F484651

General Info

Members Datasets Scaffolds Average Seq Length
885 315 1770 337

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10003366|Ga0065714_100033665
Length 357
Sequence MKTSFTQQEIKVTFCTVSSSLLLCSSMEVQAGPAADEATPWYRQDVPVMTLPAVTFTAPYSRRFSAASDTRSSRLTIEDAAPSAWDQVYGQASRQAQTDVLAQGFAGPGSSEFKGPAILTLKSGSGHTQRVGLVGGTTQLQGNSNGLLTGRAHADPRHDTLSLEGQSLGAYWSLTGPQGWHVDLTASGGRVNGYTRNDQGARMATEGSAVTLSVEGGFPIGLSDNWVVEPQAQLINQRITLDTPYGGSGNASSSELTSWSGRVGARLKGSYDINGLGVEPYVRTNLWHTVYTGNTVNLXQVEKISSSRYSSTVEVGLGLVARVTPAVSLYVSADYSSDVDDNDLNGLIGSLGVRMRW

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
53 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
63 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
64 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
65 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
69 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
70 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
71 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
72 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
73 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
74 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
75 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
76 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
77 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
78 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
79 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
80 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
87 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
88 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
89 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
182 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
183 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
186 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
189 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
192 2511231004 Pseudomonas sp. GM102 Isolate Nodule
193 2511231006 Pseudomonas sp. GM17 Isolate Nodule
194 2511231007 Pseudomonas sp. GM18 Isolate Nodule
195 2511231008 Pseudomonas sp. GM21 Isolate Nodule
196 2511231010 Pseudomonas sp. GM25 Isolate Nodule
197 2511231011 Pseudomonas sp. GM30 Isolate Nodule
198 2511231012 Pseudomonas sp. GM33 Isolate Nodule
199 2511231014 Pseudomonas sp. GM48 Isolate Nodule
200 2511231016 Pseudomonas sp. GM50 Isolate Nodule
201 2511231017 Pseudomonas sp. GM55 Isolate Nodule
202 2511231018 Pseudomonas sp. GM60 Isolate Nodule
203 2511231019 Pseudomonas sp. GM67 Isolate Nodule
204 2511231021 Pseudomonas sp. GM78 Isolate Nodule
205 2511231022 Pseudomonas sp. GM79 Isolate Nodule
206 2511231023 Pseudomonas sp. GM80 Isolate Nodule
207 2511231031 Pseudomonas sp. GM16 Isolate Nodule
208 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
209 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
210 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
211 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
212 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
213 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
214 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
215 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
216 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
217 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
218 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
219 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
220 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
221 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
222 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
223 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
224 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
225 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
226 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
227 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
228 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
229 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
230 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
231 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
232 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
233 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
234 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
235 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
236 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
237 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
238 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
239 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
240 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
241 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
242 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
243 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
244 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
245 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
246 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
247 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
248 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
249 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
250 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
251 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
252 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
253 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
254 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
255 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
256 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
257 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
258 2773857670 Pseudomonas sp. 478 Isolate Unclassified
259 2773857673 Pseudomonas sp. 443 Isolate Unclassified
260 2784132063 Pseudomonas sp. 424 Isolate Unclassified
261 2784132072 Pseudomonas sp. 460 Isolate Unclassified
262 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
263 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
264 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
265 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
266 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
267 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
268 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
269 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
270 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
271 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
272 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
273 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
274 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
275 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
276 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
277 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
278 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
279 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
280 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
281 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
282 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
283 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
284 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
285 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
286 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
287 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
288 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
289 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
290 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
291 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
292 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
293 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
294 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
295 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
296 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
297 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
298 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
299 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
300 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
301 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
302 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
303 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
304 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
305 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
306 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
307 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
308 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
309 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
310 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
311 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
312 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
313 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
314 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
