0495630_1333270 | Ga0495630_1333270_60_515 | 142 |
| 312 | 3300046526 | Ga0495666_0404550 | Ga0495666_0404550_37_489 | 142 |
| 313 | 3300046529 | Ga0495652_0003271 | Ga0495652_0003271_9128_9580 | 142 |
| 314 | 3300046529 | Ga0495652_0003576 | Ga0495652_0003576_7005_7457 | 142 |
| 315 | 3300046529 | Ga0495652_0702169 | Ga0495652_0702169_65_520 | 142 |
| 316 | 3300046531 | Ga0495665_0007582 | Ga0495665_0007582_270_725 | 142 |
| 317 | 3300046531 | Ga0495665_0424489 | Ga0495665_0424489_93_545 | 142 |
| 318 | 3300046533 | Ga0495640_0007314 | Ga0495640_0007314_585_1040 | 142 |
| 319 | 3300046533 | Ga0495640_0009834 | Ga0495640_0009834_1729_2181 | 142 |
| 320 | 3300046535 | Ga0495586_0034210 | Ga0495586_0034210_1385_1837 | 142 |
| 321 | 3300046536 | Ga0495587_0000605 | Ga0495587_0000605_17447_17899 | 142 |
| 322 | 3300046536 | Ga0495587_0017195 | Ga0495587_0017195_540_992 | 142 |
| 323 | 3300046536 | Ga0495587_0019208 | Ga0495587_0019208_2828_3283 | 142 |
| 324 | 3300046543 | Ga0495645_0001541 | Ga0495645_0001541_5779_6231 | 142 |
| 325 | 3300046543 | Ga0495645_0275153 | Ga0495645_0275153_493_948 | 142 |
| 326 | 3300046559 | Ga0495667_0000537 | Ga0495667_0000537_6475_6927 | 142 |
| 327 | 3300046559 | Ga0495667_0001852 | Ga0495667_0001852_2373_2825 | 142 |
| 328 | 3300046559 | Ga0495667_0030746 | Ga0495667_0030746_1559_2014 | 142 |
| 329 | 3300046642 | Ga0495634_0253555 | Ga0495634_0253555_601_1053 | 142 |
| 330 | 3300046642 | Ga0495634_0575132 | Ga0495634_0575132_128_583 | 142 |
| 331 | 3300046663 | Ga0495635_0010898 | Ga0495635_0010898_416_868 | 142 |
| 332 | 3300046663 | Ga0495635_0043166 | Ga0495635_0043166_776_1231 | 142 |
| 333 | 3300046663 | Ga0495635_0477239 | Ga0495635_0477239_219_674 | 142 |
| 334 | 3300046675 | Ga0495657_0001623 | Ga0495657_0001623_12284_12736 | 142 |
| 335 | 3300046675 | Ga0495657_0019891 | Ga0495657_0019891_3187_3639 | 142 |
| 336 | 3300046675 | Ga0495657_0025659 | Ga0495657_0025659_2162_2617 | 142 |
| 337 | 3300046678 | Ga0495599_0000408 | Ga0495599_0000408_17569_18021 | 142 |
| 338 | 3300046678 | Ga0495599_0000918 | Ga0495599_0000918_9811_10263 | 142 |
| 339 | 3300046678 | Ga0495599_0068859 | Ga0495599_0068859_1593_2048 | 142 |
| 340 | 3300046678 | Ga0495599_0270759 | Ga0495599_0270759_416_871 | 142 |
| 341 | 3300046679 | Ga0495623_0003230 | Ga0495623_0003230_3774_4226 | 142 |
| 342 | 3300046679 | Ga0495623_0021765 | Ga0495623_0021765_740_1192 | 142 |
| 343 | 3300046679 | Ga0495623_0044612 | Ga0495623_0044612_443_898 | 142 |
| 344 | 3300046679 | Ga0495623_0220595 | Ga0495623_0220595_182_637 | 142 |
| 345 | 3300046680 | Ga0495646_0011988 | Ga0495646_0011988_77_532 | 142 |
| 346 | 3300046680 | Ga0495646_0013443 | Ga0495646_0013443_1904_2356 | 142 |
| 347 | 3300046680 | Ga0495646_0019395 | Ga0495646_0019395_2336_2788 | 142 |
| 348 | 3300046683 | Ga0495658_0019344 | Ga0495658_0019344_2667_3122 | 142 |
| 349 | 3300046689 | Ga0495613_0040724 | Ga0495613_0040724_1563_2018 | 142 |
| 350 | 3300046689 | Ga0495613_0303649 | Ga0495613_0303649_301_753 | 142 |
| 351 | 3300046809 | Ga0495600_0012611 | Ga0495600_0012611_741_1193 | 142 |
| 352 | 3300046809 | Ga0495600_0096300 | Ga0495600_0096300_307_759 | 142 |
| 353 | 3300046809 | Ga0495600_0126883 | Ga0495600_0126883_443_898 | 142 |
| 354 | 3300047315 | Ga0495581_0007642 | Ga0495581_0007642_69_524 | 142 |
| 355 | 3300047315 | Ga0495581_0065108 | Ga0495581_0065108_1552_2004 | 142 |
| 356 | 3300047317 | Ga0495604_0001543 | Ga0495604_0001543_1020_1472 | 142 |
| 357 | 3300047317 | Ga0495604_0004407 | Ga0495604_0004407_9510_9962 | 142 |
| 358 | 3300047317 | Ga0495604_0049504 | Ga0495604_0049504_162_617 | 142 |
| 359 | 3300047317 | Ga0495604_0309630 | Ga0495604_0309630_160_615 | 142 |
| 360 | 3300047319 | Ga0495674_0011185 | Ga0495674_0011185_5649_6101 | 142 |
| 361 | 3300047319 | Ga0495674_0100855 | Ga0495674_0100855_443_898 | 142 |
| 362 | 3300047319 | Ga0495674_0156110 | Ga0495674_0156110_1304_1759 | 142 |
| 363 | 3300047319 | Ga0495674_1301116 | Ga0495674_1301116_56_511 | 142 |
| 364 | 3300047321 | Ga0495676_0830946 | Ga0495676_0830946_55_510 | 142 |
| 365 | 3300047322 | Ga0495680_0003448 | Ga0495680_0003448_6569_7021 | 142 |
| 366 | 3300047322 | Ga0495680_0009581 | Ga0495680_0009581_2354_2806 | 142 |
| 367 | 3300047322 | Ga0495680_0031915 | Ga0495680_0031915_2162_2617 | 142 |
| 368 | 3300047444 | Ga0495675_0006489 | Ga0495675_0006489_1187_1639 | 142 |
| 369 | 3300047444 | Ga0495675_0027380 | Ga0495675_0027380_1213_1668 | 142 |
| 370 | 3300047444 | Ga0495675_0064506 | Ga0495675_0064506_1737_2189 | 142 |
| 371 | 3300047471 | Ga0495684_0003448 | Ga0495684_0003448_7204_7656 | 142 |
| 372 | 3300047471 | Ga0495684_0037269 | Ga0495684_0037269_2094_2549 | 142 |
| 373 | 3300047471 | Ga0495684_0499929 | Ga0495684_0499929_357_809 | 142 |
| 374 | 3300047471 | Ga0495684_0532602 | Ga0495684_0532602_112_567 | 142 |
| 375 | 3300047673 | Ga0495593_0037411 | Ga0495593_0037411_1756_2211 | 142 |
| 376 | 3300048088 | Ga0495602_0001263 | Ga0495602_0001263_17899_18351 | 142 |
| 377 | 3300048088 | Ga0495602_0021230 | Ga0495602_0021230_683_1135 | 142 |
| 378 | 3300048088 | Ga0495602_0123138 | Ga0495602_0123138_162_617 | 142 |
| 379 | 3300048088 | Ga0495602_0359072 | Ga0495602_0359072_435_890 | 142 |
| 380 | 3300048089 | Ga0495614_0054616 | Ga0495614_0054616_1112_1567 | 142 |
| 381 | 3300049576 | Ga0501040_1049803 | Ga0501040_1049803_97_549 | 142 |
| 382 | 3300050507 | nmdc:mga05p37_22004_c1 | nmdc:mga05p37_22004_c1_5019_5471 | 142 |
| 383 | 3300050510 | nmdc:mga06r32_500290_c1 | nmdc:mga06r32_500290_c1_168_620 | 142 |
| 384 | 3300050512 | nmdc:mga0n895_384159_c1 | nmdc:mga0n895_384159_c1_893_1345 | 142 |
| 385 | 3300050512 | nmdc:mga0n895_91844_c1 | nmdc:mga0n895_91844_c1_1694_2146 | 142 |
| 386 | 3300050513 | nmdc:mga0rr50_46566_c1 | nmdc:mga0rr50_46566_c1_2206_2658 | 142 |
| 387 | 3300050514 | nmdc:mga08x19_82232_c1 | nmdc:mga08x19_82232_c1_1407_1859 | 142 |
| 388 | 3300050515 | nmdc:mga0a205_12757_c1 | nmdc:mga0a205_12757_c1_2854_3306 | 142 |
| 389 | 3300053077 | Ga0495601_0001455 | Ga0495601_0001455_1991_2443 | 142 |
| 390 | 3300053084 | Ga0495595_0000843 | Ga0495595_0000843_8622_9074 | 142 |
| 391 | 3300053084 | Ga0495595_0007342 | Ga0495595_0007342_905_1357 | 142 |
| 392 | 3300053084 | Ga0495595_0043393 | Ga0495595_0043393_271_726 | 142 |
| 393 | 3300053085 | Ga0495619_0080308 | Ga0495619_0080308_1052_1504 | 142 |
| 394 | 3300003659 | JGI25404J52841_10001092 | JGI25404J52841_100010925 | 143 |
| 395 | 3300004800 | Ga0058861_12043780 | Ga0058861_120437801 | 143 |
| 396 | 3300004803 | Ga0058862_12706110 | Ga0058862_127061101 | 143 |
| 397 | 3300005329 | Ga0070683_100075781 | Ga0070683_1000757812 | 143 |
| 398 | 3300005329 | Ga0070683_100382345 | Ga0070683_1003823451 | 143 |
| 399 | 3300005329 | Ga0070683_100852711 | Ga0070683_1008527111 | 143 |
| 400 | 3300005331 | Ga0070670_101404312 | Ga0070670_1014043121 | 143 |
| 401 | 3300005334 | Ga0068869_100139532 | Ga0068869_1001395322 | 143 |
| 402 | 3300005334 | Ga0068869_101515775 | Ga0068869_1015157751 | 143 |
| 403 | 3300005336 | Ga0070680_101431036 | Ga0070680_1014310361 | 143 |
| 404 | 3300005337 | Ga0070682_100315416 | Ga0070682_1003154161 | 143 |
| 405 | 3300005337 | Ga0070682_100933297 | Ga0070682_1009332971 | 143 |
| 406 | 3300005338 | Ga0068868_100202235 | Ga0068868_1002022352 | 143 |
| 407 | 3300005338 | Ga0068868_101493115 | Ga0068868_1014931151 | 143 |
| 408 | 3300005341 | Ga0070691_10698919 | Ga0070691_106989191 | 143 |
| 409 | 3300005344 | Ga0070661_100392002 | Ga0070661_1003920022 | 143 |
| 410 | 3300005354 | Ga0070675_100510808 | Ga0070675_1005108082 | 143 |
| 411 | 3300005356 | Ga0070674_100222825 | Ga0070674_1002228252 | 143 |
| 412 | 3300005364 | Ga0070673_101313412 | Ga0070673_1013134122 | 143 |
| 413 | 3300005364 | Ga0070673_101589695 | Ga0070673_1015896951 | 143 |
| 414 | 3300005434 | Ga0070709_10082338 | Ga0070709_100823382 | 143 |
| 415 | 3300005435 | Ga0070714_100024414 | Ga0070714_1000244143 | 143 |
| 416 | 3300005435 | Ga0070714_100722612 | Ga0070714_1007226122 | 143 |
| 417 | 3300005435 | Ga0070714_101044783 | Ga0070714_1010447832 | 143 |
| 418 | 3300005435 | Ga0070714_101062692 | Ga0070714_1010626922 | 143 |
| 419 | 3300005435 | Ga0070714_101419944 | Ga0070714_1014199441 | 143 |
| 420 | 3300005436 | Ga0070713_100043664 | Ga0070713_1000436642 | 143 |
| 421 | 3300005436 | Ga0070713_100120023 | Ga0070713_1001200233 | 143 |
| 422 | 3300005436 | Ga0070713_100244642 | Ga0070713_1002446422 | 143 |
| 423 | 3300005436 | Ga0070713_100560609 | Ga0070713_1005606092 | 143 |
| 424 | 3300005436 | Ga0070713_100776176 | Ga0070713_1007761761 | 143 |
| 425 | 3300005437 | Ga0070710_10144798 | Ga0070710_101447982 | 143 |
| 426 | 3300005437 | Ga0070710_10395102 | Ga0070710_103951022 | 143 |
| 427 | 3300005437 | Ga0070710_10894657 | Ga0070710_108946571 | 143 |
| 428 | 3300005439 | Ga0070711_100078518 | Ga0070711_1000785182 | 143 |
| 429 | 3300005440 | Ga0070705_101335415 | Ga0070705_1013354151 | 143 |
| 430 | 3300005445 | Ga0070708_100047647 | Ga0070708_1000476473 | 143 |
| 431 | 3300005445 | Ga0070708_100441042 | Ga0070708_1004410422 | 143 |
| 432 | 3300005455 | Ga0070663_100417308 | Ga0070663_1004173081 | 143 |
| 433 | 3300005456 | Ga0070678_100245676 | Ga0070678_1002456762 | 143 |
| 434 | 3300005456 | Ga0070678_101165527 | Ga0070678_1011655272 | 143 |
| 435 | 3300005456 | Ga0070678_101446089 | Ga0070678_1014460891 | 143 |
| 436 | 3300005457 | Ga0070662_100767977 | Ga0070662_1007679772 | 143 |
| 437 | 3300005458 | Ga0070681_10581936 | Ga0070681_105819361 | 143 |
| 438 | 3300005458 | Ga0070681_11224918 | Ga0070681_112249181 | 143 |
| 439 | 3300005458 | Ga0070681_11417585 | Ga0070681_114175851 | 143 |
| 440 | 3300005467 | Ga0070706_100093017 | Ga0070706_1000930172 | 143 |
| 441 | 3300005467 | Ga0070706_100312463 | Ga0070706_1003124632 | 143 |
| 442 | 3300005467 | Ga0070706_100490871 | Ga0070706_1004908712 | 143 |
| 443 | 3300005467 | Ga0070706_100555779 | Ga0070706_1005557791 | 143 |
| 444 | 3300005468 | Ga0070707_100003731 | Ga0070707_1000037314 | 143 |
| 445 | 3300005468 | Ga0070707_100086187 | Ga0070707_1000861876 | 143 |
| 446 | 3300005468 | Ga0070707_100226629 | Ga0070707_1002266293 | 143 |
| 447 | 3300005468 | Ga0070707_100679550 | Ga0070707_1006795501 | 143 |
| 448 | 3300005468 | Ga0070707_100747280 | Ga0070707_1007472801 | 143 |
| 449 | 3300005468 | Ga0070707_100886432 | Ga0070707_1008864321 | 143 |
| 450 | 3300005471 | Ga0070698_100003676 | Ga0070698_10000367615 | 143 |
| 451 | 3300005471 | Ga0070698_100008957 | Ga0070698_1000089575 | 143 |
| 452 | 3300005471 | Ga0070698_100011232 | Ga0070698_1000112327 | 143 |
| 453 | 3300005471 | Ga0070698_100150799 | Ga0070698_1001507995 | 143 |
| 454 | 3300005471 | Ga0070698_100858794 | Ga0070698_1008587943 | 143 |
| 455 | 3300005518 | Ga0070699_100000405 | Ga0070699_10000040529 | 143 |
| 456 | 3300005518 | Ga0070699_100132548 | Ga0070699_1001325481 | 143 |
| 457 | 3300005530 | Ga0070679_100221190 | Ga0070679_1002211902 | 143 |
| 458 | 3300005535 | Ga0070684_100261088 | Ga0070684_1002610881 | 143 |
| 459 | 3300005535 | Ga0070684_100340859 | Ga0070684_1003408592 | 143 |
| 460 | 3300005535 | Ga0070684_100932886 | Ga0070684_1009328861 | 143 |
| 461 | 3300005535 | Ga0070684_101253660 | Ga0070684_1012536602 | 143 |