315 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.99
Metatranscriptomes 0
Isolates 14.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 1.92
Rhizoplane 4.97
Rhizosphere 82.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10003366 3300005288 Bacteria 8611
2 MRS2a_Contig_6196 2124908027 Bacteria 2582
3 MRS2a_Contig_6968 2124908027 Bacteria 9994
4 SwRhRL2b_contig_147174 2162886007 Bacteria 4220
5 JGI25162J39368_1000051 3300002737 Bacteria 156765
6 JGI25163J39215_1000030 3300002771 Bacteria 65586
7 JGI25164J39214_1000027 3300002772 Bacteria 156759
8 JGI25165J46597_1000101 3300003214 Bacteria 156765
9 Ga0055536_1000014 3300003781 Bacteria 240624
10 Ga0055530_10000009 3300003791 Bacteria 174044
11 Ga0055530_10000011 3300003791 Bacteria 170218
12 Ga0055530_10000321 3300003791 Bacteria 43445
13 Ga0055540_1000006 3300003792 Bacteria 372018
14 Ga0055540_1000034 3300003792 Bacteria 170218
15 Ga0055540_1000563 3300003792 Bacteria 27320
16 Ga0055531_10000099 3300003794 Bacteria 93823
17 Ga0065714_10008244 3300005288 Bacteria 3015
18 Ga0065714_10017945 3300005288 Bacteria 2267
19 Ga0065714_10064563 3300005288 Bacteria 35434
20 Ga0065714_10095959 3300005288 Bacteria 1773
21 Ga0065714_10098354 3300005288 Bacteria 1712
22 Ga0065714_10143167 3300005288 Bacteria 1157
23 Ga0065704_10072463 3300005289 Bacteria 8479
24 Ga0065712_10000471 3300005290 Bacteria 18240
25 Ga0065715_10114243 3300005293 Bacteria 2458
26 Ga0075364_10147738 3300006051 Bacteria 1583
27 Ga0075432_10000516 3300006058 Bacteria 11605
28 Ga0075432_10005726 3300006058 Bacteria 4231
29 Ga0075432_10006429 3300006058 Bacteria 3998
30 Ga0075432_10013961 3300006058 Bacteria 2734
31 Ga0075432_10019797 3300006058 Bacteria 2300
32 Ga0075436_100204913 3300006914 Bacteria 1397
33 Ga0079104_1007429 3300006946 Bacteria 3977
34 Ga0105251_10009612 3300009011 Bacteria 5694
35 Ga0105251_10025050 3300009011 Bacteria 3056
36 Ga0105251_10026388 3300009011 Bacteria 2958
37 Ga0105251_10132442 3300009011 Bacteria 1130
38 Ga0105244_10001644 3300009036 Bacteria 17691
39 Ga0105244_10007454 3300009036 Bacteria 6956
40 Ga0105244_10011328 3300009036 Bacteria 5358
41 Ga0105244_10017861 3300009036 Bacteria 3997
42 Ga0105244_10024808 3300009036 Bacteria 3267
43 Ga0105244_10059183 3300009036 Bacteria 1932
44 Ga0105250_10005927 3300009092 Bacteria 5404
45 Ga0105250_10052348 3300009092 Bacteria 1638
46 Ga0105243_10000026 3300009148 Bacteria 191522
47 Ga0105246_10000479 3300011119 Bacteria 21552
48 Ga0157345_1000015 3300012498 Bacteria 48949
49 Ga0157373_10000389 3300013100 Bacteria 35149
50 Ga0157373_10001066 3300013100 Bacteria 21062
51 Ga0157373_10033464 3300013100 Bacteria 3698
52 Ga0157373_10060306 3300013100 Bacteria 2688
53 Ga0157371_10000142 3300013102 Bacteria 103825
54 Ga0157371_10019685 3300013102 Bacteria 4972
55 Ga0157370_10025310 3300013104 Bacteria 5874
56 Ga0157370_10026738 3300013104 Bacteria 5693
57 Ga0157370_10028241 3300013104 Bacteria 5522
58 Ga0157370_10142940 3300013104 Bacteria 2229
59 Ga0157370_10153216 3300013104 Bacteria 2144
60 Ga0157370_10178016 3300013104 Bacteria 1977
61 Ga0157370_10211833 3300013104 Bacteria 1796
62 Ga0157370_10265030 3300013104 Bacteria 1587
63 Ga0157369_10001032 3300013105 Bacteria 35169
64 Ga0163162_10015509 3300013306 Bacteria 7447
65 Ga0163162_10065239 3300013306 Bacteria 3688
66 Ga0157372_10083845 3300013307 Bacteria 3611
67 Ga0157375_10098906 3300013308 Bacteria 2995
68 Ga0157375_10177426 3300013308 Bacteria 2281
69 Ga0182008_10010134 3300014497 Bacteria 5053
70 Ga0182008_10012908 3300014497 Bacteria 4398
71 Ga0182008_10017092 3300014497 Bacteria 3764
72 Ga0182006_1000459 3300015261 Bacteria 32081
73 Ga0182006_1002339 3300015261 Bacteria 10422
74 Ga0182006_1004629 3300015261 Bacteria 6739
75 Ga0182006_1006943 3300015261 Bacteria 5212
76 Ga0182006_1009795 3300015261 Bacteria 4285
77 Ga0182006_1010767 3300015261 Bacteria 4051
78 Ga0182006_1014867 3300015261 Bacteria 3348
79 Ga0182006_1031794 3300015261 Bacteria 2125
80 Ga0182006_1064774 3300015261 Bacteria 1370
81 Ga0182007_10000087 3300015262 Bacteria 68528
82 Ga0182007_10004442 3300015262 Bacteria 6356
83 Ga0182007_10022700 3300015262 Bacteria 2213
84 Ga0182005_1003168 3300015265 Bacteria 5634
85 Ga0182005_1004198 3300015265 Bacteria 4707
86 Ga0182005_1015429 3300015265 Bacteria 2131
87 Ga0182005_1019406 3300015265 Bacteria 1874
88 Ga0182005_1024112 3300015265 Bacteria 1663
89 Ga0182005_1030268 3300015265 Bacteria 1475
90 Ga0163161_10004310 3300017792 Bacteria 9911
91 Ga0163161_10006120 3300017792 Bacteria 8336
92 Ga0163161_10007695 3300017792 Bacteria 7452
93 Ga0163161_10017073 3300017792 Bacteria 5077
94 Ga0163161_10026691 3300017792 Bacteria 4092
95 Ga0163161_10028547 3300017792 Bacteria 3963
96 Ga0163161_10052010 3300017792 Bacteria 2969
97 Ga0209760_100014 3300025207 Bacteria 177898
98 Ga0207427_100011 3300025231 Bacteria 640076
99 Ga0209437_100025 3300025233 Bacteria 561333
100 Ga0209233_1000012 3300025261 Bacteria 1019519
101 Ga0209675_1004493 3300025291 Bacteria 6181
102 Ga0209676_1000002 3300025292 Bacteria 1732948
103 Ga0209676_1000003 3300025292 Bacteria 1454178
104 Ga0209676_1000158 3300025292 Bacteria 162469
105 Ga0209676_1014476 3300025292 Bacteria 2962
106 Ga0209050_1000004 3300025298 Bacteria 1600040
107 Ga0209050_1000006 3300025298 Bacteria 1359702
108 Ga0209050_1000013 3300025298 Bacteria 811408
109 Ga0209051_1000001 3300025303 Bacteria 1732974
110 Ga0209051_1000006 3300025303 Bacteria 1015785
111 Ga0209051_1000007 3300025303 Bacteria 811408
112 Ga0209257_1000029 3300025304 Bacteria 695617
113 Ga0209257_1037227 3300025304 Bacteria 1485
114 Ga0207696_1000211 3300025711 Bacteria 87942
115 Ga0207696_1000724 3300025711 Bacteria 22166
116 Ga0207696_1004104 3300025711 Bacteria 6371
117 Ga0207655_1000518 3300025728 Bacteria 49081
118 Ga0207655_1001701 3300025728 Bacteria 19364
119 Ga0207655_1001944 3300025728 Bacteria 17675
120 Ga0207655_1012143 3300025728 Bacteria 5061
121 Ga0207655_1012773 3300025728 Bacteria 4871
122 Ga0207713_1000275 3300025735 Bacteria 61536
123 Ga0207713_1001425 3300025735 Bacteria 19142
124 Ga0207713_1003617 3300025735 Bacteria 10414
125 Ga0207713_1019393 3300025735 Bacteria 3328
126 Ga0207713_1033635 3300025735 Bacteria 2237
127 Ga0207664_10070019 3300025929 Bacteria 2822
128 Ga0207709_10000004 3300025935 Bacteria 825156
129 Ga0207428_10002235 3300027907 Bacteria 19448
130 Ga0207428_10047841 3300027907 Bacteria 3434
131 Ga0316178_1009025 3300030735 Bacteria 5670
132 Ga0316181_1207328 3300030744 Bacteria 5756
133 Ga0307408_100002061 3300031548 Bacteria 14465
134 Ga0307408_100003529 3300031548 Bacteria 10646
135 Ga0307408_100026372 3300031548 Bacteria 3991
136 Ga0307408_100074742 3300031548 Bacteria 2515
137 Ga0307405_10004405 3300031731 Bacteria 6655
138 Ga0307406_10308826 3300031901 Bacteria 1218
139 Ga0307412_10001133 3300031911 Bacteria 15255
140 Ga0307412_10013732 3300031911 Bacteria 4757
141 Ga0307412_10048830 3300031911 Bacteria 2785
142 Ga0307409_100074834 3300031995 Bacteria 2708
143 Ga0307414_10004414 3300032004 Bacteria 7640
144 Ga0307411_10292862 3300032005 Bacteria 1301
145 Ga0307510_10006853 3300033180 Bacteria 13589
146 Ga0439438_000823 3300041405 Bacteria 13883
147 Ga0439438_001395 3300041405 Bacteria 10651
148 Ga0439438_001998 3300041405 Bacteria 8906
149 Ga0439438_003513 3300041405 Bacteria 6324
150 Ga0439438_005068 3300041405 Bacteria 4912
151 Ga0439438_014783 3300041405 Bacteria 2315
152 Ga0439447_000992 3300041407 Bacteria 10363
153 Ga0439447_001286 3300041407 Bacteria 9129
154 Ga0439447_008865 3300041407 Bacteria 3087
155 Ga0439447_014957 3300041407 Bacteria 2163
156 Ga0439447_021721 3300041407 Bacteria 1687
157 Ga0439461_0024628 3300041410 Bacteria 1218
158 Ga0439466_0004026 3300041411 Bacteria 5673
159 Ga0439466_0005378 3300041411 Bacteria 4896
160 Ga0439466_0008858 3300041411 Bacteria 3785
161 Ga0439466_0031748 3300041411 Bacteria 1804
162 Ga0439466_0044144 3300041411 Bacteria 1478
163 Ga0439431_0008366 3300041997 Bacteria 2324
164 Ga0439445_0003665 3300042004 Bacteria 3447
165 Ga0439432_000867 3300042006 Bacteria 11322
166 Ga0439432_002235 3300042006 Bacteria 7302
167 Ga0439432_012625 3300042006 Bacteria 2886
168 Ga0439432_028888 3300042006 Bacteria 1804
169 Ga0439451_000488 3300042009 Bacteria 7671
170 Ga0439451_005675 3300042009 Bacteria 2552
171 Ga0439451_006798 3300042009 Bacteria 2340
172 Ga0439452_000087 3300042010 Bacteria 79439
173 Ga0439452_000111 3300042010 Bacteria 65396
174 Ga0439452_000437 3300042010 Bacteria 23932
175 Ga0439452_001162 3300042010 Bacteria 11413
176 Ga0439452_002226 3300042010 Bacteria 7286
177 Ga0439452_016333 3300042010 Bacteria 2017
178 Ga0439456_000552 3300042013 Bacteria 7869
179 Ga0439456_002451 3300042013 Bacteria 3744
180 Ga0439456_002672 3300042013 Bacteria 3595
181 Ga0439456_012965 3300042013 Bacteria 1732
182 Ga0439456_016722 3300042013 Bacteria 1534
183 Ga0439463_002213 3300042016 Bacteria 5011
184 Ga0439463_002583 3300042016 Bacteria 4593