| 462 | 3300005536 | Ga0070697_100029395 | Ga0070697_1000293951 | 143 |
| 463 | 3300005539 | Ga0068853_100061302 | Ga0068853_1000613025 | 143 |
| 464 | 3300005544 | Ga0070686_101162384 | Ga0070686_1011623841 | 143 |
| 465 | 3300005546 | Ga0070696_100590070 | Ga0070696_1005900701 | 143 |
| 466 | 3300005547 | Ga0070693_100348754 | Ga0070693_1003487541 | 143 |
| 467 | 3300005548 | Ga0070665_100307596 | Ga0070665_1003075962 | 143 |
| 468 | 3300005548 | Ga0070665_101417992 | Ga0070665_1014179921 | 143 |
| 469 | 3300005549 | Ga0070704_100362466 | Ga0070704_1003624662 | 143 |
| 470 | 3300005563 | Ga0068855_100579982 | Ga0068855_1005799822 | 143 |
| 471 | 3300005563 | Ga0068855_101510327 | Ga0068855_1015103272 | 143 |
| 472 | 3300005577 | Ga0068857_100092718 | Ga0068857_1000927182 | 143 |
| 473 | 3300005577 | Ga0068857_100150823 | Ga0068857_1001508234 | 143 |
| 474 | 3300005578 | Ga0068854_100447867 | Ga0068854_1004478672 | 143 |
| 475 | 3300005614 | Ga0068856_101258839 | Ga0068856_1012588391 | 143 |
| 476 | 3300005614 | Ga0068856_101361486 | Ga0068856_1013614862 | 143 |
| 477 | 3300005615 | Ga0070702_101078372 | Ga0070702_1010783721 | 143 |
| 478 | 3300005617 | Ga0068859_100422296 | Ga0068859_1004222962 | 143 |
| 479 | 3300005617 | Ga0068859_101257195 | Ga0068859_1012571952 | 143 |
| 480 | 3300005618 | Ga0068864_102202494 | Ga0068864_1022024941 | 143 |
| 481 | 3300005719 | Ga0068861_101318383 | Ga0068861_1013183832 | 143 |
| 482 | 3300005834 | Ga0068851_10091240 | Ga0068851_100912402 | 143 |
| 483 | 3300005841 | Ga0068863_100306613 | Ga0068863_1003066132 | 143 |
| 484 | 3300005841 | Ga0068863_101916837 | Ga0068863_1019168372 | 143 |
| 485 | 3300005842 | Ga0068858_100185422 | Ga0068858_1001854222 | 143 |
| 486 | 3300005843 | Ga0068860_100707286 | Ga0068860_1007072862 | 143 |
| 487 | 3300005843 | Ga0068860_101471931 | Ga0068860_1014719311 | 143 |
| 488 | 3300005843 | Ga0068860_101556756 | Ga0068860_1015567561 | 143 |
| 489 | 3300005983 | Ga0081540_1001743 | Ga0081540_100174311 | 143 |
| 490 | 3300006028 | Ga0070717_10035084 | Ga0070717_100350843 | 143 |
| 491 | 3300006028 | Ga0070717_10065911 | Ga0070717_100659114 | 143 |
| 492 | 3300006028 | Ga0070717_10185487 | Ga0070717_101854875 | 143 |
| 493 | 3300006028 | Ga0070717_10783239 | Ga0070717_107832392 | 143 |
| 494 | 3300006163 | Ga0070715_10690291 | Ga0070715_106902911 | 143 |
| 495 | 3300006173 | Ga0070716_100107312 | Ga0070716_1001073122 | 143 |
| 496 | 3300006173 | Ga0070716_100815927 | Ga0070716_1008159272 | 143 |
| 497 | 3300006175 | Ga0070712_100036052 | Ga0070712_1000360521 | 143 |
| 498 | 3300006175 | Ga0070712_100132094 | Ga0070712_1001320944 | 143 |
| 499 | 3300006175 | Ga0070712_100207072 | Ga0070712_1002070722 | 143 |
| 500 | 3300006175 | Ga0070712_100281608 | Ga0070712_1002816082 | 143 |
| 501 | 3300006175 | Ga0070712_100322043 | Ga0070712_1003220431 | 143 |
| 502 | 3300006175 | Ga0070712_101617694 | Ga0070712_1016176941 | 143 |
| 503 | 3300006237 | Ga0097621_100363651 | Ga0097621_1003636512 | 143 |
| 504 | 3300006358 | Ga0068871_101710712 | Ga0068871_1017107122 | 143 |
| 505 | 3300006852 | Ga0075433_11422670 | Ga0075433_114226701 | 143 |
| 506 | 3300006871 | Ga0075434_100515993 | Ga0075434_1005159931 | 143 |
| 507 | 3300006881 | Ga0068865_100028789 | Ga0068865_1000287892 | 143 |
| 508 | 3300006931 | Ga0097620_100422283 | Ga0097620_1004222832 | 143 |
| 509 | 3300006931 | Ga0097620_101257251 | Ga0097620_1012572512 | 143 |
| 510 | 3300007076 | Ga0075435_101852209 | Ga0075435_1018522091 | 143 |
| 511 | 3300009092 | Ga0105250_10077867 | Ga0105250_100778672 | 143 |
| 512 | 3300009093 | Ga0105240_10398695 | Ga0105240_103986952 | 143 |
| 513 | 3300009093 | Ga0105240_10972950 | Ga0105240_109729501 | 143 |
| 514 | 3300009094 | Ga0111539_13510366 | Ga0111539_135103661 | 143 |
| 515 | 3300009098 | Ga0105245_10973672 | Ga0105245_109736721 | 143 |
| 516 | 3300009098 | Ga0105245_11152039 | Ga0105245_111520392 | 143 |
| 517 | 3300009101 | Ga0105247_10430328 | Ga0105247_104303281 | 143 |
| 518 | 3300009101 | Ga0105247_10700423 | Ga0105247_107004231 | 143 |
| 519 | 3300009148 | Ga0105243_10071648 | Ga0105243_100716483 | 143 |
| 520 | 3300009174 | Ga0105241_10176838 | Ga0105241_101768382 | 143 |
| 521 | 3300009174 | Ga0105241_10830963 | Ga0105241_108309631 | 143 |
| 522 | 3300009176 | Ga0105242_10819844 | Ga0105242_108198441 | 143 |
| 523 | 3300009545 | Ga0105237_10917324 | Ga0105237_109173241 | 143 |
| 524 | 3300009551 | Ga0105238_10149293 | Ga0105238_101492931 | 143 |
| 525 | 3300009551 | Ga0105238_11304333 | Ga0105238_113043331 | 143 |
| 526 | 3300009551 | Ga0105238_11304335 | Ga0105238_113043351 | 143 |
| 527 | 3300009553 | Ga0105249_10249872 | Ga0105249_102498721 | 143 |
| 528 | 3300009553 | Ga0105249_11967813 | Ga0105249_119678131 | 143 |
| 529 | 3300010159 | Ga0099796_10080203 | Ga0099796_100802032 | 143 |
| 530 | 3300011119 | Ga0105246_10011576 | Ga0105246_100115765 | 143 |
| 531 | 3300011119 | Ga0105246_10523851 | Ga0105246_105238512 | 143 |
| 532 | 3300012507 | Ga0157342_1009931 | Ga0157342_10099312 | 143 |
| 533 | 3300013100 | Ga0157373_10092891 | Ga0157373_100928912 | 143 |
| 534 | 3300013102 | Ga0157371_10181709 | Ga0157371_101817092 | 143 |
| 535 | 3300013104 | Ga0157370_10122936 | Ga0157370_101229363 | 143 |
| 536 | 3300013104 | Ga0157370_11142876 | Ga0157370_111428761 | 143 |
| 537 | 3300013105 | Ga0157369_10659842 | Ga0157369_106598421 | 143 |
| 538 | 3300013105 | Ga0157369_10668021 | Ga0157369_106680212 | 143 |
| 539 | 3300013105 | Ga0157369_11136163 | Ga0157369_111361631 | 143 |
| 540 | 3300013105 | Ga0157369_11204219 | Ga0157369_112042191 | 143 |
| 541 | 3300013296 | Ga0157374_10448039 | Ga0157374_104480392 | 143 |
| 542 | 3300013296 | Ga0157374_10872999 | Ga0157374_108729992 | 143 |
| 543 | 3300013297 | Ga0157378_10318606 | Ga0157378_103186062 | 143 |
| 544 | 3300013306 | Ga0163162_10616706 | Ga0163162_106167061 | 143 |
| 545 | 3300013306 | Ga0163162_11470083 | Ga0163162_114700831 | 143 |
| 546 | 3300013307 | Ga0157372_10635203 | Ga0157372_106352032 | 143 |
| 547 | 3300013307 | Ga0157372_12353686 | Ga0157372_123536862 | 143 |
| 548 | 3300013308 | Ga0157375_12038382 | Ga0157375_120383821 | 143 |
| 549 | 3300013308 | Ga0157375_12065253 | Ga0157375_120652531 | 143 |
| 550 | 3300014325 | Ga0163163_10361023 | Ga0163163_103610232 | 143 |
| 551 | 3300014745 | Ga0157377_10644064 | Ga0157377_106440641 | 143 |
| 552 | 3300014968 | Ga0157379_10591307 | Ga0157379_105913072 | 143 |
| 553 | 3300014968 | Ga0157379_10728805 | Ga0157379_107288052 | 143 |
| 554 | 3300020069 | Ga0197907_10032160 | Ga0197907_100321602 | 143 |
| 555 | 3300020069 | Ga0197907_10861133 | Ga0197907_108611332 | 143 |
| 556 | 3300020069 | Ga0197907_10924303 | Ga0197907_109243033 | 143 |
| 557 | 3300020070 | Ga0206356_10039166 | Ga0206356_100391661 | 143 |
| 558 | 3300020070 | Ga0206356_11395269 | Ga0206356_113952692 | 143 |
| 559 | 3300020075 | Ga0206349_1814736 | Ga0206349_18147362 | 143 |
| 560 | 3300020076 | Ga0206355_1681200 | Ga0206355_16812001 | 143 |
| 561 | 3300020077 | Ga0206351_10213855 | Ga0206351_102138551 | 143 |
| 562 | 3300020077 | Ga0206351_10244370 | Ga0206351_102443701 | 143 |
| 563 | 3300020078 | Ga0206352_10526204 | Ga0206352_105262041 | 143 |
| 564 | 3300020078 | Ga0206352_11106613 | Ga0206352_111066131 | 143 |
| 565 | 3300020078 | Ga0206352_11335809 | Ga0206352_113358091 | 143 |
| 566 | 3300020080 | Ga0206350_10136229 | Ga0206350_101362292 | 143 |
| 567 | 3300020080 | Ga0206350_11119363 | Ga0206350_111193632 | 143 |
| 568 | 3300020080 | Ga0206350_11310291 | Ga0206350_113102911 | 143 |
| 569 | 3300020080 | Ga0206350_11351073 | Ga0206350_113510731 | 143 |
| 570 | 3300020081 | Ga0206354_10541864 | Ga0206354_105418642 | 143 |
| 571 | 3300020081 | Ga0206354_11573652 | Ga0206354_115736522 | 143 |
| 572 | 3300020082 | Ga0206353_10209463 | Ga0206353_102094632 | 143 |
| 573 | 3300020610 | Ga0154015_1066765 | Ga0154015_10667651 | 143 |
| 574 | 3300021388 | Ga0213875_10004119 | Ga0213875_100041192 | 143 |
| 575 | 3300022467 | Ga0224712_10300427 | Ga0224712_103004271 | 143 |
| 576 | 3300025321 | Ga0207656_10412629 | Ga0207656_104126291 | 143 |
| 577 | 3300025885 | Ga0207653_10133864 | Ga0207653_101338642 | 143 |
| 578 | 3300025898 | Ga0207692_10069804 | Ga0207692_100698041 | 143 |
| 579 | 3300025898 | Ga0207692_10211134 | Ga0207692_102111342 | 143 |
| 580 | 3300025898 | Ga0207692_10325830 | Ga0207692_103258301 | 143 |
| 581 | 3300025898 | Ga0207692_10754394 | Ga0207692_107543941 | 143 |
| 582 | 3300025898 | Ga0207692_11014266 | Ga0207692_110142661 | 143 |
| 583 | 3300025900 | Ga0207710_10358472 | Ga0207710_103584721 | 143 |
| 584 | 3300025900 | Ga0207710_10446397 | Ga0207710_104463971 | 143 |
| 585 | 3300025901 | Ga0207688_10246000 | Ga0207688_102460002 | 143 |
| 586 | 3300025903 | Ga0207680_10895081 | Ga0207680_108950811 | 143 |
| 587 | 3300025904 | Ga0207647_10066847 | Ga0207647_100668473 | 143 |
| 588 | 3300025905 | Ga0207685_10248683 | Ga0207685_102486831 | 143 |
| 589 | 3300025906 | Ga0207699_10020249 | Ga0207699_100202496 | 143 |
| 590 | 3300025906 | Ga0207699_10055907 | Ga0207699_100559072 | 143 |
| 591 | 3300025906 | Ga0207699_10140995 | Ga0207699_101409952 | 143 |
| 592 | 3300025906 | Ga0207699_10515578 | Ga0207699_105155781 | 143 |
| 593 | 3300025910 | Ga0207684_10042592 | Ga0207684_100425921 | 143 |
| 594 | 3300025910 | Ga0207684_10174450 | Ga0207684_101744502 | 143 |
| 595 | 3300025910 | Ga0207684_10391147 | Ga0207684_103911472 | 143 |
| 596 | 3300025911 | Ga0207654_10203593 | Ga0207654_102035932 | 143 |
| 597 | 3300025913 | Ga0207695_10534452 | Ga0207695_105344521 | 143 |
| 598 | 3300025914 | Ga0207671_10597283 | Ga0207671_105972832 | 143 |
| 599 | 3300025915 | Ga0207693_10485565 | Ga0207693_104855652 | 143 |
| 600 | 3300025915 | Ga0207693_10666239 | Ga0207693_106662392 | 143 |
| 601 | 3300025915 | Ga0207693_10829362 | Ga0207693_108293621 | 143 |
| 602 | 3300025916 | Ga0207663_10126743 | Ga0207663_101267432 | 143 |
| 603 | 3300025916 | Ga0207663_10357438 | Ga0207663_103574382 | 143 |
| 604 | 3300025916 | Ga0207663_11148745 | Ga0207663_111487451 | 143 |
| 605 | 3300025917 | Ga0207660_10177213 | Ga0207660_101772132 | 143 |
| 606 | 3300025917 | Ga0207660_10292633 | Ga0207660_102926332 | 143 |
| 607 | 3300025918 | Ga0207662_10054165 | Ga0207662_100541652 | 143 |
| 608 | 3300025919 | Ga0207657_10009522 | Ga0207657_100095225 | 143 |
| 609 | 3300025920 | Ga0207649_10053478 | Ga0207649_100534782 | 143 |
| 610 | 3300025921 | Ga0207652_10069883 | Ga0207652_100698833 | 143 |
| 611 | 3300025921 | Ga0207652_11877724 | Ga0207652_118777241 | 143 |
| 612 | 3300025922 | Ga0207646_10015499 | Ga0207646_100154996 | 143 |
| 613 | 3300025922 | Ga0207646_10049954 | Ga0207646_100499545 | 143 |
| 614 | 3300025922 | Ga0207646_10196833 | Ga0207646_101968332 | 143 |
| 615 | 3300025922 | Ga0207646_10467288 | Ga0207646_104672882 | 143 |
| 616 | 3300025924 | Ga0207694_10670273 | Ga0207694_106702731 | 143 |
| 617 | 3300025924 | Ga0207694_10736727 | Ga0207694_107367271 | 143 |
| 618 | 3300025926 | Ga0207659_10150235 | Ga0207659_101502352 | 143 |
| 619 | 3300025927 | Ga0207687_10361043 | Ga0207687_103610431 | 143 |
| 620 | 3300025928 | Ga0207700_10011082 | Ga0207700_100110827 | 143 |
| 621 | 3300025928 | Ga0207700_10028774 | Ga0207700_100287746 | 143 |