185 Ga0439463_018598 3300042016 Bacteria 1729
186 Ga0439463_052928 3300042016 Bacteria 1036
187 Ga0450911_000513 3300042115 Bacteria 12271
188 Ga0450911_001595 3300042115 Bacteria 5097
189 Ga0450919_000665 3300042121 Bacteria 4334
190 Ga0450922_002874 3300042124 Bacteria 1598
191 Ga0450890_000903 3300042127 Bacteria 4299
192 Ga0450891_003186 3300042129 Bacteria 1598
193 Ga0450902_000398 3300042137 Bacteria 5304
194 Ga0450902_004718 3300042137 Bacteria 2034
195 Ga0450902_010475 3300042137 Bacteria 1466
196 Ga0450903_001621 3300042138 Bacteria 4186
197 Ga0450903_004740 3300042138 Bacteria 2302
198 Ga0450903_009225 3300042138 Bacteria 1609
199 Ga0450903_010230 3300042138 Bacteria 1520
200 Ga0450904_002426 3300042139 Bacteria 2225
201 Ga0450906_000499 3300042145 Bacteria 8253
202 Ga0450906_001141 3300042145 Bacteria 5863
203 Ga0450907_000047 3300042146 Bacteria 51538
204 Ga0450907_005934 3300042146 Bacteria 2050
205 Ga0450907_018683 3300042146 Bacteria 1160
206 Ga0439446_0002597 3300042156 Bacteria 4356
207 Ga0450909_000061 3300042185 Bacteria 9449
208 Ga0450909_000523 3300042185 Bacteria 5029
209 Ga0439434_0000898 3300042435 Bacteria 8572
210 Ga0439464_0006550 3300042439 Bacteria 3036
211 Ga0439460_0000829 3300042461 Bacteria 7032
212 Ga0439460_0001394 3300042461 Bacteria 5691
213 Ga0450893_0005500 3300042532 Bacteria 2035
214 Ga0439440_0001693 3300042993 Bacteria 4051
215 Ga0439440_0013362 3300042993 Bacteria 1759
216 Ga0439440_0038287 3300042993 Bacteria 1160
217 Ga0495617_000065 3300046452 Bacteria 95225
218 Ga0495617_000864 3300046452 Bacteria 14316
219 Ga0495617_002360 3300046452 Bacteria 7548
220 Ga0495617_002427 3300046452 Bacteria 7412
221 Ga0495617_007507 3300046452 Bacteria 3781
222 Ga0495617_010736 3300046452 Bacteria 3135
223 Ga0495617_014149 3300046452 Bacteria 2711
224 Ga0495617_016767 3300046452 Bacteria 2477
225 Ga0495617_078481 3300046452 Bacteria 1082
226 Ga0495627_000596 3300046453 Bacteria 28813
227 Ga0495627_002070 3300046453 Bacteria 10227
228 Ga0495627_002411 3300046453 Bacteria 9029
229 Ga0495627_002757 3300046453 Bacteria 8163
230 Ga0495627_006743 3300046453 Bacteria 4469
231 Ga0495627_009376 3300046453 Bacteria 3606
232 Ga0495627_010062 3300046453 Bacteria 3456
233 Ga0495603_0052093 3300046455 Bacteria 2431
234 Ga0495603_0054911 3300046455 Bacteria 2360
235 Ga0495590_0000289 3300046457 Bacteria 27065
236 Ga0495590_0001018 3300046457 Bacteria 12337
237 Ga0495590_0001978 3300046457 Bacteria 8639
238 Ga0495590_0002412 3300046457 Bacteria 7734
239 Ga0495590_0005210 3300046457 Bacteria 5165
240 Ga0495590_0025967 3300046457 Bacteria 2057
241 Ga0495590_0026294 3300046457 Bacteria 2043
242 Ga0495590_0037132 3300046457 Bacteria 1699
243 Ga0495590_0066367 3300046457 Bacteria 1263
244 Ga0495591_000008 3300046458 Bacteria 353558
245 Ga0495591_000155 3300046458 Bacteria 72717
246 Ga0495591_000667 3300046458 Bacteria 25312
247 Ga0495591_001178 3300046458 Bacteria 17098
248 Ga0495591_002399 3300046458 Bacteria 10462
249 Ga0495591_004141 3300046458 Bacteria 7201
250 Ga0495591_004360 3300046458 Bacteria 6968
251 Ga0495591_005106 3300046458 Bacteria 6162
252 Ga0495591_008309 3300046458 Bacteria 4271
253 Ga0495591_012890 3300046458 Bacteria 3088
254 Ga0495591_016946 3300046458 Bacteria 2517
255 Ga0495591_025061 3300046458 Bacteria 1877
256 Ga0495629_0297624 3300046459 Bacteria 1105
257 Ga0495638_0003003 3300046460 Bacteria 13469
258 Ga0495638_0004108 3300046460 Bacteria 11137
259 Ga0495638_0007788 3300046460 Bacteria 7648
260 Ga0495638_0009794 3300046460 Bacteria 6692
261 Ga0495638_0011294 3300046460 Bacteria 6155
262 Ga0495638_0014525 3300046460 Bacteria 5316
263 Ga0495638_0018367 3300046460 Bacteria 4644
264 Ga0495638_0018552 3300046460 Bacteria 4618
265 Ga0495638_0031081 3300046460 Bacteria 3433
266 Ga0495638_0057464 3300046460 Bacteria 2412
267 Ga0495638_0060325 3300046460 Bacteria 2346
268 Ga0495638_0080396 3300046460 Bacteria 1980
269 Ga0495638_0096857 3300046460 Bacteria 1770
270 Ga0495653_0103433 3300046463 Bacteria 2059
271 Ga0495650_0004525 3300046471 Bacteria 9495
272 Ga0495650_0006503 3300046471 Bacteria 7265
273 Ga0495650_0006504 3300046471 Bacteria 7263
274 Ga0495650_0006606 3300046471 Bacteria 7200
275 Ga0495650_0010894 3300046471 Bacteria 5034
276 Ga0495650_0038017 3300046471 Bacteria 2088
277 Ga0495650_0049946 3300046471 Bacteria 1733
278 Ga0495605_0000511 3300046474 Bacteria 33206
279 Ga0495605_0001607 3300046474 Bacteria 14642
280 Ga0495605_0002336 3300046474 Bacteria 11816
281 Ga0495605_0005602 3300046474 Bacteria 7298
282 Ga0495605_0019867 3300046474 Bacteria 3578
283 Ga0495605_0021893 3300046474 Bacteria 3380
284 Ga0495605_0044185 3300046474 Bacteria 2204
285 Ga0495605_0052116 3300046474 Bacteria 1989
286 Ga0495605_0069874 3300046474 Bacteria 1662
287 Ga0495605_0070938 3300046474 Bacteria 1646
288 Ga0495605_0094581 3300046474 Bacteria 1380
289 Ga0495639_0000016 3300046475 Bacteria 76516
290 Ga0495639_0010804 3300046475 Bacteria 3931
291 Ga0495639_0069712 3300046475 Bacteria 1622
292 Ga0495584_0000669 3300046491 Bacteria 22772
293 Ga0495584_0001193 3300046491 Bacteria 15970
294 Ga0495584_0001334 3300046491 Bacteria 14960
295 Ga0495584_0001932 3300046491 Bacteria 11920
296 Ga0495584_0004207 3300046491 Bacteria 7764
297 Ga0495584_0004416 3300046491 Bacteria 7575
298 Ga0495584_0005203 3300046491 Bacteria 6906
299 Ga0495584_0006636 3300046491 Bacteria 6049
300 Ga0495584_0011865 3300046491 Bacteria 4456
301 Ga0495584_0018527 3300046491 Bacteria 3538
302 Ga0495584_0027244 3300046491 Bacteria 2895
303 Ga0495584_0035805 3300046491 Bacteria 2508
304 Ga0495585_0000274 3300046492 Bacteria 51562
305 Ga0495585_0001519 3300046492 Bacteria 18015
306 Ga0495585_0001686 3300046492 Bacteria 16882
307 Ga0495585_0002630 3300046492 Bacteria 12646
308 Ga0495585_0005606 3300046492 Bacteria 7885
309 Ga0495585_0007780 3300046492 Bacteria 6530
310 Ga0495585_0012819 3300046492 Bacteria 4930
311 Ga0495585_0015138 3300046492 Bacteria 4483
312 Ga0495585_0016978 3300046492 Bacteria 4214
313 Ga0495585_0088034 3300046492 Bacteria 1675
314 Ga0495594_0009756 3300046499 Bacteria 4969
315 Ga0495596_0000400 3300046500 Bacteria 27679
316 Ga0495607_0000014 3300046501 Bacteria 186627
317 Ga0495607_0004074 3300046501 Bacteria 10937
318 Ga0495607_0007496 3300046501 Bacteria 7539
319 Ga0495607_0007520 3300046501 Bacteria 7525
320 Ga0495607_0008308 3300046501 Bacteria 7099
321 Ga0495607_0009332 3300046501 Bacteria 6647
322 Ga0495607_0009725 3300046501 Bacteria 6491
323 Ga0495607_0010043 3300046501 Bacteria 6376
324 Ga0495607_0020412 3300046501 Bacteria 4189
325 Ga0495607_0022897 3300046501 Bacteria 3917
326 Ga0495607_0075557 3300046501 Bacteria 1867
327 Ga0495607_0079659 3300046501 Bacteria 1804
328 Ga0495607_0156941 3300046501 Bacteria 1159
329 Ga0495583_0000571 3300046506 Bacteria 50665
330 Ga0495583_0002148 3300046506 Bacteria 17603
331 Ga0495583_0006341 3300046506 Bacteria 7757
332 Ga0495583_0012308 3300046506 Bacteria 4852
333 Ga0495583_0021214 3300046506 Bacteria 3347
334 Ga0495606_0002914 3300046507 Bacteria 18888
335 Ga0495606_0003286 3300046507 Bacteria 17310
336 Ga0495606_0011164 3300046507 Bacteria 7353
337 Ga0495606_0026683 3300046507 Bacteria 4112
338 Ga0495606_0036353 3300046507 Bacteria 3355
339 Ga0495606_0038226 3300046507 Bacteria 3249
340 Ga0495606_0057157 3300046507 Bacteria 2513
341 Ga0495606_0127446 3300046507 Bacteria 1516
342 Ga0495610_0004471 3300046512 Bacteria 10326
343 Ga0495610_0004748 3300046512 Bacteria 9907
344 Ga0495610_0006090 3300046512 Bacteria 8418
345 Ga0495610_0006134 3300046512 Bacteria 8376
346 Ga0495610_0008572 3300046512 Bacteria 6596
347 Ga0495610_0011026 3300046512 Bacteria 5557
348 Ga0495610_0012974 3300046512 Bacteria 4979
349 Ga0495610_0013630 3300046512 Bacteria 4821
350 Ga0495610_0015367 3300046512 Bacteria 4452
351 Ga0495610_0030563 3300046512 Bacteria 2821
352 Ga0495610_0092458 3300046512 Bacteria 1369
353 Ga0495616_0000104 3300046513 Bacteria 72819
354 Ga0495616_0000130 3300046513 Bacteria 65741
355 Ga0495616_0003578 3300046513 Bacteria 9932
356 Ga0495616_0005316 3300046513 Bacteria 7938
357 Ga0495616_0005465 3300046513 Bacteria 7817
358 Ga0495616_0006072 3300046513 Bacteria 7359
359 Ga0495616_0008077 3300046513 Bacteria 6265
360 Ga0495616_0009047 3300046513 Bacteria 5847
361 Ga0495616_0017708 3300046513 Bacteria 3925
362 Ga0495616_0033091 3300046513 Bacteria 2696
363 Ga0495616_0035373 3300046513 Bacteria 2585
364 Ga0495616_0038899 3300046513 Bacteria 2439
365 Ga0495616_0078270 3300046513 Bacteria 1586
366 Ga0495620_0000805 3300046515 Bacteria 19286
367 Ga0495620_0002255 3300046515 Bacteria 11168
368 Ga0495620_0003327 3300046515 Bacteria 9221
369 Ga0495620_0009749 3300046515 Bacteria 5097
370 Ga0495620_0010026 3300046515 Bacteria 5011
371 Ga0495620_0011755 3300046515 Bacteria 4553
372 Ga0495620_0021257 3300046515 Bacteria 3154
373 Ga0495620_0021833 3300046515 Bacteria 3099
374 Ga0495630_0237226 3300046517 Bacteria 1393
375 Ga0495631_0000014 3300046518 Bacteria 109076
376 Ga0495631_0001375 3300046518 Bacteria 14826
377 Ga0495631_0002072 3300046518 Bacteria 11671
378 Ga0495631_0014858 3300046518 Bacteria 3748
379 Ga0495631_0042692 3300046518 Bacteria 2003
380 Ga0495631_0066599 3300046518 Bacteria 1558
381 Ga0495631_0081387 3300046518 Bacteria 1397
382 Ga0495632_0000108 3300046519 Bacteria 85312
383 Ga0495632_0000150 3300046519 Bacteria 72066
384 Ga0495632_0001394 3300046519 Bacteria 20275
385 Ga0495632_0004238 3300046519 Bacteria 9798
386 Ga0495632_0004341 3300046519 Bacteria 9663
387 Ga0495632_0008283 3300046519 Bacteria 6402
388 Ga0495632_0018531 3300046519 Bacteria 3819
389 Ga0495632_0021372 3300046519 Bacteria 3488
390 Ga0495632_0029467 3300046519 Bacteria 2857
391 Ga0495632_0032246 3300046519 Bacteria 2701
392 Ga0495632_0044135 3300046519 Bacteria 2225
393 Ga0495632_0075394 3300046519 Bacteria 1614
394 Ga0495637_0000165 3300046520 Bacteria 50829
395 Ga0495637_0001145 3300046520 Bacteria 16245
396 Ga0495637_0004505 3300046520 Bacteria 7208
397 Ga0495637_0004524 3300046520 Bacteria 7195
398 Ga0495637_0005387 3300046520 Bacteria 6535
399 Ga0495637_0007820 3300046520 Bacteria 5277
400 Ga0495637_0008067 3300046520 Bacteria 5186
401 Ga0495637_0021842 3300046520 Bacteria 2928
402 Ga0495637_0023997 3300046520 Bacteria 2761
403 Ga0495637_0024534 3300046520 Bacteria 2728
404 Ga0495637_0028271 3300046520 Bacteria 2505
405 Ga0495637_0037045 3300046520 Bacteria 2120
406 Ga0495637_0038604 3300046520 Bacteria 2066
407 Ga0495637_0039110 3300046520 Bacteria 2049
408 Ga0495637_0043906 3300046520 Bacteria 1906
409 Ga0495637_0051820 3300046520 Bacteria 1715
410 Ga0495643_0002159 3300046522 Bacteria 16130
411 Ga0495643_0005625 3300046522 Bacteria 8408
412 Ga0495643_0006381 3300046522 Bacteria 7785
413 Ga0495643_0014322 3300046522 Bacteria 4720
414 Ga0495643_0017421 3300046522 Bacteria 4199
415 Ga0495643_0021369 3300046522 Bacteria 3713
416 Ga0495643_0023822 3300046522 Bacteria 3476
417 Ga0495643_0045272 3300046522 Bacteria 2389
418 Ga0495644_0001541 3300046523 Bacteria 9406
419 Ga0495644_0002293 3300046523 Bacteria 7654
420 Ga0495644_0003329 3300046523 Bacteria 6354
421 Ga0495644_0007610 3300046523 Bacteria 4176
422 Ga0495644_0010802 3300046523 Bacteria 3517
423 Ga0495648_0002237 3300046524 Bacteria 18093
424 Ga0495648_0003517 3300046524 Bacteria 13737
425 Ga0495648_0009061 3300046524 Bacteria 7766
426 Ga0495648_0010740 3300046524 Bacteria 6953
427 Ga0495648_0011145 3300046524 Bacteria 6796
428 Ga0495648_0016188 3300046524 Bacteria 5381
429 Ga0495648_0018500 3300046524 Bacteria 4928
430 Ga0495648_0020350 3300046524 Bacteria 4629
431 Ga0495648_0047929 3300046524 Bacteria 2635
432 Ga0495648_0049668 3300046524 Bacteria 2569
433 Ga0495648_0061908 3300046524 Bacteria 2219
434 Ga0495648_0079555 3300046524 Bacteria 1870
435 Ga0495666_0019102 3300046526 Bacteria 3404
436 Ga0495666_0031189 3300046526 Bacteria 2612
437 Ga0495666_0075479 3300046526 Bacteria 1598
438 Ga0495642_0000159 3300046528 Bacteria 39104
439 Ga0495642_0013258 3300046528 Bacteria 3186
440 Ga0495654_0000731 3300046530 Bacteria 25586
441 Ga0495654_0001995 3300046530 Bacteria 13442
442 Ga0495654_0003322 3300046530 Bacteria 9908
443 Ga0495654_0003925 3300046530 Bacteria 8980
444 Ga0495654_0004477 3300046530 Bacteria 8280
445 Ga0495654_0007633 3300046530 Bacteria 6022
446 Ga0495654_0009866 3300046530 Bacteria 5217
447 Ga0495654_0010105 3300046530 Bacteria 5148
448 Ga0495654_0017190 3300046530 Bacteria 3806
449 Ga0495654_0057545 3300046530 Bacteria 1878
450 Ga0495654_0061406 3300046530 Bacteria 1804
451 Ga0495654_0089483 3300046530 Bacteria 1430
452 Ga0495654_0121095 3300046530 Bacteria 1184
453 Ga0495587_0001496 3300046536 Bacteria 15552
454 Ga0495609_0002377 3300046538 Bacteria 11596
455 Ga0495609_0003968 3300046538 Bacteria 8278
456 Ga0495609_0004270 3300046538 Bacteria 7886
457 Ga0495609_0008261 3300046538 Bacteria 5107
458 Ga0495609_0012194 3300046538 Bacteria 4078
459 Ga0495609_0016693 3300046538 Bacteria 3419
460 Ga0495609_0033019 3300046538 Bacteria 2349
461 Ga0495597_0000166 3300046542 Bacteria 58474
462 Ga0495597_0002924 3300046542 Bacteria 10376
463 Ga0495597_0004391 3300046542 Bacteria 7768
464 Ga0495597_0005685 3300046542 Bacteria 6559
465 Ga0495597_0008257 3300046542 Bacteria 5225
466 Ga0495597_0008920 3300046542 Bacteria 5002
467 Ga0495597_0008961 3300046542 Bacteria 4986
468 Ga0495597_0016540 3300046542 Bacteria 3482
469 Ga0495597_0019446 3300046542 Bacteria 3178
470 Ga0495597_0029876 3300046542 Bacteria 2485
471 Ga0495597_0034987 3300046542 Bacteria 2268
472 Ga0495597_0112597 3300046542 Bacteria 1139
473 Ga0495622_0000219 3300046557 Bacteria 45417
474 Ga0495622_0001078 3300046557 Bacteria 14272
475 Ga0495622_0001509 3300046557 Bacteria 11623
476 Ga0495622_0007178 3300046557 Bacteria 5176
477 Ga0495622_0008111 3300046557 Bacteria 4866
478 Ga0495622_0127424 3300046557 Bacteria 1160
479 Ga0495633_0002262 3300046558 Bacteria 13777
480 Ga0495633_0008983 3300046558 Bacteria 5563
481 Ga0495633_0012998 3300046558 Bacteria 4405
482 Ga0495633_0061330 3300046558 Bacteria 1761
483 Ga0495656_0081688 3300046615 Bacteria 1459
484 Ga0495656_0089077 3300046615 Bacteria 1408
485 Ga0495668_0001447 3300046616 Bacteria 22953
486 Ga0495668_0006387 3300046616 Bacteria 7725
487 Ga0495668_0124515 3300046616 Bacteria 1410
488 Ga0495634_0001919 3300046642 Bacteria 17793
489 Ga0495611_0001182 3300046648 Bacteria 13570
490 Ga0495611_0007945 3300046648 Bacteria 4505
491 Ga0495611_0050211 3300046648 Bacteria 1878
492 Ga0495625_0000383 3300046660 Bacteria 67584
493 Ga0495625_0003858 3300046660 Bacteria 14487
494 Ga0495625_0005792 3300046660 Bacteria 11162
495 Ga0495625_0009205 3300046660 Bacteria 8294
496 Ga0495625_0014842 3300046660 Bacteria 6198
497 Ga0495625_0049888 3300046660 Bacteria 3006
498 Ga0495625_0101446 3300046660 Bacteria 1976
499 Ga0495625_0116381 3300046660 Bacteria 1823
500 Ga0495625_0133034 3300046660 Bacteria 1683
501 Ga0495625_0196864 3300046660 Bacteria 1332
502 Ga0495625_0264743 3300046660 Bacteria 1111
503 Ga0495635_0003885 3300046663 Bacteria 10381
504 Ga0495659_0002722 3300046664 Bacteria 5680
505 Ga0495659_0008229 3300046664 Bacteria 3316
506 Ga0495661_0002954 3300046665 Bacteria 12842
507 Ga0495661_0023385 3300046665 Bacteria 4012
508 Ga0495661_0044054 3300046665 Bacteria 2738
509 Ga0495661_0055294 3300046665 Bacteria 2379
510 Ga0495661_0065413 3300046665 Bacteria 2142
511 Ga0495661_0128615 3300046665 Bacteria 1390
512 Ga0495661_0152665 3300046665 Bacteria 1246
513 Ga0495588_0002504 3300046674 Bacteria 7869
514 Ga0495588_0010464 3300046674 Bacteria 4314
515 Ga0495588_0012084 3300046674 Bacteria 4070
516 Ga0495588_0063267 3300046674 Bacteria 1918
517 Ga0495599_0240875 3300046678 Bacteria 1103
518 Ga0495623_0017980 3300046679 Bacteria 4565
519 Ga0495669_0114104 3300046684 Bacteria 1263
520 Ga0495613_0026335 3300046689 Bacteria 4333
521 Ga0495613_0226752 3300046689 Bacteria 1310
522 Ga0495670_0000489 3300046691 Bacteria 18754
523 Ga0495670_0001051 3300046691 Bacteria 13371
524 Ga0495670_0001470 3300046691 Bacteria 11506
525 Ga0495670_0002598 3300046691 Bacteria 8929
526 Ga0495670_0005176 3300046691 Bacteria 6417
527 Ga0495670_0022861 3300046691 Bacteria 3087
528 Ga0495670_0032946 3300046691 Bacteria 2577
529 Ga0495670_0052600 3300046691 Bacteria 2039
530 Ga0495670_0066035 3300046691 Bacteria 1824
531 Ga0495671_0000090 3300046692 Bacteria 85706
532 Ga0495671_0001932 3300046692 Bacteria 13303
533 Ga0495671_0003141 3300046692 Bacteria 10269
534 Ga0495671_0003504 3300046692 Bacteria 9623
535 Ga0495671_0004786 3300046692 Bacteria 8001
536 Ga0495671_0005213 3300046692 Bacteria 7640
537 Ga0495671_0006711 3300046692 Bacteria 6629
538 Ga0495671_0007933 3300046692 Bacteria 6006
539 Ga0495671_0008940 3300046692 Bacteria 5624
540 Ga0495671_0014391 3300046692 Bacteria 4259
541 Ga0495671_0017601 3300046692 Bacteria 3801
542 Ga0495671_0025962 3300046692 Bacteria 3040
543 Ga0495671_0037965 3300046692 Bacteria 2435
544 Ga0495671_0078055 3300046692 Bacteria 1623
545 Ga0495649_0000187 3300046694 Bacteria 54311
546 Ga0495649_0002572 3300046694 Bacteria 12702
547 Ga0495649_0004410 3300046694 Bacteria 9196
548 Ga0495649_0005706 3300046694 Bacteria 7854
549 Ga0495649_0007415 3300046694 Bacteria 6687
550 Ga0495649_0008799 3300046694 Bacteria 6049
551 Ga0495649_0010338 3300046694 Bacteria 5511
552 Ga0495649_0011323 3300046694 Bacteria 5236
553 Ga0495649_0012994 3300046694 Bacteria 4819
554 Ga0495649_0021637 3300046694 Bacteria 3602
555 Ga0495649_0034144 3300046694 Bacteria 2799
556 Ga0495649_0043468 3300046694 Bacteria 2452
557 Ga0495649_0054307 3300046694 Bacteria 2166
558 Ga0495649_0092821 3300046694 Bacteria 1607
559 Ga0495649_0117415 3300046694 Bacteria 1408
560 Ga0495649_0134722 3300046694 Bacteria 1302
561 Ga0495649_0202874 3300046694 Bacteria 1029
562 Ga0495589_0000545 3300046794 Bacteria 26179
563 Ga0495589_0000975 3300046794 Bacteria 17423