| 622 | 3300025928 | Ga0207700_10085135 | Ga0207700_100851354 | 143 |
| 623 | 3300025928 | Ga0207700_10187131 | Ga0207700_101871312 | 143 |
| 624 | 3300025928 | Ga0207700_10239984 | Ga0207700_102399842 | 143 |
| 625 | 3300025928 | Ga0207700_11246577 | Ga0207700_112465771 | 143 |
| 626 | 3300025929 | Ga0207664_10089946 | Ga0207664_100899463 | 143 |
| 627 | 3300025929 | Ga0207664_10119876 | Ga0207664_101198762 | 143 |
| 628 | 3300025929 | Ga0207664_10147936 | Ga0207664_101479363 | 143 |
| 629 | 3300025929 | Ga0207664_10187820 | Ga0207664_101878201 | 143 |
| 630 | 3300025929 | Ga0207664_10203924 | Ga0207664_102039243 | 143 |
| 631 | 3300025931 | Ga0207644_10785168 | Ga0207644_107851682 | 143 |
| 632 | 3300025933 | Ga0207706_10079698 | Ga0207706_100796981 | 143 |
| 633 | 3300025934 | Ga0207686_10427430 | Ga0207686_104274302 | 143 |
| 634 | 3300025936 | Ga0207670_11479671 | Ga0207670_114796711 | 143 |
| 635 | 3300025937 | Ga0207669_10835396 | Ga0207669_108353962 | 143 |
| 636 | 3300025938 | Ga0207704_10441898 | Ga0207704_104418982 | 143 |
| 637 | 3300025939 | Ga0207665_10011289 | Ga0207665_100112894 | 143 |
| 638 | 3300025939 | Ga0207665_11124624 | Ga0207665_111246242 | 143 |
| 639 | 3300025940 | Ga0207691_11002390 | Ga0207691_110023902 | 143 |
| 640 | 3300025942 | Ga0207689_10067729 | Ga0207689_100677295 | 143 |
| 641 | 3300025944 | Ga0207661_10021010 | Ga0207661_100210104 | 143 |
| 642 | 3300025944 | Ga0207661_10188507 | Ga0207661_101885071 | 143 |
| 643 | 3300025944 | Ga0207661_11123924 | Ga0207661_111239241 | 143 |
| 644 | 3300025944 | Ga0207661_11187068 | Ga0207661_111870682 | 143 |
| 645 | 3300025945 | Ga0207679_10659019 | Ga0207679_106590191 | 143 |
| 646 | 3300025949 | Ga0207667_11133427 | Ga0207667_111334271 | 143 |
| 647 | 3300025961 | Ga0207712_11083251 | Ga0207712_110832511 | 143 |
| 648 | 3300025972 | Ga0207668_10958664 | Ga0207668_109586641 | 143 |
| 649 | 3300025972 | Ga0207668_11136578 | Ga0207668_111365781 | 143 |
| 650 | 3300025981 | Ga0207640_10613787 | Ga0207640_106137871 | 143 |
| 651 | 3300026023 | Ga0207677_11417353 | Ga0207677_114173531 | 143 |
| 652 | 3300026035 | Ga0207703_11039607 | Ga0207703_110396071 | 143 |
| 653 | 3300026067 | Ga0207678_10013839 | Ga0207678_100138392 | 143 |
| 654 | 3300026075 | Ga0207708_10307659 | Ga0207708_103076592 | 143 |
| 655 | 3300026078 | Ga0207702_10715297 | Ga0207702_107152972 | 143 |
| 656 | 3300026078 | Ga0207702_12103158 | Ga0207702_121031581 | 143 |
| 657 | 3300026088 | Ga0207641_10444188 | Ga0207641_104441882 | 143 |
| 658 | 3300026116 | Ga0207674_10119813 | Ga0207674_101198135 | 143 |
| 659 | 3300026116 | Ga0207674_10124222 | Ga0207674_101242221 | 143 |
| 660 | 3300026116 | Ga0207674_11314288 | Ga0207674_113142882 | 143 |
| 661 | 3300026118 | Ga0207675_100052218 | Ga0207675_1000522182 | 143 |
| 662 | 3300026118 | Ga0207675_100456499 | Ga0207675_1004564991 | 143 |
| 663 | 3300026121 | Ga0207683_11546339 | Ga0207683_115463392 | 143 |
| 664 | 3300026121 | Ga0207683_11566398 | Ga0207683_115663981 | 143 |
| 665 | 3300026142 | Ga0207698_11351965 | Ga0207698_113519651 | 143 |
| 666 | 3300026142 | Ga0207698_11946099 | Ga0207698_119460991 | 143 |
| 667 | 3300028023 | Ga0265357_1001605 | Ga0265357_10016051 | 143 |
| 668 | 3300028381 | Ga0268264_11863866 | Ga0268264_118638661 | 143 |
| 669 | 3300028654 | Ga0265322_10040260 | Ga0265322_100402602 | 143 |
| 670 | 3300028800 | Ga0265338_10001197 | Ga0265338_1000119731 | 143 |
| 671 | 3300028800 | Ga0265338_10311204 | Ga0265338_103112041 | 143 |
| 672 | 3300030760 | Ga0265762_1013027 | Ga0265762_10130271 | 143 |
| 673 | 3300030763 | Ga0265763_1000424 | Ga0265763_10004242 | 143 |
| 674 | 3300030882 | Ga0265764_100491 | Ga0265764_1004913 | 143 |
| 675 | 3300031240 | Ga0265320_10210696 | Ga0265320_102106962 | 143 |
| 676 | 3300031241 | Ga0265325_10147857 | Ga0265325_101478572 | 143 |
| 677 | 3300034817 | Ga0373948_0024187 | Ga0373948_0024187_300_731 | 143 |
| 678 | 3300034957 | Ga0373938_0010587 | Ga0373938_0010587_1002_1433 | 143 |
| 679 | 3300035083 | Ga0373926_0189688 | Ga0373926_0189688_263_697 | 143 |
| 680 | 3300035086 | Ga0373934_0000178 | Ga0373934_0000178_13791_14228 | 143 |
| 681 | 3300035086 | Ga0373934_0117000 | Ga0373934_0117000_482_922 | 143 |
| 682 | 3300035086 | Ga0373934_0148985 | Ga0373934_0148985_11_463 | 143 |
| 683 | 3300035088 | Ga0373940_0194261 | Ga0373940_0194261_158_589 | 143 |
| 684 | 3300035090 | Ga0373949_0013622 | Ga0373949_0013622_925_1356 | 143 |
| 685 | 3300035111 | Ga0373923_0136030 | Ga0373923_0136030_117_569 | 143 |
| 686 | 3300035111 | Ga0373923_0179470 | Ga0373923_0179470_62_502 | 143 |
| 687 | 3300035111 | Ga0373923_0313732 | Ga0373923_0313732_150_581 | 143 |
| 688 | 3300035111 | Ga0373923_0394451 | Ga0373923_0394451_140_571 | 143 |
| 689 | 3300035111 | Ga0373923_0480089 | Ga0373923_0480089_56_490 | 143 |
| 690 | 3300035114 | Ga0373939_0071112 | Ga0373939_0071112_608_1039 | 143 |
| 691 | 3300035114 | Ga0373939_0327359 | Ga0373939_0327359_109_540 | 143 |
| 692 | 3300035115 | Ga0373941_0120095 | Ga0373941_0120095_309_740 | 143 |
| 693 | 3300035117 | Ga0373953_0000084 | Ga0373953_0000084_20423_20860 | 143 |
| 694 | 3300035117 | Ga0373953_0031819 | Ga0373953_0031819_1298_1738 | 143 |
| 695 | 3300035117 | Ga0373953_0098302 | Ga0373953_0098302_138_572 | 143 |
| 696 | 3300035118 | Ga0373954_0003839 | Ga0373954_0003839_2804_3241 | 143 |
| 697 | 3300035118 | Ga0373954_0041490 | Ga0373954_0041490_168_608 | 143 |
| 698 | 3300035118 | Ga0373954_0532331 | Ga0373954_0532331_108_539 | 143 |
| 699 | 3300035119 | Ga0373956_0000007 | Ga0373956_0000007_29088_29525 | 143 |
| 700 | 3300035119 | Ga0373956_0026014 | Ga0373956_0026014_342_794 | 143 |