564 Ga0495589_0005386 3300046794 Bacteria 6752
565 Ga0495589_0005424 3300046794 Bacteria 6726
566 Ga0495589_0006038 3300046794 Bacteria 6399
567 Ga0495589_0010569 3300046794 Bacteria 4800
568 Ga0495589_0020801 3300046794 Bacteria 3354
569 Ga0495589_0048200 3300046794 Bacteria 2109
570 Ga0495589_0053613 3300046794 Bacteria 1989
571 Ga0495589_0056352 3300046794 Bacteria 1934
572 Ga0495589_0069482 3300046794 Bacteria 1722
573 Ga0495660_0000589 3300046810 Bacteria 28836
574 Ga0495660_0003689 3300046810 Bacteria 9417
575 Ga0495660_0004408 3300046810 Bacteria 8524
576 Ga0495660_0006510 3300046810 Bacteria 6900
577 Ga0495660_0011770 3300046810 Bacteria 5073
578 Ga0495660_0011815 3300046810 Bacteria 5062
579 Ga0495660_0013458 3300046810 Bacteria 4740
580 Ga0495660_0031946 3300046810 Bacteria 2957
581 Ga0495660_0054150 3300046810 Bacteria 2174
582 Ga0495660_0057072 3300046810 Bacteria 2107
583 Ga0495660_0080045 3300046810 Bacteria 1715
584 Ga0495660_0128414 3300046810 Bacteria 1274
585 Ga0495660_0137529 3300046810 Bacteria 1219
586 Ga0495660_0145189 3300046810 Bacteria 1176
587 Ga0495581_0012518 3300047315 Bacteria 4914
588 Ga0495604_0010566 3300047317 Bacteria 7319
589 Ga0495604_0108162 3300047317 Bacteria 2031
590 Ga0495636_0007733 3300047318 Bacteria 4228
591 Ga0495636_0029088 3300047318 Bacteria 2254
592 Ga0495636_0120881 3300047318 Bacteria 1158
593 Ga0495674_0023487 3300047319 Bacteria 5681
594 Ga0495672_0000393 3300047320 Bacteria 53595
595 Ga0495672_0001485 3300047320 Bacteria 22995
596 Ga0495672_0004298 3300047320 Bacteria 11737
597 Ga0495672_0004530 3300047320 Bacteria 11334
598 Ga0495672_0013620 3300047320 Bacteria 5601
599 Ga0495672_0014233 3300047320 Bacteria 5457
600 Ga0495672_0014889 3300047320 Bacteria 5305
601 Ga0495672_0027878 3300047320 Bacteria 3582
602 Ga0495672_0042885 3300047320 Bacteria 2724
603 Ga0495672_0054093 3300047320 Bacteria 2348
604 Ga0495672_0056038 3300047320 Bacteria 2296
605 Ga0495672_0063351 3300047320 Bacteria 2123
606 Ga0495672_0110906 3300047320 Bacteria 1472
607 Ga0495672_0121483 3300047320 Bacteria 1387
608 Ga0495676_0003470 3300047321 Bacteria 14269
609 Ga0495680_0108477 3300047322 Bacteria 2060
610 Ga0495683_0000057 3300047323 Bacteria 118509
611 Ga0495683_0000375 3300047323 Bacteria 36522
612 Ga0495683_0003082 3300047323 Bacteria 9772
613 Ga0495683_0003749 3300047323 Bacteria 8780
614 Ga0495683_0006057 3300047323 Bacteria 6638
615 Ga0495683_0007222 3300047323 Bacteria 6028
616 Ga0495683_0016744 3300047323 Bacteria 3804
617 Ga0495683_0032903 3300047323 Bacteria 2640
618 Ga0495683_0075665 3300047323 Bacteria 1649
619 Ga0495687_001015 3300047443 Bacteria 27995
620 Ga0495687_010963 3300047443 Bacteria 4915
621 Ga0495687_069831 3300047443 Bacteria 1412
622 Ga0495675_0017493 3300047444 Bacteria 4544
623 Ga0495675_0080351 3300047444 Bacteria 2053
624 Ga0495677_0001420 3300047445 Bacteria 9603
625 Ga0495679_001267 3300047446 Bacteria 14834
626 Ga0495679_003902 3300047446 Bacteria 7052
627 Ga0495679_007716 3300047446 Bacteria 4457
628 Ga0495679_021783 3300047446 Bacteria 2205
629 Ga0495685_026922 3300047447 Bacteria 1978
630 Ga0495685_065681 3300047447 Bacteria 1219
631 Ga0495673_0000234 3300047469 Bacteria 80453
632 Ga0495673_0000518 3300047469 Bacteria 40740
633 Ga0495673_0002342 3300047469 Bacteria 13469
634 Ga0495673_0003400 3300047469 Bacteria 10511
635 Ga0495673_0003858 3300047469 Bacteria 9668
636 Ga0495673_0003887 3300047469 Bacteria 9614
637 Ga0495673_0004792 3300047469 Bacteria 8368
638 Ga0495673_0004840 3300047469 Bacteria 8323
639 Ga0495673_0007442 3300047469 Bacteria 6293
640 Ga0495673_0008222 3300047469 Bacteria 5890
641 Ga0495673_0009229 3300047469 Bacteria 5472
642 Ga0495673_0015641 3300047469 Bacteria 3903
643 Ga0495673_0020281 3300047469 Bacteria 3312
644 Ga0495673_0027094 3300047469 Bacteria 2731
645 Ga0495673_0045494 3300047469 Bacteria 1950
646 Ga0495681_0000268 3300047470 Bacteria 41631
647 Ga0495681_0000960 3300047470 Bacteria 22065
648 Ga0495681_0001864 3300047470 Bacteria 15483
649 Ga0495681_0002541 3300047470 Bacteria 12997
650 Ga0495681_0003334 3300047470 Bacteria 11170
651 Ga0495681_0005959 3300047470 Bacteria 8083
652 Ga0495681_0006083 3300047470 Bacteria 7978
653 Ga0495681_0006764 3300047470 Bacteria 7461
654 Ga0495681_0007818 3300047470 Bacteria 6770
655 Ga0495681_0010237 3300047470 Bacteria 5690
656 Ga0495681_0014635 3300047470 Bacteria 4483
657 Ga0495681_0016631 3300047470 Bacteria 4112
658 Ga0495681_0028390 3300047470 Bacteria 2879
659 Ga0495681_0102777 3300047470 Bacteria 1247
660 Ga0495681_0120247 3300047470 Bacteria 1128
661 Ga0495686_0003547 3300047472 Bacteria 13430
662 Ga0495686_0005400 3300047472 Bacteria 10091
663 Ga0495686_0008114 3300047472 Bacteria 7765
664 Ga0495686_0008798 3300047472 Bacteria 7353
665 Ga0495686_0018772 3300047472 Bacteria 4632
666 Ga0495593_0005422 3300047673 Bacteria 7534
667 Ga0495593_0015034 3300047673 Bacteria 4396
668 Ga0495626_0000064 3300048091 Bacteria 142060
669 Ga0495626_0000226 3300048091 Bacteria 66392
670 Ga0495626_0001687 3300048091 Bacteria 17018
671 Ga0495626_0004295 3300048091 Bacteria 8787
672 Ga0495626_0009436 3300048091 Bacteria 5274
673 Ga0495626_0011051 3300048091 Bacteria 4789
674 Ga0495626_0011381 3300048091 Bacteria 4708
675 Ga0495626_0011931 3300048091 Bacteria 4574
676 Ga0495626_0017771 3300048091 Bacteria 3585
677 Ga0495626_0019914 3300048091 Bacteria 3347
678 Ga0495626_0052437 3300048091 Bacteria 1880
679 Ga0495626_0057095 3300048091 Bacteria 1786
680 Ga0495626_0084207 3300048091 Bacteria 1407
681 Ga0495626_0088097 3300048091 Bacteria 1368
682 Ga0495626_0092859 3300048091 Bacteria 1325
683 Ga0495626_0101236 3300048091 Bacteria 1255
684 Ga0495626_0126346 3300048091 Bacteria 1095
685 Ga0496102_0000440 3300048905 Bacteria 47446
686 Ga0496103_0000599 3300048906 Bacteria 28333
687 Ga0496105_0349221 3300048908 Bacteria 1182
688 Ga0496106_0049997 3300048909 Bacteria 3150
689 Ga0496110_0073402 3300048913 Bacteria 3036
690 Ga0496110_0215907 3300048913 Bacteria 1744
691 Ga0496111_0035685 3300048914 Bacteria 3555
692 Ga0496112_0079097 3300048915 Bacteria 3252
693 Ga0496114_0239878 3300048917 Bacteria 1594
694 Ga0496116_0002938 3300048919 Bacteria 17362
695 Ga0496116_0004737 3300048919 Bacteria 12846
696 Ga0496116_0010379 3300048919 Bacteria 7816
697 Ga0496116_0019466 3300048919 Bacteria 5197
698 Ga0496117_0005796 3300048920 Bacteria 12814
699 Ga0496117_0006546 3300048920 Bacteria 11728
700 Ga0496117_0038713 3300048920 Bacteria 3530
701 Ga0496117_0137483 3300048920 Bacteria 1469
702 Ga0496117_0165725 3300048920 Bacteria 1289
703 Ga0496118_0006336 3300048921 Bacteria 13068
704 Ga0496118_0025986 3300048921 Bacteria 5003
705 Ga0496118_0050024 3300048921 Bacteria 3212
706 Ga0496118_0102214 3300048921 Bacteria 1932
707 Ga0496118_0145975 3300048921 Bacteria 1489
708 Ga0496121_0019707 3300048924 Bacteria 6728
709 Ga0496121_0074685 3300048924 Bacteria 2710
710 Ga0496122_0013921 3300048925 Bacteria 7822
711 Ga0496122_0028041 3300048925 Bacteria 4794
712 Ga0496122_0091852 3300048925 Bacteria 2065
713 Ga0496123_0008460 3300048926 Bacteria 9447
714 Ga0496123_0009666 3300048926 Bacteria 8649
715 Ga0496124_0007455 3300048927 Bacteria 11622
716 Ga0496124_0076190 3300048927 Bacteria 2769
717 Ga0496124_0090772 3300048927 Bacteria 2490
718 Ga0496124_0151488 3300048927 Bacteria 1818
719 Ga0496124_0208708 3300048927 Bacteria 1479
720 Ga0496124_0291928 3300048927 Bacteria 1183
721 Ga0496125_0011448 3300048928 Bacteria 8870
722 Ga0496125_0098133 3300048928 Bacteria 2168
723 Ga0496126_0142627 3300048929 Bacteria 2060
724 Ga0496126_0268712 3300048929 Bacteria 1416
725 Ga0495678_000838 3300049459 Bacteria 27484
726 Ga0495678_001482 3300049459 Bacteria 18348
727 Ga0495678_002175 3300049459 Bacteria 13778
728 Ga0495678_003108 3300049459 Bacteria 10519
729 Ga0495678_003625 3300049459 Bacteria 9403
730 Ga0495678_005863 3300049459 Bacteria 6651
731 Ga0495678_005916 3300049459 Bacteria 6616
732 Ga0495678_008286 3300049459 Bacteria 5262
733 Ga0495678_010659 3300049459 Bacteria 4450
734 Ga0495678_011298 3300049459 Bacteria 4281
735 Ga0495678_025802 3300049459 Bacteria 2518
736 Ga0495678_029085 3300049459 Bacteria 2324
737 Ga0495678_033780 3300049459 Bacteria 2109
738 Ga0495678_042283 3300049459 Bacteria 1817
739 Ga0495678_075382 3300049459 Bacteria 1225
740 Ga0495682_0001221 3300049460 Bacteria 14574
741 Ga0495682_0002877 3300049460 Bacteria 7912
742 Ga0495682_0003553 3300049460 Bacteria 6891
743 Ga0495682_0014553 3300049460 Bacteria 2982
744 Ga0495682_0015168 3300049460 Bacteria 2919
745 Ga0495682_0025761 3300049460 Bacteria 2187
746 Ga0495682_0027140 3300049460 Bacteria 2124
747 Ga0495682_0029636 3300049460 Bacteria 2027
748 Ga0495682_0033104 3300049460 Bacteria 1908
749 Ga0495682_0050641 3300049460 Bacteria 1511
750 Ga0495682_0065463 3300049460 Bacteria 1310
751 Ga0501222_000720 3300049662 Bacteria 4818
752 Ga0501240_025374 3300049673 Bacteria 920
753 Ga0501252_008810 3300049682 Bacteria 1166
754 Ga0501241_000656 3300049758 Bacteria 7435
755 Ga0501269_003065 3300049766 Bacteria 2029
756 Ga0501226_000351 3300049853 Bacteria 6726
757 nmdc:mga00v17_91989_c1 3300050491 Bacteria 1906
758 Ga0500572_003118 3300053111 Bacteria 3843
759 Ga0500621_077505 3300053126 Bacteria 1335
760 Ga0500568_0026235 3300053139 Bacteria 2448
761 Ga0500586_019962 3300053145 Bacteria 2092
762 2511255628 2511231004 Bacteria 6669789
763 2511266071 2511231006 Bacteria 6794709
764 2511274711 2511231007 Bacteria 6306603
765 2511280139 2511231008 Bacteria 6624100
766 2511288656 2511231010 Bacteria 6373152
767 2511297050 2511231011 Bacteria 6149768
768 2511301507 2511231012 Bacteria 6738011
769 2511312460 2511231014 Bacteria 6462302
770 2511326954 2511231016 Bacteria 6704427
771 2511334915 2511231017 Bacteria 6503007
772 2511341586 2511231018 Bacteria 6436256
773 2511345163 2511231019 Bacteria 6520662
774 2511354069 2511231021 Bacteria 7302637
775 2511361636 2511231022 Bacteria 6719296
776 2511370385 2511231023 Bacteria 6808468
777 2511415926 2511231031 Bacteria 6558529
778 2511824766 2511231156 Bacteria 6845832
779 2512323721 2512047018 Bacteria 6663241
780 2583792020 2582580891 Bacteria 6800976
781 2597857950 2597489887 Bacteria 6666321
782 2599484977 2599185185 Bacteria 6652270
783 2599500520 2599185188 Bacteria 6164180
784 2599771899 2599185248 Bacteria 6696816
785 2599802612 2599185257 Bacteria 6492581
786 2599885137 2599185289 Bacteria 6778765
787 2599898804 2599185291 Bacteria 6775623
788 2599932203 2599185300 Bacteria 6062622
789 2599944252 2599185302 Bacteria 5954930
790 2599954724 2599185304 Bacteria 5951361
791 2599959790 2599185305 Bacteria 6748700
792 2599967471 2599185306 Bacteria 6637356
793 2599977022 2599185308 Bacteria 6621546
794 2599985666 2599185309 Bacteria 5969593
795 2599991514 2599185310 Bacteria 6014457
796 2599993657 2599185311 Bacteria 6354990
797 2600002537 2599185312 Bacteria 5912071
798 2600006332 2599185313 Bacteria 6658188
799 2600011250 2599185314 Bacteria 6621749
800 2600016298 2599185315 Bacteria 6771107
801 2600024626 2599185316 Bacteria 6320029
802 2600031622 2599185317 Bacteria 6435722
803 2600040619 2599185319 Bacteria 6637840
804 2600050157 2599185320 Bacteria 5963263
805 2600051504 2599185321 Bacteria 6764560
806 2600062956 2599185323 Bacteria 6688755
807 2600072574 2599185324 Bacteria 6590677
808 2600079321 2599185325 Bacteria 6324919
809 2600361395 2600254930 Bacteria 6431253
810 2600366519 2600254931 Bacteria 6734225
811 2601799560 2600255318 Bacteria 6383414
812 2606078206 2603880185 Bacteria 6379190
813 2606130314 2603880199 Bacteria 6377649
814 2624480589 2623620443 Bacteria 6427864
815 2624492507 2623620446 Bacteria 6500345
816 2643844570 2643221565 Bacteria 6216018
817 2644189847 2643221633 Bacteria 6733554
818 2644284321 2643221650 Bacteria 7029547
819 2671091766 2667528170 Bacteria 6786960
820 2671126616 2667528176 Bacteria 6724917
821 2671769769 2671180172 Bacteria 6495783
822 2678265506 2675903515 Bacteria 6580491
823 2715756547 2713897149 Bacteria 6506249
824 2718634276 2718217725 Bacteria 5758958
825 2739311983 2738543025 Bacteria 6600348
826 2743737416 2740892503 Bacteria 6855563
827 2745005957 2744054620 Bacteria 6551379
828 2774122471 2773857670 Bacteria 6407454
829 2774138016 2773857673 Bacteria 6513460
830 2784264641 2784132063 Bacteria 6262788
831 2784314696 2784132072 Bacteria 6596533
832 2794597401 2791355520 Bacteria 5948615
833 2808853798 2808606361 Bacteria 6136259
834 2808922128 2808606376 Bacteria 6248667
835 2808929212 2808606377 Bacteria 6646337
836 2808933579 2808606378 Bacteria 6177535
837 2808944889 2808606380 Bacteria 6248705
838 2808951333 2808606381 Bacteria 6646461
839 2808958469 2808606382 Bacteria 6841132
840 2808962053 2808606383 Bacteria 6138645
841 2808997190 2808606389 Bacteria 6138126
842 2809214983 2808606445 Bacteria 6057339
843 2819658694 2818991456 Bacteria 6123676
844 2825651610 2825651385 Bacteria 6715909
845 2842834555 2842832357 Bacteria 5959113
846 2842859035 2842854478 Bacteria 6143501
847 2852663320 2852657418 Bacteria 6472974
848 2860344790 2860339153 Bacteria 6846989
849 2878032463 2878029506 Bacteria 6418441
850 2904522149 2904518522 Bacteria 6068986
851 2904552426 2904550169 Bacteria 6221258
852 2913039992 2913036834 Bacteria 6704877
853 2919065159 2919063839 Bacteria 6302690
854 2919386930 2919385768 Bacteria 5897293
855 2919458846 2919456309 Bacteria 6586567
856 2919484993 2919481497 Bacteria 6907839
857 2919489127 2919487758 Bacteria 5929766
858 2919698674 2919697872 Bacteria 6553725
859 2923156457 2923153595 Bacteria 6870622
860 2923588515 2923586266 Bacteria 6565975
861 2929147691 2929144301 Bacteria 6622272
862 2931375200 2931369376 Bacteria 6847892
863 2931402308 2931396565 Bacteria 7251677
864 2969307334 2969304461 Bacteria 6601805
865 2974291009 2974289157 Bacteria 6080362
866 2984289612 2984286254 Bacteria 6702062
867 2988728787 2988728565 Bacteria 6124362
868 2998142810 2998139840 Bacteria 6073514
869 3007395824 3007395558 Bacteria 6755444
870 3007514451 3007511990 Bacteria 6481491
871 3007614318 3007614139 Bacteria 6053559
872 3007620762 3007619802 Bacteria 6411688
873 3007719240 3007718800 Bacteria 5971527
874 3007856833 3007855910 Bacteria 5637581
875 3007862168 3007861166 Bacteria 6045338
876 8015690643 8015687852 Bacteria 6613826
877 8019778858 8019775933 Bacteria 6858656
878 8029997982 8029995093 Bacteria 5990776
879 8055773778 8055770955 Bacteria 6827675
880 8056145779 8056143049 Bacteria 6307666
881 8056157770 8056155041 Bacteria 6486948
882 8056168390 8056166840 Bacteria 5820959
883 8056174069 8056172158 Bacteria 6133900
884 8056178402 8056177738 Bacteria 6748268
885 8056574846 8056569372 Bacteria 5997322
886 Ga0065714_10003366
887 MRS2a_Contig_6196
888 MRS2a_Contig_6968
889 SwRhRL2b_contig_147174
890 JGI25162J39368_1000051
891 JGI25163J39215_1000030
892 JGI25164J39214_1000027
893 JGI25165J46597_1000101
894 Ga0055536_1000014
895 Ga0055530_10000009
896 Ga0055530_10000011
897 Ga0055530_10000321
898 Ga0055540_1000006
899 Ga0055540_1000034
900 Ga0055540_1000563
901 Ga0055531_10000099
902 Ga0065714_10008244
903 Ga0065714_10017945
904 Ga0065714_10064563
905 Ga0065714_10095959
906 Ga0065714_10098354
907 Ga0065714_10143167
908 Ga0065704_10072463
909 Ga0065712_10000471
910 Ga0065715_10114243
911 Ga0075364_10147738
912 Ga0075432_10000516
913 Ga0075432_10005726
914 Ga0075432_10006429
915 Ga0075432_10013961
916 Ga0075432_10019797
917 Ga0075436_100204913
918 Ga0079104_1007429
919 Ga0105251_10009612
920 Ga0105251_10025050
921 Ga0105251_10026388
922 Ga0105251_10132442
923 Ga0105244_10001644
924 Ga0105244_10007454
925 Ga0105244_10011328
926 Ga0105244_10017861
927 Ga0105244_10024808
928 Ga0105244_10059183
929 Ga0105250_10005927
930 Ga0105250_10052348
931 Ga0105243_10000026
932 Ga0105246_10000479
933 Ga0157345_1000015
934 Ga0157373_10000389
935 Ga0157373_10001066
936 Ga0157373_10033464
937 Ga0157373_10060306
938 Ga0157371_10000142
939 Ga0157371_10019685
940 Ga0157370_10025310
941 Ga0157370_10026738
942 Ga0157370_10028241
943 Ga0157370_10142940
944 Ga0157370_10153216
945 Ga0157370_10178016
946 Ga0157370_10211833
947 Ga0157370_10265030
948 Ga0157369_10001032
949 Ga0163162_10015509
950 Ga0163162_10065239
951 Ga0157372_10083845
952 Ga0157375_10098906
953 Ga0157375_10177426
954 Ga0182008_10010134
955 Ga0182008_10012908
956 Ga0182008_10017092
957 Ga0182006_1000459
958 Ga0182006_1002339
959 Ga0182006_1004629
960 Ga0182006_1006943
961 Ga0182006_1009795
962 Ga0182006_1010767
963 Ga0182006_1014867
964 Ga0182006_1031794
965 Ga0182006_1064774
966 Ga0182007_10000087
967 Ga0182007_10004442
968 Ga0182007_10022700
969 Ga0182005_1003168
970 Ga0182005_1004198
971 Ga0182005_1015429
972 Ga0182005_1019406
973 Ga0182005_1024112
974 Ga0182005_1030268
975 Ga0163161_10004310
976 Ga0163161_10006120
977 Ga0163161_10007695
978 Ga0163161_10017073
979 Ga0163161_10026691
980 Ga0163161_10028547
981 Ga0163161_10052010
982 Ga0209760_100014
983 Ga0207427_100011
984 Ga0209437_100025
985 Ga0209233_1000012
986 Ga0209675_1004493
987 Ga0209676_1000002
988 Ga0209676_1000003
989 Ga0209676_1000158
990 Ga0209676_1014476
991 Ga0209050_1000004
992 Ga0209050_1000006
993 Ga0209050_1000013
994 Ga0209051_1000001
995 Ga0209051_1000006
996 Ga0209051_1000007
997 Ga0209257_1000029
998 Ga0209257_1037227
999 Ga0207696_1000211
1000 Ga0207696_1000724
1001 Ga0207696_1004104
1002 Ga0207655_1000518
1003 Ga0207655_1001701
1004 Ga0207655_1001944
1005 Ga0207655_1012143
1006 Ga0207655_1012773
1007 Ga0207713_1000275
1008 Ga0207713_1001425
1009 Ga0207713_1003617
1010 Ga0207713_1019393
1011 Ga0207713_1033635
1012 Ga0207664_10070019
1013 Ga0207709_10000004
1014 Ga0207428_10002235
1015 Ga0207428_10047841
1016 Ga0316178_1009025
1017 Ga0316181_1207328
1018 Ga0307408_100002061
1019 Ga0307408_100003529
1020 Ga0307408_100026372
1021 Ga0307408_100074742
1022 Ga0307405_10004405
1023 Ga0307406_10308826
1024 Ga0307412_10001133