| 701 | 3300035119 | Ga0373956_0338483 | Ga0373956_0338483_173_607 | 143 |
| 702 | 3300035120 | Ga0373957_0000024 | Ga0373957_0000024_9821_10258 | 143 |
| 703 | 3300035120 | Ga0373957_0105863 | Ga0373957_0105863_221_661 | 143 |
| 704 | 3300035120 | Ga0373957_0343265 | Ga0373957_0343265_91_525 | 143 |
| 705 | 3300035120 | Ga0373957_0460855 | Ga0373957_0460855_53_484 | 143 |
| 706 | 3300035171 | Ga0373946_0213227 | Ga0373946_0213227_440_880 | 143 |
| 707 | 3300035172 | Ga0373955_0000007 | Ga0373955_0000007_25757_26194 | 143 |
| 708 | 3300035172 | Ga0373955_0066861 | Ga0373955_0066861_14_445 | 143 |
| 709 | 3300035172 | Ga0373955_0127993 | Ga0373955_0127993_840_1292 | 143 |
| 710 | 3300035172 | Ga0373955_0206105 | Ga0373955_0206105_350_790 | 143 |
| 711 | 3300035207 | Ga0373942_0047809 | Ga0373942_0047809_130_561 | 143 |
| 712 | 3300035241 | Ga0373961_0029012 | Ga0373961_0029012_38_469 | 143 |
| 713 | 3300035410 | Ga0373924_0003234 | Ga0373924_0003234_760_1200 | 143 |
| 714 | 3300035410 | Ga0373924_0005522 | Ga0373924_0005522_105_539 | 143 |
| 715 | 3300035410 | Ga0373924_0021111 | Ga0373924_0021111_1722_2159 | 143 |
| 716 | 3300035410 | Ga0373924_0335527 | Ga0373924_0335527_187_618 | 143 |
| 717 | 3300035691 | Ga0373931_0588235 | Ga0373931_0588235_156_587 | 143 |
| 718 | 3300035692 | Ga0373935_0058944 | Ga0373935_0058944_1958_2410 | 143 |
| 719 | 3300035692 | Ga0373935_0232599 | Ga0373935_0232599_575_1015 | 143 |
| 720 | 3300035692 | Ga0373935_0357506 | Ga0373935_0357506_455_886 | 143 |
| 721 | 3300035692 | Ga0373935_0792642 | Ga0373935_0792642_105_536 | 143 |
| 722 | 3300035692 | Ga0373935_1025005 | Ga0373935_1025005_101_541 | 143 |
| 723 | 3300035695 | Ga0373927_0040668 | Ga0373927_0040668_90_542 | 143 |
| 724 | 3300035724 | Ga0373933_0000002 | Ga0373933_0000002_89599_90036 | 143 |
| 725 | 3300035724 | Ga0373933_0010125 | Ga0373933_0010125_3182_3622 | 143 |
| 726 | 3300035724 | Ga0373933_0099864 | Ga0373933_0099864_871_1323 | 143 |
| 727 | 3300035724 | Ga0373933_0377478 | Ga0373933_0377478_137_589 | 143 |
| 728 | 3300035724 | Ga0373933_0555170 | Ga0373933_0555170_211_642 | 143 |
| 729 | 3300035725 | Ga0373947_0045765 | Ga0373947_0045765_1587_2039 | 143 |
| 730 | 3300036401 | Ga0373937_0000014 | Ga0373937_0000014_61750_62187 | 143 |
| 731 | 3300036401 | Ga0373937_0045905 | Ga0373937_0045905_2679_3131 | 143 |
| 732 | 3300036401 | Ga0373937_0129547 | Ga0373937_0129547_1578_2030 | 143 |
| 733 | 3300036401 | Ga0373937_0251406 | Ga0373937_0251406_21_452 | 143 |
| 734 | 3300036401 | Ga0373937_0314424 | Ga0373937_0314424_944_1378 | 143 |
| 735 | 3300036401 | Ga0373937_0472999 | Ga0373937_0472999_532_972 | 143 |
| 736 | 3300036401 | Ga0373937_1277377 | Ga0373937_1277377_145_579 | 143 |
| 737 | 3300036457 | Ga0265778_005647 | Ga0265778_005647_867_1307 | 143 |
| 738 | 3300037068 | Ga0373925_0000373 | Ga0373925_0000373_7958_8407 | 143 |
| 739 | 3300037068 | Ga0373925_0001704 | Ga0373925_0001704_2957_3394 | 143 |
| 740 | 3300037068 | Ga0373925_0014582 | Ga0373925_0014582_366_818 | 143 |
| 741 | 3300037068 | Ga0373925_0044387 | Ga0373925_0044387_1664_2107 | 143 |
| 742 | 3300037068 | Ga0373925_1148892 | Ga0373925_1148892_156_608 | 143 |
| 743 | 3300037853 | Ga0436364_0037108 | Ga0436364_0037108_6662_7102 | 143 |
| 744 | 3300037853 | Ga0436364_0787453 | Ga0436364_0787453_331_768 | 143 |
| 745 | 3300046454 | Ga0495592_0000077 | Ga0495592_0000077_23651_24088 | 143 |
| 746 | 3300046454 | Ga0495592_0207603 | Ga0495592_0207603_760_1200 | 143 |
| 747 | 3300046454 | Ga0495592_0218829 | Ga0495592_0218829_53_487 | 143 |
| 748 | 3300046454 | Ga0495592_0837131 | Ga0495592_0837131_14_445 | 143 |
| 749 | 3300046461 | Ga0495641_0446907 | Ga0495641_0446907_81_515 | 143 |
| 750 | 3300046462 | Ga0495651_0000019 | Ga0495651_0000019_61750_62187 | 143 |
| 751 | 3300046462 | Ga0495651_0011292 | Ga0495651_0011292_6067_6519 | 143 |
| 752 | 3300046462 | Ga0495651_0087391 | Ga0495651_0087391_370_801 | 143 |
| 753 | 3300046462 | Ga0495651_0345108 | Ga0495651_0345108_492_932 | 143 |
| 754 | 3300046462 | Ga0495651_0626085 | Ga0495651_0626085_178_612 | 143 |
| 755 | 3300046463 | Ga0495653_0000252 | Ga0495653_0000252_7557_7994 | 143 |
| 756 | 3300046463 | Ga0495653_0010757 | Ga0495653_0010757_353_805 | 143 |
| 757 | 3300046463 | Ga0495653_0117177 | Ga0495653_0117177_1229_1660 | 143 |
| 758 | 3300046463 | Ga0495653_0165935 | Ga0495653_0165935_945_1385 | 143 |
| 759 | 3300046463 | Ga0495653_0303146 | Ga0495653_0303146_530_982 | 143 |
| 760 | 3300046463 | Ga0495653_0517388 | Ga0495653_0517388_152_712 | 143 |
| 761 | 3300046463 | Ga0495653_0570295 | Ga0495653_0570295_93_527 | 143 |
| 762 | 3300046477 | Ga0495664_0027093 | Ga0495664_0027093_360_812 | 143 |
| 763 | 3300046477 | Ga0495664_0181731 | Ga0495664_0181731_535_1008 | 143 |
| 764 | 3300046477 | Ga0495664_0216956 | Ga0495664_0216956_285_725 | 143 |
| 765 | 3300046477 | Ga0495664_0241888 | Ga0495664_0241888_409_861 | 143 |
| 766 | 3300046477 | Ga0495664_0263247 | Ga0495664_0263247_411_851 | 143 |
| 767 | 3300046477 | Ga0495664_0526357 | Ga0495664_0526357_61_492 | 143 |
| 768 | 3300046511 | Ga0495608_0000028 | Ga0495608_0000028_89591_90028 | 143 |
| 769 | 3300046511 | Ga0495608_0120100 | Ga0495608_0120100_1099_1533 | 143 |
| 770 | 3300046511 | Ga0495608_0151698 | Ga0495608_0151698_822_1262 | 143 |
| 771 | 3300046511 | Ga0495608_0292448 | Ga0495608_0292448_187_627 | 143 |
| 772 | 3300046514 | Ga0495618_0139021 | Ga0495618_0139021_625_1065 | 143 |
| 773 | 3300046514 | Ga0495618_0242575 | Ga0495618_0242575_401_832 | 143 |
| 774 | 3300046514 | Ga0495618_0297745 | Ga0495618_0297745_196_648 | 143 |
| 775 | 3300046516 | Ga0495628_0000337 | Ga0495628_0000337_32023_32460 | 143 |
| 776 | 3300046516 | Ga0495628_0025055 | Ga0495628_0025055_3825_4277 | 143 |
| 777 | 3300046516 | Ga0495628_0176967 | Ga0495628_0176967_1169_1600 | 143 |
| 778 | 3300046516 | Ga0495628_0221717 | Ga0495628_0221717_345_797 | 143 |
| 779 | 3300046516 | Ga0495628_0240418 | Ga0495628_0240418_691_1125 | 143 |
| 780 | 3300046516 | Ga0495628_0479676 | Ga0495628_0479676_86_517 | 143 |
| 781 | 3300046516 | Ga0495628_0797776 | Ga0495628_0797776_22_474 | 143 |
| 782 | 3300046517 | Ga0495630_0364152 | Ga0495630_0364152_270_710 | 143 |
| 783 | 3300046517 | Ga0495630_0871694 | Ga0495630_0871694_151_582 | 143 |
| 784 | 3300046517 | Ga0495630_0891594 | Ga0495630_0891594_81_512 | 143 |
| 785 | 3300046517 | Ga0495630_1313459 | Ga0495630_1313459_94_531 | 143 |
| 786 | 3300046529 | Ga0495652_0000031 | Ga0495652_0000031_89579_90016 | 143 |
| 787 | 3300046529 | Ga0495652_0007308 | Ga0495652_0007308_2101_2553 | 143 |
| 788 | 3300046529 | Ga0495652_0112765 | Ga0495652_0112765_877_1317 | 143 |
| 789 | 3300046529 | Ga0495652_0137619 | Ga0495652_0137619_1298_1732 | 143 |
| 790 | 3300046529 | Ga0495652_0158058 | Ga0495652_0158058_1174_1650 | 143 |
| 791 | 3300046529 | Ga0495652_0180700 | Ga0495652_0180700_984_1415 | 143 |
| 792 | 3300046529 | Ga0495652_0844350 | Ga0495652_0844350_48_479 | 143 |
| 793 | 3300046533 | Ga0495640_0020499 | Ga0495640_0020499_2500_2952 | 143 |
| 794 | 3300046533 | Ga0495640_0036929 | Ga0495640_0036929_648_1100 | 143 |
| 795 | 3300046533 | Ga0495640_0125737 | Ga0495640_0125737_754_1194 | 143 |
| 796 | 3300046533 | Ga0495640_0570823 | Ga0495640_0570823_53_484 | 143 |
| 797 | 3300046535 | Ga0495586_0235443 | Ga0495586_0235443_129_560 | 143 |
| 798 | 3300046535 | Ga0495586_0321362 | Ga0495586_0321362_376_807 | 143 |
| 799 | 3300046535 | Ga0495586_0461387 | Ga0495586_0461387_200_640 | 143 |
| 800 | 3300046536 | Ga0495587_0000023 | Ga0495587_0000023_61728_62165 | 143 |
| 801 | 3300046536 | Ga0495587_0038095 | Ga0495587_0038095_2244_2675 | 143 |
| 802 | 3300046536 | Ga0495587_0150278 | Ga0495587_0150278_201_641 | 143 |
| 803 | 3300046536 | Ga0495587_0168066 | Ga0495587_0168066_466_918 | 143 |
| 804 | 3300046536 | Ga0495587_0246748 | Ga0495587_0246748_399_830 | 143 |
| 805 | 3300046536 | Ga0495587_0485569 | Ga0495587_0485569_87_521 | 143 |
| 806 | 3300046543 | Ga0495645_0200680 | Ga0495645_0200680_629_1081 | 143 |
| 807 | 3300046543 | Ga0495645_0358643 | Ga0495645_0358643_462_896 | 143 |
| 808 | 3300046543 | Ga0495645_0608445 | Ga0495645_0608445_81_521 | 143 |
| 809 | 3300046559 | Ga0495667_0000054 | Ga0495667_0000054_89591_90028 | 143 |
| 810 | 3300046559 | Ga0495667_0025502 | Ga0495667_0025502_611_1042 | 143 |
| 811 | 3300046559 | Ga0495667_0176125 | Ga0495667_0176125_876_1328 | 143 |
| 812 | 3300046559 | Ga0495667_0249565 | Ga0495667_0249565_619_1059 | 143 |
| 813 | 3300046559 | Ga0495667_0433992 | Ga0495667_0433992_323_775 | 143 |
| 814 | 3300046559 | Ga0495667_0990582 | Ga0495667_0990582_18_449 | 143 |
| 815 | 3300046642 | Ga0495634_0073656 | Ga0495634_0073656_118_558 | 143 |
| 816 | 3300046663 | Ga0495635_0028679 | Ga0495635_0028679_3406_3858 | 143 |
| 817 | 3300046663 | Ga0495635_0056438 | Ga0495635_0056438_1389_1841 | 143 |
| 818 | 3300046663 | Ga0495635_0224288 | Ga0495635_0224288_367_807 | 143 |
| 819 | 3300046675 | Ga0495657_0000022 | Ga0495657_0000022_89599_90036 | 143 |
| 820 | 3300046675 | Ga0495657_0034083 | Ga0495657_0034083_374_826 | 143 |
| 821 | 3300046675 | Ga0495657_0081932 | Ga0495657_0081932_1568_1999 | 143 |
| 822 | 3300046675 | Ga0495657_0141062 | Ga0495657_0141062_209_649 | 143 |
| 823 | 3300046675 | Ga0495657_0160676 | Ga0495657_0160676_252_692 | 143 |
| 824 | 3300046675 | Ga0495657_0290507 | Ga0495657_0290507_86_520 | 143 |
| 825 | 3300046675 | Ga0495657_0309586 | Ga0495657_0309586_155_586 | 143 |
| 826 | 3300046678 | Ga0495599_0000125 | Ga0495599_0000125_36240_36677 | 143 |
| 827 | 3300046678 | Ga0495599_0139996 | Ga0495599_0139996_624_1076 | 143 |
| 828 | 3300046678 | Ga0495599_0227269 | Ga0495599_0227269_621_1061 | 143 |
| 829 | 3300046678 | Ga0495599_0342355 | Ga0495599_0342355_249_689 | 143 |
| 830 | 3300046679 | Ga0495623_0000797 | Ga0495623_0000797_9155_9592 | 143 |
| 831 | 3300046680 | Ga0495646_0028041 | Ga0495646_0028041_2414_2851 | 143 |
| 832 | 3300046680 | Ga0495646_0373425 | Ga0495646_0373425_235_675 | 143 |
| 833 | 3300046683 | Ga0495658_0645519 | Ga0495658_0645519_188_619 | 143 |
| 834 | 3300046689 | Ga0495613_0879351 | Ga0495613_0879351_76_516 | 143 |
| 835 | 3300046690 | Ga0495624_0591969 | Ga0495624_0591969_35_475 | 143 |
| 836 | 3300046809 | Ga0495600_0040792 | Ga0495600_0040792_1004_1441 | 143 |
| 837 | 3300046809 | Ga0495600_0063555 | Ga0495600_0063555_344_796 | 143 |
| 838 | 3300046809 | Ga0495600_0159285 | Ga0495600_0159285_862_1302 | 143 |
| 839 | 3300047317 | Ga0495604_0000022 | Ga0495604_0000022_89558_89995 | 143 |
| 840 | 3300047317 | Ga0495604_0002956 | Ga0495604_0002956_2067_2519 | 143 |
| 841 | 3300047317 | Ga0495604_0107071 | Ga0495604_0107071_1375_1806 | 143 |
| 842 | 3300047317 | Ga0495604_0246550 | Ga0495604_0246550_635_1069 | 143 |
| 843 | 3300047317 | Ga0495604_0272387 | Ga0495604_0272387_563_1003 | 143 |
| 844 | 3300047319 | Ga0495674_0003502 | Ga0495674_0003502_4790_5242 | 143 |
| 845 | 3300047319 | Ga0495674_0119975 | Ga0495674_0119975_823_1263 | 143 |
| 846 | 3300047319 | Ga0495674_0122790 | Ga0495674_0122790_1523_1963 | 143 |
| 847 | 3300047319 | Ga0495674_0610323 | Ga0495674_0610323_185_619 | 143 |
| 848 | 3300047321 | Ga0495676_0471218 | Ga0495676_0471218_188_640 | 143 |
| 849 | 3300047322 | Ga0495680_0000154 | Ga0495680_0000154_37128_37565 | 143 |