1025 Ga0307412_10013732
1026 Ga0307412_10048830
1027 Ga0307409_100074834
1028 Ga0307414_10004414
1029 Ga0307411_10292862
1030 Ga0307510_10006853
1031 Ga0439438_000823
1032 Ga0439438_001395
1033 Ga0439438_001998
1034 Ga0439438_003513
1035 Ga0439438_005068
1036 Ga0439438_014783
1037 Ga0439447_000992
1038 Ga0439447_001286
1039 Ga0439447_008865
1040 Ga0439447_014957
1041 Ga0439447_021721
1042 Ga0439461_0024628
1043 Ga0439466_0004026
1044 Ga0439466_0005378
1045 Ga0439466_0008858
1046 Ga0439466_0031748
1047 Ga0439466_0044144
1048 Ga0439431_0008366
1049 Ga0439445_0003665
1050 Ga0439432_000867
1051 Ga0439432_002235
1052 Ga0439432_012625
1053 Ga0439432_028888
1054 Ga0439451_000488
1055 Ga0439451_005675
1056 Ga0439451_006798
1057 Ga0439452_000087
1058 Ga0439452_000111
1059 Ga0439452_000437
1060 Ga0439452_001162
1061 Ga0439452_002226
1062 Ga0439452_016333
1063 Ga0439456_000552
1064 Ga0439456_002451
1065 Ga0439456_002672
1066 Ga0439456_012965
1067 Ga0439456_016722
1068 Ga0439463_002213
1069 Ga0439463_002583
1070 Ga0439463_018598
1071 Ga0439463_052928
1072 Ga0450911_000513
1073 Ga0450911_001595
1074 Ga0450919_000665
1075 Ga0450922_002874
1076 Ga0450890_000903
1077 Ga0450891_003186
1078 Ga0450902_000398
1079 Ga0450902_004718
1080 Ga0450902_010475
1081 Ga0450903_001621
1082 Ga0450903_004740
1083 Ga0450903_009225
1084 Ga0450903_010230
1085 Ga0450904_002426
1086 Ga0450906_000499
1087 Ga0450906_001141
1088 Ga0450907_000047
1089 Ga0450907_005934
1090 Ga0450907_018683
1091 Ga0439446_0002597
1092 Ga0450909_000061
1093 Ga0450909_000523
1094 Ga0439434_0000898
1095 Ga0439464_0006550
1096 Ga0439460_0000829
1097 Ga0439460_0001394
1098 Ga0450893_0005500
1099 Ga0439440_0001693
1100 Ga0439440_0013362
1101 Ga0439440_0038287
1102 Ga0495617_000065
1103 Ga0495617_000864
1104 Ga0495617_002360
1105 Ga0495617_002427
1106 Ga0495617_007507
1107 Ga0495617_010736
1108 Ga0495617_014149
1109 Ga0495617_016767
1110 Ga0495617_078481
1111 Ga0495627_000596
1112 Ga0495627_002070
1113 Ga0495627_002411
1114 Ga0495627_002757
1115 Ga0495627_006743
1116 Ga0495627_009376
1117 Ga0495627_010062
1118 Ga0495603_0052093
1119 Ga0495603_0054911
1120 Ga0495590_0000289
1121 Ga0495590_0001018
1122 Ga0495590_0001978
1123 Ga0495590_0002412
1124 Ga0495590_0005210
1125 Ga0495590_0025967
1126 Ga0495590_0026294
1127 Ga0495590_0037132
1128 Ga0495590_0066367
1129 Ga0495591_000008
1130 Ga0495591_000155
1131 Ga0495591_000667
1132 Ga0495591_001178
1133 Ga0495591_002399
1134 Ga0495591_004141
1135 Ga0495591_004360
1136 Ga0495591_005106
1137 Ga0495591_008309
1138 Ga0495591_012890
1139 Ga0495591_016946
1140 Ga0495591_025061
1141 Ga0495629_0297624
1142 Ga0495638_0003003
1143 Ga0495638_0004108
1144 Ga0495638_0007788
1145 Ga0495638_0009794
1146 Ga0495638_0011294
1147 Ga0495638_0014525
1148 Ga0495638_0018367
1149 Ga0495638_0018552
1150 Ga0495638_0031081
1151 Ga0495638_0057464
1152 Ga0495638_0060325
1153 Ga0495638_0080396
1154 Ga0495638_0096857
1155 Ga0495653_0103433
1156 Ga0495650_0004525
1157 Ga0495650_0006503
1158 Ga0495650_0006504
1159 Ga0495650_0006606
1160 Ga0495650_0010894
1161 Ga0495650_0038017
1162 Ga0495650_0049946
1163 Ga0495605_0000511
1164 Ga0495605_0001607
1165 Ga0495605_0002336
1166 Ga0495605_0005602
1167 Ga0495605_0019867
1168 Ga0495605_0021893
1169 Ga0495605_0044185
1170 Ga0495605_0052116
1171 Ga0495605_0069874
1172 Ga0495605_0070938
1173 Ga0495605_0094581
1174 Ga0495639_0000016
1175 Ga0495639_0010804
1176 Ga0495639_0069712
1177 Ga0495584_0000669
1178 Ga0495584_0001193
1179 Ga0495584_0001334
1180 Ga0495584_0001932
1181 Ga0495584_0004207
1182 Ga0495584_0004416
1183 Ga0495584_0005203
1184 Ga0495584_0006636
1185 Ga0495584_0011865
1186 Ga0495584_0018527
1187 Ga0495584_0027244
1188 Ga0495584_0035805
1189 Ga0495585_0000274
1190 Ga0495585_0001519
1191 Ga0495585_0001686
1192 Ga0495585_0002630
1193 Ga0495585_0005606
1194 Ga0495585_0007780
1195 Ga0495585_0012819
1196 Ga0495585_0015138
1197 Ga0495585_0016978
1198 Ga0495585_0088034
1199 Ga0495594_0009756
1200 Ga0495596_0000400
1201 Ga0495607_0000014
1202 Ga0495607_0004074
1203 Ga0495607_0007496
1204 Ga0495607_0007520
1205 Ga0495607_0008308
1206 Ga0495607_0009332
1207 Ga0495607_0009725
1208 Ga0495607_0010043
1209 Ga0495607_0020412
1210 Ga0495607_0022897
1211 Ga0495607_0075557
1212 Ga0495607_0079659
1213 Ga0495607_0156941
1214 Ga0495583_0000571
1215 Ga0495583_0002148
1216 Ga0495583_0006341
1217 Ga0495583_0012308
1218 Ga0495583_0021214
1219 Ga0495606_0002914
1220 Ga0495606_0003286
1221 Ga0495606_0011164
1222 Ga0495606_0026683
1223 Ga0495606_0036353
1224 Ga0495606_0038226
1225 Ga0495606_0057157
1226 Ga0495606_0127446
1227 Ga0495610_0004471
1228 Ga0495610_0004748
1229 Ga0495610_0006090
1230 Ga0495610_0006134
1231 Ga0495610_0008572
1232 Ga0495610_0011026
1233 Ga0495610_0012974
1234 Ga0495610_0013630
1235 Ga0495610_0015367
1236 Ga0495610_0030563
1237 Ga0495610_0092458
1238 Ga0495616_0000104
1239 Ga0495616_0000130
1240 Ga0495616_0003578
1241 Ga0495616_0005316
1242 Ga0495616_0005465
1243 Ga0495616_0006072
1244 Ga0495616_0008077
1245 Ga0495616_0009047
1246 Ga0495616_0017708
1247 Ga0495616_0033091
1248 Ga0495616_0035373
1249 Ga0495616_0038899
1250 Ga0495616_0078270
1251 Ga0495620_0000805
1252 Ga0495620_0002255
1253 Ga0495620_0003327
1254 Ga0495620_0009749
1255 Ga0495620_0010026
1256 Ga0495620_0011755
1257 Ga0495620_0021257
1258 Ga0495620_0021833
1259 Ga0495630_0237226
1260 Ga0495631_0000014
1261 Ga0495631_0001375
1262 Ga0495631_0002072
1263 Ga0495631_0014858
1264 Ga0495631_0042692
1265 Ga0495631_0066599
1266 Ga0495631_0081387
1267 Ga0495632_0000108
1268 Ga0495632_0000150
1269 Ga0495632_0001394
1270 Ga0495632_0004238
1271 Ga0495632_0004341
1272 Ga0495632_0008283
1273 Ga0495632_0018531
1274 Ga0495632_0021372
1275 Ga0495632_0029467
1276 Ga0495632_0032246
1277 Ga0495632_0044135
1278 Ga0495632_0075394
1279 Ga0495637_0000165
1280 Ga0495637_0001145
1281 Ga0495637_0004505
1282 Ga0495637_0004524
1283 Ga0495637_0005387
1284 Ga0495637_0007820
1285 Ga0495637_0008067
1286 Ga0495637_0021842
1287 Ga0495637_0023997
1288 Ga0495637_0024534
1289 Ga0495637_0028271
1290 Ga0495637_0037045
1291 Ga0495637_0038604
1292 Ga0495637_0039110
1293 Ga0495637_0043906
1294 Ga0495637_0051820
1295 Ga0495643_0002159
1296 Ga0495643_0005625
1297 Ga0495643_0006381
1298 Ga0495643_0014322
1299 Ga0495643_0017421
1300 Ga0495643_0021369
1301 Ga0495643_0023822
1302 Ga0495643_0045272
1303 Ga0495644_0001541
1304 Ga0495644_0002293
1305 Ga0495644_0003329
1306 Ga0495644_0007610
1307 Ga0495644_0010802
1308 Ga0495648_0002237
1309 Ga0495648_0003517
1310 Ga0495648_0009061
1311 Ga0495648_0010740
1312 Ga0495648_0011145
1313 Ga0495648_0016188
1314 Ga0495648_0018500
1315 Ga0495648_0020350
1316 Ga0495648_0047929
1317 Ga0495648_0049668
1318 Ga0495648_0061908
1319 Ga0495648_0079555
1320 Ga0495666_0019102
1321 Ga0495666_0031189
1322 Ga0495666_0075479
1323 Ga0495642_0000159
1324 Ga0495642_0013258
1325 Ga0495654_0000731
1326 Ga0495654_0001995
1327 Ga0495654_0003322
1328 Ga0495654_0003925
1329 Ga0495654_0004477
1330 Ga0495654_0007633
1331 Ga0495654_0009866
1332 Ga0495654_0010105
1333 Ga0495654_0017190
1334 Ga0495654_0057545
1335 Ga0495654_0061406
1336 Ga0495654_0089483
1337 Ga0495654_0121095
1338 Ga0495587_0001496
1339 Ga0495609_0002377
1340 Ga0495609_0003968
1341 Ga0495609_0004270
1342 Ga0495609_0008261
1343 Ga0495609_0012194
1344 Ga0495609_0016693
1345 Ga0495609_0033019
1346 Ga0495597_0000166
1347 Ga0495597_0002924
1348 Ga0495597_0004391
1349 Ga0495597_0005685
1350 Ga0495597_0008257
1351 Ga0495597_0008920
1352 Ga0495597_0008961
1353 Ga0495597_0016540
1354 Ga0495597_0019446
1355 Ga0495597_0029876
1356 Ga0495597_0034987
1357 Ga0495597_0112597
1358 Ga0495622_0000219
1359 Ga0495622_0001078
1360 Ga0495622_0001509
1361 Ga0495622_0007178
1362 Ga0495622_0008111
1363 Ga0495622_0127424
1364 Ga0495633_0002262
1365 Ga0495633_0008983
1366 Ga0495633_0012998
1367 Ga0495633_0061330
1368 Ga0495656_0081688
1369 Ga0495656_0089077
1370 Ga0495668_0001447
1371 Ga0495668_0006387
1372 Ga0495668_0124515
1373 Ga0495634_0001919
1374 Ga0495611_0001182
1375 Ga0495611_0007945
1376 Ga0495611_0050211
1377 Ga0495625_0000383
1378 Ga0495625_0003858
1379 Ga0495625_0005792
1380 Ga0495625_0009205
1381 Ga0495625_0014842
1382 Ga0495625_0049888
1383 Ga0495625_0101446
1384 Ga0495625_0116381
1385 Ga0495625_0133034
1386 Ga0495625_0196864
1387 Ga0495625_0264743
1388 Ga0495635_0003885
1389 Ga0495659_0002722
1390 Ga0495659_0008229
1391 Ga0495661_0002954
1392 Ga0495661_0023385
1393 Ga0495661_0044054
1394 Ga0495661_0055294
1395 Ga0495661_0065413
1396 Ga0495661_0128615
1397 Ga0495661_0152665
1398 Ga0495588_0002504
1399 Ga0495588_0010464
1400 Ga0495588_0012084
1401 Ga0495588_0063267
1402 Ga0495599_0240875
1403 Ga0495623_0017980
1404 Ga0495669_0114104
1405 Ga0495613_0026335
1406 Ga0495613_0226752
1407 Ga0495670_0000489
1408 Ga0495670_0001051
1409 Ga0495670_0001470
1410 Ga0495670_0002598
1411 Ga0495670_0005176
1412 Ga0495670_0022861
1413 Ga0495670_0032946
1414 Ga0495670_0052600
1415 Ga0495670_0066035
1416 Ga0495671_0000090
1417 Ga0495671_0001932
1418 Ga0495671_0003141
1419 Ga0495671_0003504
1420 Ga0495671_0004786
1421 Ga0495671_0005213
1422 Ga0495671_0006711
1423 Ga0495671_0007933
1424 Ga0495671_0008940
1425 Ga0495671_0014391
1426 Ga0495671_0017601
1427 Ga0495671_0025962
1428 Ga0495671_0037965
1429 Ga0495671_0078055
1430 Ga0495649_0000187
1431 Ga0495649_0002572
1432 Ga0495649_0004410
1433 Ga0495649_0005706
1434 Ga0495649_0007415
1435 Ga0495649_0008799
1436 Ga0495649_0010338
1437 Ga0495649_0011323
1438 Ga0495649_0012994
1439 Ga0495649_0021637
1440 Ga0495649_0034144
1441 Ga0495649_0043468
1442 Ga0495649_0054307
1443 Ga0495649_0092821
1444 Ga0495649_0117415
1445 Ga0495649_0134722
1446 Ga0495649_0202874
1447 Ga0495589_0000545
1448 Ga0495589_0000975
1449 Ga0495589_0005386
1450 Ga0495589_0005424
1451 Ga0495589_0006038
1452 Ga0495589_0010569
1453 Ga0495589_0020801
1454 Ga0495589_0048200
1455 Ga0495589_0053613
1456 Ga0495589_0056352
1457 Ga0495589_0069482
1458 Ga0495660_0000589
1459 Ga0495660_0003689
1460 Ga0495660_0004408
1461 Ga0495660_0006510
1462 Ga0495660_0011770
1463 Ga0495660_0011815
1464 Ga0495660_0013458
1465 Ga0495660_0031946
1466 Ga0495660_0054150
1467 Ga0495660_0057072
1468 Ga0495660_0080045
1469 Ga0495660_0128414
1470 Ga0495660_0137529
1471 Ga0495660_0145189
1472 Ga0495581_0012518
1473 Ga0495604_0010566
1474 Ga0495604_0108162
1475 Ga0495636_0007733
1476 Ga0495636_0029088
1477 Ga0495636_0120881
1478 Ga0495674_0023487
1479 Ga0495672_0000393
1480 Ga0495672_0001485
1481 Ga0495672_0004298
1482 Ga0495672_0004530
1483 Ga0495672_0013620
1484 Ga0495672_0014233
1485 Ga0495672_0014889
1486 Ga0495672_0027878
1487 Ga0495672_0042885
1488 Ga0495672_0054093
1489 Ga0495672_0056038
1490 Ga0495672_0063351
1491 Ga0495672_0110906
1492 Ga0495672_0121483
1493 Ga0495676_0003470
1494 Ga0495680_0108477
1495 Ga0495683_0000057
1496 Ga0495683_0000375
1497 Ga0495683_0003082
1498 Ga0495683_0003749
1499 Ga0495683_0006057
1500 Ga0495683_0007222
1501 Ga0495683_0016744
1502 Ga0495683_0032903
1503 Ga0495683_0075665
1504 Ga0495687_001015
1505 Ga0495687_010963
1506 Ga0495687_069831
1507 Ga0495675_0017493
1508 Ga0495675_0080351
1509 Ga0495677_0001420
1510 Ga0495679_001267
1511 Ga0495679_003902
1512 Ga0495679_007716
1513 Ga0495679_021783
1514 Ga0495685_026922
1515 Ga0495685_065681
1516 Ga0495673_0000234
1517 Ga0495673_0000518
1518 Ga0495673_0002342
1519 Ga0495673_0003400
1520 Ga0495673_0003858
1521 Ga0495673_0003887
1522 Ga0495673_0004792
1523 Ga0495673_0004840
1524 Ga0495673_0007442
1525 Ga0495673_0008222
1526 Ga0495673_0009229
1527 Ga0495673_0015641
1528 Ga0495673_0020281
1529 Ga0495673_0027094
1530 Ga0495673_0045494
1531 Ga0495681_0000268
1532 Ga0495681_0000960
1533 Ga0495681_0001864
1534 Ga0495681_0002541
1535 Ga0495681_0003334
1536 Ga0495681_0005959
1537 Ga0495681_0006083
1538 Ga0495681_0006764
1539 Ga0495681_0007818
1540 Ga0495681_0010237
1541 Ga0495681_0014635
1542 Ga0495681_0016631
1543 Ga0495681_0028390
1544 Ga0495681_0102777
1545 Ga0495681_0120247
1546 Ga0495686_0003547
1547 Ga0495686_0005400
1548 Ga0495686_0008114
1549 Ga0495686_0008798
1550 Ga0495686_0018772
1551 Ga0495593_0005422
1552 Ga0495593_0015034
1553 Ga0495626_0000064
1554 Ga0495626_0000226
1555 Ga0495626_0001687
1556 Ga0495626_0004295
1557 Ga0495626_0009436
1558 Ga0495626_0011051
1559 Ga0495626_0011381
1560 Ga0495626_0011931
1561 Ga0495626_0017771
1562 Ga0495626_0019914
1563 Ga0495626_0052437
1564 Ga0495626_0057095
1565 Ga0495626_0084207
1566 Ga0495626_0088097
1567 Ga0495626_0092859
1568 Ga0495626_0101236
1569 Ga0495626_0126346
1570 Ga0496102_0000440
1571 Ga0496103_0000599
1572 Ga0496105_0349221
1573 Ga0496106_0049997
1574 Ga0496110_0073402
1575 Ga0496110_0215907
1576 Ga0496111_0035685
1577 Ga0496112_0079097
1578 Ga0496114_0239878
1579 Ga0496116_0002938
1580 Ga0496116_0004737
1581 Ga0496116_0010379
1582 Ga0496116_0019466
1583 Ga0496117_0005796
1584 Ga0496117_0006546
1585 Ga0496117_0038713
1586 Ga0496117_0137483
1587 Ga0496117_0165725
1588 Ga0496118_0006336
1589 Ga0496118_0025986
1590 Ga0496118_0050024
1591 Ga0496118_0102214
1592 Ga0496118_0145975
1593 Ga0496121_0019707
1594 Ga0496121_0074685
1595 Ga0496122_0013921
1596 Ga0496122_0028041
1597 Ga0496122_0091852
1598 Ga0496123_0008460
1599 Ga0496123_0009666
1600 Ga0496124_0007455
1601 Ga0496124_0076190
1602 Ga0496124_0090772
1603 Ga0496124_0151488
1604 Ga0496124_0208708
1605 Ga0496124_0291928
1606 Ga0496125_0011448
1607 Ga0496125_0098133
1608 Ga0496126_0142627
1609 Ga0496126_0268712
1610 Ga0495678_000838
1611 Ga0495678_001482
1612 Ga0495678_002175
1613 Ga0495678_003108
1614 Ga0495678_003625
1615 Ga0495678_005863
1616 Ga0495678_005916
1617 Ga0495678_008286
1618 Ga0495678_010659
1619 Ga0495678_011298
1620 Ga0495678_025802
1621 Ga0495678_029085
1622 Ga0495678_033780
1623 Ga0495678_042283
1624 Ga0495678_075382
1625 Ga0495682_0001221
1626 Ga0495682_0002877
1627 Ga0495682_0003553
1628 Ga0495682_0014553
1629 Ga0495682_0015168
1630 Ga0495682_0025761
1631 Ga0495682_0027140
1632 Ga0495682_0029636
1633 Ga0495682_0033104
1634 Ga0495682_0050641
1635 Ga0495682_0065463
1636 Ga0501222_000720
1637 Ga0501240_025374
1638 Ga0501252_008810
1639 Ga0501241_000656
1640 Ga0501269_003065
1641 Ga0501226_000351
1642 nmdc:mga00v17_91989_c1
1643 Ga0500572_003118
1644 Ga0500621_077505
1645 Ga0500568_0026235
1646 Ga0500586_019962
1647 2511255628
1648 2511266071
1649 2511274711
1650 2511280139
1651 2511288656
1652 2511297050
1653 2511301507
1654 2511312460
1655 2511326954
1656 2511334915
1657 2511341586
1658 2511345163
1659 2511354069
1660 2511361636
1661 2511370385
1662 2511415926
1663 2511824766
1664 2512323721
1665 2583792020
1666 2597857950
1667 2599484977
1668 2599500520
1669 2599771899
1670 2599802612
1671 2599885137
1672 2599898804
1673 2599932203
1674 2599944252
1675 2599954724
1676 2599959790
1677 2599967471
1678 2599977022
1679 2599985666
1680 2599991514
1681 2599993657
1682 2600002537
1683 2600006332
1684 2600011250
1685 2600016298
1686 2600024626
1687 2600031622
1688 2600040619
1689 2600050157
1690 2600051504
1691 2600062956
1692 2600072574
1693 2600079321
1694 2600361395
1695 2600366519
1696 2601799560
1697 2606078206
1698 2606130314
1699 2624480589
1700 2624492507
1701 2643844570
1702 2644189847
1703 2644284321
1704 2671091766
1705 2671126616
1706 2671769769
1707 2678265506
1708 2715756547
1709 2718634276
1710 2739311983
1711 2743737416
1712 2745005957
1713 2774122471
1714 2774138016
1715 2784264641
1716 2784314696
1717 2794597401
1718 2808853798
1719 2808922128
1720 2808929212
1721 2808933579
1722 2808944889
1723 2808951333
1724 2808958469
1725 2808962053
1726 2808997190
1727 2809214983
1728 2819658694
1729 2825651610
1730 2842834555
1731 2842859035
1732 2852663320
1733 2860344790
1734 2878032463
1735 2904522149
1736 2904552426
1737 2913039992
1738 2919065159
1739 2919386930
1740 2919458846
1741 2919484993
1742 2919489127
1743 2919698674
1744 2923156457
1745 2923588515
1746 2929147691
1747 2931375200
1748 2931402308
1749 2969307334
1750 2974291009
1751 2984289612
1752 2988728787
1753 2998142810
1754 3007395824
1755 3007514451
1756 3007614318
1757 3007620762
1758 3007719240
1759 3007856833
1760 3007862168
1761 8015690643
1762 8019778858
1763 8029997982
1764 8055773778
1765 8056145779
1766 8056157770
1767 8056168390
1768 8056174069
1769 8056178402
1770 8056574846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03797

Autotransporter

Autotransporter beta-domain

119

334

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ehf-assembly1.cif.gz_A ompt (in-vitro folded), an outer membrane protein vibrio cholerae (trimer form) 0.5685 91 328
3sbo-assembly1.cif.gz_F structure of e.coli gdh from native source 0.5633 159 180
6ehe-assembly1.cif.gz_A omptdeltal8 (loop l8 deletion mutant of ompt), an outer membrane protein of vibrio cholerae 0.5617 97 328
3qq2-assembly1.cif.gz_A-2 crystal structure of the beta domain of the bordetella autotransporter brka 0.5593 91 328
3aeh-assembly2.cif.gz_B integral membrane domain of autotransporter hbp 0.555 91 327
ID Description Score Start End Superfamily
af_P10423_30_345_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6316 151 186 3.40.630.10
3qq2A00 Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain 0.5593 91 328 2.40.128.130
4auiC00 Mainly Beta;Beta Barrel;Porin;Porin 0.551 90 328 2.40.160.10
af_P39180_703_1039_2.40.128.130 Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain 0.5332 88 326 2.40.128.130
af_P77199_657_968_2.40.128.130 Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain 0.5303 91 328 2.40.128.130
ID Description Score Start End GO Terms
AF-A0A484ZRA3-F1-model_v4 AIDA autotransporter-like protein ShdA 0.7104 230 328 GO:0019867
AF-A0A800M669-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.7086 178 328
AF-A0A484ZRA3-F1-model_v4 AIDA autotransporter-like protein ShdA 0.6972 230 328 GO:0019867
AF-A0A800M669-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.6892 178 328
AF-K7S6K7-F1-model_v4 deleted 0.6775 91 328

Map