| 850 | 3300047322 | Ga0495680_0035570 | Ga0495680_0035570_2754_3194 | 143 |
| 851 | 3300047322 | Ga0495680_0044489 | Ga0495680_0044489_498_932 | 143 |
| 852 | 3300047322 | Ga0495680_0472025 | Ga0495680_0472025_154_585 | 143 |
| 853 | 3300047322 | Ga0495680_0756159 | Ga0495680_0756159_157_588 | 143 |
| 854 | 3300047444 | Ga0495675_0000235 | Ga0495675_0000235_17739_18176 | 143 |
| 855 | 3300047444 | Ga0495675_0060940 | Ga0495675_0060940_1307_1738 | 143 |
| 856 | 3300047444 | Ga0495675_0093748 | Ga0495675_0093748_1347_1799 | 143 |
| 857 | 3300047444 | Ga0495675_0716074 | Ga0495675_0716074_93_527 | 143 |
| 858 | 3300047471 | Ga0495684_0057283 | Ga0495684_0057283_2170_2622 | 143 |
| 859 | 3300047471 | Ga0495684_0648246 | Ga0495684_0648246_118_558 | 143 |
| 860 | 3300047471 | Ga0495684_0673310 | Ga0495684_0673310_230_661 | 143 |
| 861 | 3300047471 | Ga0495684_0935619 | Ga0495684_0935619_39_470 | 143 |
| 862 | 3300048088 | Ga0495602_0000251 | Ga0495602_0000251_1019_1456 | 143 |
| 863 | 3300048088 | Ga0495602_0031790 | Ga0495602_0031790_3580_4011 | 143 |
| 864 | 3300048088 | Ga0495602_0078803 | Ga0495602_0078803_2260_2712 | 143 |
| 865 | 3300048088 | Ga0495602_0308311 | Ga0495602_0308311_657_1130 | 143 |
| 866 | 3300048088 | Ga0495602_0490428 | Ga0495602_0490428_267_701 | 143 |
| 867 | 3300048088 | Ga0495602_0563992 | Ga0495602_0563992_81_521 | 143 |
| 868 | 3300048903 | Ga0496100_1068297 | Ga0496100_1068297_77_508 | 143 |
| 869 | 3300048903 | Ga0496100_1177138 | Ga0496100_1177138_146_577 | 143 |
| 870 | 3300048904 | Ga0496101_0284736 | Ga0496101_0284736_769_1200 | 143 |
| 871 | 3300048905 | Ga0496102_0383507 | Ga0496102_0383507_709_1140 | 143 |
| 872 | 3300048906 | Ga0496103_0480845 | Ga0496103_0480845_193_624 | 143 |
| 873 | 3300048907 | Ga0496104_1001737 | Ga0496104_1001737_112_543 | 143 |
| 874 | 3300048908 | Ga0496105_0296952 | Ga0496105_0296952_813_1244 | 143 |
| 875 | 3300048908 | Ga0496105_0734781 | Ga0496105_0734781_185_616 | 143 |
| 876 | 3300048909 | Ga0496106_0248619 | Ga0496106_0248619_441_872 | 143 |
| 877 | 3300048909 | Ga0496106_0776858 | Ga0496106_0776858_107_538 | 143 |
| 878 | 3300048911 | Ga0496108_0822512 | Ga0496108_0822512_207_638 | 143 |
| 879 | 3300048911 | Ga0496108_1287560 | Ga0496108_1287560_41_472 | 143 |
| 880 | 3300048912 | Ga0496109_0332485 | Ga0496109_0332485_342_773 | 143 |
| 881 | 3300048913 | Ga0496110_0986764 | Ga0496110_0986764_123_554 | 143 |
| 882 | 3300048914 | Ga0496111_0180004 | Ga0496111_0180004_855_1286 | 143 |
| 883 | 3300048915 | Ga0496112_0474127 | Ga0496112_0474127_566_997 | 143 |
| 884 | 3300048915 | Ga0496112_0596566 | Ga0496112_0596566_75_506 | 143 |
| 885 | 3300048916 | Ga0496113_0688241 | Ga0496113_0688241_257_688 | 143 |
| 886 | 3300048917 | Ga0496114_0619402 | Ga0496114_0619402_305_736 | 143 |
| 887 | 3300048918 | Ga0496115_0074354 | Ga0496115_0074354_1350_1787 | 143 |
| 888 | 3300048929 | Ga0496126_0007521 | Ga0496126_0007521_7327_7848 | 143 |
| 889 | 3300048929 | Ga0496126_0027096 | Ga0496126_0027096_1493_1930 | 143 |
| 890 | 3300050513 | nmdc:mga0rr50_453393_c1 | nmdc:mga0rr50_453393_c1_490_921 | 143 |
| 891 | 3300050515 | nmdc:mga0a205_169598_c1 | nmdc:mga0a205_169598_c1_1413_1844 | 143 |
| 892 | 3300053077 | Ga0495601_0053364 | Ga0495601_0053364_941_1393 | 143 |
| 893 | 3300053078 | Ga0495612_0037716 | Ga0495612_0037716_900_1352 | 143 |
| 894 | 3300053078 | Ga0495612_0192636 | Ga0495612_0192636_61_534 | 143 |
| 895 | 3300053078 | Ga0495612_0426118 | Ga0495612_0426118_48_482 | 143 |
| 896 | 3300053084 | Ga0495595_0024435 | Ga0495595_0024435_243_680 | 143 |
| 897 | 3300053084 | Ga0495595_0143843 | Ga0495595_0143843_118_549 | 143 |
| 898 | 3300053085 | Ga0495619_0371497 | Ga0495619_0371497_306_758 | 143 |
| 899 | 3300053085 | Ga0495619_0873685 | Ga0495619_0873685_79_510 | 143 |
| 900 | 3300059477 | Ga0587084_022021 | Ga0587084_022021_34_465 | 143 |
| 901 | 3300059490 | Ga0587066_054018 | Ga0587066_054018_257_688 | 143 |
| 902 | 3300059626 | Ga0587115_088045 | Ga0587115_088045_111_542 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ab7-assembly2.cif.gz_A | crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 | 0.8276 | 4 | 140 |
| 3cis-assembly3.cif.gz_F | the crystal structure of rv2623 from mycobacterium tuberculosis | 0.8099 | 1 | 141 |
| 2z08-assembly1.cif.gz_A | crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 | 0.8085 | 4 | 139 |
| 2jax-assembly1.cif.gz_A-2 | universal stress protein rv2623 from mycobaterium tuberculosis | 0.797 | 3 | 142 |
| 6hcd-assembly2.cif.gz_D | structure of universal stress protein from archaeoglobus fulgidus | 0.7858 | 1 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFD7_1_148_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8439 | 3 | 138 | 3.40.50.620 |
| af_P9WFD7_1_148_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8013 | 3 | 138 | 3.40.50.620 |
| 2jaxA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7933 | 3 | 139 | 3.40.50.620 |
| af_P9WFD9_1_145_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7899 | 2 | 143 | 3.40.50.620 |
| af_Q5A0W0_283_438_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7896 | 2 | 143 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A358SK79-F1-model_v4 | Universal stress protein UspA | 0.8986 | 1 | 143 |
|
| AF-A0A358SK79-F1-model_v4 | Universal stress protein UspA | 0.8926 | 1 | 143 |
|
| AF-A0A498DQY1-F1-model_v4 | Universal stress protein | 0.8644 | 4 | 143 |
|
| AF-A0A1I4HM48-F1-model_v4 | Universal stress protein family protein | 0.8637 | 2 | 143 |
|
| AF-A0A229RHI3-F1-model_v4 | Universal stress protein | 0.8565 | 2 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar