F482328
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 823 | 281 | 1646 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100864637|Ga0070707_1008646371 |
| Length | 199 |
| Sequence | VRALSAADVTAVTLQLGRAPRGLLGVAHRCPCGLPDVVETAPRLPDGTPFPTLYYLTCPRAAAAVGRLEAGGLMREMTQRLAAEPGLRQAYLAAHRDYLARRDEAARASGVEPLPPGTPSAGGMPDRVKCLHALVAHELAVPGTSPLGREALLAAGEWWRAGRCVSEPTVEGAGAAGGAPEASGRHGVAVPAEPRAAVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 203 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 204 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 205 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 206 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 207 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.37 |
| Rhizosphere | 94.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100864637 | 3300005468 | Bacteria | 868 |
| 2 | JGI25407J50210_10013314 | 3300003373 | Bacteria | 2114 |
| 3 | JGI25404J52841_10000310 | 3300003659 | Bacteria | 6411 |
| 4 | Ga0070658_10102376 | 3300005327 | Bacteria | 2368 |
| 5 | Ga0070683_100267951 | 3300005329 | Bacteria | 1624 |
| 6 | Ga0070683_100546892 | 3300005329 | Bacteria | 1107 |
| 7 | Ga0068869_100102426 | 3300005334 | Bacteria | 2167 |
| 8 | Ga0070666_10047240 | 3300005335 | Bacteria | 2890 |
| 9 | Ga0070680_100166929 | 3300005336 | Bacteria | 1851 |
| 10 | Ga0068868_100048233 | 3300005338 | Bacteria | 3340 |
| 11 | Ga0068868_100913577 | 3300005338 | Bacteria | 798 |
| 12 | Ga0070660_100256345 | 3300005339 | Bacteria | 1427 |
| 13 | Ga0070689_100874902 | 3300005340 | Bacteria | 794 |
| 14 | Ga0070691_10186858 | 3300005341 | Bacteria | 1081 |
| 15 | Ga0070675_100060805 | 3300005354 | Bacteria | 3118 |
| 16 | Ga0070671_100919814 | 3300005355 | Bacteria | 764 |
| 17 | Ga0070673_100195179 | 3300005364 | Bacteria | 1741 |
| 18 | Ga0070659_100045863 | 3300005366 | Bacteria | 3425 |
| 19 | Ga0070667_100910092 | 3300005367 | Bacteria | 819 |
| 20 | Ga0070709_10039770 | 3300005434 | Bacteria | 2887 |
| 21 | Ga0070709_10043542 | 3300005434 | Bacteria | 2776 |
| 22 | Ga0070709_10129451 | 3300005434 | Bacteria | 1721 |
| 23 | Ga0070709_10138419 | 3300005434 | Bacteria | 1670 |
| 24 | Ga0070709_10158953 | 3300005434 | Bacteria | 1569 |
| 25 | Ga0070709_10176687 | 3300005434 | Bacteria | 1496 |
| 26 | Ga0070709_10324784 | 3300005434 | Bacteria | 1130 |
| 27 | Ga0070709_10411571 | 3300005434 | Bacteria | 1011 |
| 28 | Ga0070714_100024977 | 3300005435 | Bacteria | 4927 |
| 29 | Ga0070714_100044665 | 3300005435 | Bacteria | 3751 |
| 30 | Ga0070714_100057055 | 3300005435 | Bacteria | 3341 |
| 31 | Ga0070714_100066933 | 3300005435 | Bacteria | 3096 |
| 32 | Ga0070714_100173088 | 3300005435 | Bacteria | 1960 |
| 33 | Ga0070714_100193703 | 3300005435 | Bacteria | 1856 |
| 34 | Ga0070714_100212514 | 3300005435 | Bacteria | 1774 |
| 35 | Ga0070714_100269245 | 3300005435 | Bacteria | 1579 |
| 36 | Ga0070714_100329603 | 3300005435 | Bacteria | 1429 |
| 37 | Ga0070714_100350549 | 3300005435 | Bacteria | 1386 |
| 38 | Ga0070714_100555503 | 3300005435 | Bacteria | 1099 |
| 39 | Ga0070714_100565660 | 3300005435 | Bacteria | 1089 |
| 40 | Ga0070714_100640505 | 3300005435 | Bacteria | 1023 |
| 41 | Ga0070714_100952389 | 3300005435 | Bacteria | 834 |
| 42 | Ga0070713_100012145 | 3300005436 | Bacteria | 6307 |
| 43 | Ga0070713_100097618 | 3300005436 | Bacteria | 2539 |
| 44 | Ga0070713_100097921 | 3300005436 | Bacteria | 2535 |
| 45 | Ga0070713_100206595 | 3300005436 | Bacteria | 1776 |
| 46 | Ga0070713_100431075 | 3300005436 | Bacteria | 1235 |
| 47 | Ga0070713_100447657 | 3300005436 | Bacteria | 1212 |
| 48 | Ga0070713_100783577 | 3300005436 | Bacteria | 913 |
| 49 | Ga0070713_100800574 | 3300005436 | Bacteria | 903 |
| 50 | Ga0070713_100830704 | 3300005436 | Bacteria | 886 |
| 51 | Ga0070710_10006448 | 3300005437 | Bacteria | 5638 |
| 52 | Ga0070710_10010218 | 3300005437 | Bacteria | 4606 |
| 53 | Ga0070710_10019136 | 3300005437 | Bacteria | 3535 |
| 54 | Ga0070710_10049771 | 3300005437 | Bacteria | 2345 |
| 55 | Ga0070710_10141176 | 3300005437 | Bacteria | 1477 |
| 56 | Ga0070710_10153878 | 3300005437 | Bacteria | 1420 |
| 57 | Ga0070710_10233393 | 3300005437 | Bacteria | 1175 |
| 58 | Ga0070710_10425878 | 3300005437 | Bacteria | 895 |
| 59 | Ga0070710_10436166 | 3300005437 | Bacteria | 885 |
| 60 | Ga0070710_10458451 | 3300005437 | Bacteria | 865 |
| 61 | Ga0070711_100037014 | 3300005439 | Bacteria | 3272 |
| 62 | Ga0070711_100164268 | 3300005439 | Bacteria | 1686 |
| 63 | Ga0070711_100167965 | 3300005439 | Bacteria | 1669 |
| 64 | Ga0070711_100273184 | 3300005439 | Bacteria | 1334 |
| 65 | Ga0070711_100345855 | 3300005439 | Bacteria | 1194 |
| 66 | Ga0070711_100577402 | 3300005439 | Bacteria | 935 |
| 67 | Ga0070705_100090754 | 3300005440 | Bacteria | 1902 |
| 68 | Ga0070705_100094434 | 3300005440 | Bacteria | 1872 |
| 69 | Ga0070705_100146870 | 3300005440 | Bacteria | 1559 |
| 70 | Ga0070694_100601502 | 3300005444 | Bacteria | 885 |
| 71 | Ga0070708_100001881 | 3300005445 | Bacteria | 16105 |
| 72 | Ga0070708_100024317 | 3300005445 | Bacteria | 5166 |
| 73 | Ga0070708_100241243 | 3300005445 | Bacteria | 1697 |
| 74 | Ga0070708_100316337 | 3300005445 | Bacteria | 1470 |
| 75 | Ga0070708_100424157 | 3300005445 | Bacteria | 1254 |
| 76 | Ga0070708_100652393 | 3300005445 | Bacteria | 992 |
| 77 | Ga0070708_101114582 | 3300005445 | Bacteria | 739 |
| 78 | Ga0070678_100044593 | 3300005456 | Bacteria | 3167 |
| 79 | Ga0070662_100555028 | 3300005457 | Bacteria | 963 |
| 80 | Ga0070681_10081332 | 3300005458 | Bacteria | 3195 |
| 81 | Ga0070681_10425969 | 3300005458 | Bacteria | 1239 |
| 82 | Ga0070681_10809881 | 3300005458 | Bacteria | 854 |
| 83 | Ga0070685_10363324 | 3300005466 | Bacteria | 993 |
| 84 | Ga0070706_100007753 | 3300005467 | Bacteria | 10039 |
| 85 | Ga0070706_100023920 | 3300005467 | Bacteria | 5624 |
| 86 | Ga0070706_100037414 | 3300005467 | Bacteria | 4482 |
| 87 | Ga0070706_100149267 | 3300005467 | Bacteria | 2182 |
| 88 | Ga0070706_100155037 | 3300005467 | Bacteria | 2138 |
| 89 | Ga0070706_100502524 | 3300005467 | Bacteria | 1128 |
| 90 | Ga0070707_100084049 | 3300005468 | Bacteria | 3076 |
| 91 | Ga0070707_100137185 | 3300005468 | Bacteria | 2380 |
| 92 | Ga0070707_100210452 | 3300005468 | Bacteria | 1895 |
| 93 | Ga0070707_100309098 | 3300005468 | Bacteria | 1536 |
| 94 | Ga0070698_100000840 | 3300005471 | Bacteria | 33618 |
| 95 | Ga0070698_100011091 | 3300005471 | Bacteria | 9577 |
| 96 | Ga0070698_100040235 | 3300005471 | Bacteria | 4806 |
| 97 | Ga0070698_100104505 | 3300005471 | Bacteria | 2802 |
| 98 | Ga0070698_100126977 | 3300005471 | Bacteria | 2508 |
| 99 | Ga0070698_100518082 | 3300005471 | Bacteria | 1131 |
| 100 | Ga0070698_100550993 | 3300005471 | Bacteria | 1092 |
| 101 | Ga0070698_100686576 | 3300005471 | Bacteria | 966 |
| 102 | Ga0070699_100000896 | 3300005518 | Bacteria | 27814 |
| 103 | Ga0070699_100088126 | 3300005518 | Bacteria | 2710 |
| 104 | Ga0070699_100285777 | 3300005518 | Bacteria | 1478 |
| 105 | Ga0070699_100988678 | 3300005518 | Bacteria | 771 |
| 106 | Ga0070679_100050333 | 3300005530 | Bacteria | 4150 |
| 107 | Ga0070679_101324828 | 3300005530 | Bacteria | 666 |
| 108 | Ga0070697_100001714 | 3300005536 | Bacteria | 16736 |
| 109 | Ga0068853_100158691 | 3300005539 | Bacteria | 2039 |
| 110 | Ga0070686_100313982 | 3300005544 | Bacteria | 1166 |
| 111 | Ga0070695_100384027 | 3300005545 | Bacteria | 1060 |
| 112 | Ga0070696_100019246 | 3300005546 | Bacteria | 4623 |
| 113 | Ga0070696_100050512 | 3300005546 | Bacteria | 2890 |
| 114 | Ga0070693_100163679 | 3300005547 | Bacteria | 1419 |
| 115 | Ga0070665_100137708 | 3300005548 | Bacteria | 2444 |
| 116 | Ga0070665_100299019 | 3300005548 | Bacteria | 1612 |
| 117 | Ga0070665_101014733 | 3300005548 | Bacteria | 842 |
| 118 | Ga0070664_100102935 | 3300005564 | Bacteria | 2485 |
| 119 | Ga0068854_100095502 | 3300005578 | Bacteria | 2219 |
| 120 | Ga0068856_100026135 | 3300005614 | Bacteria | 5692 |
| 121 | Ga0068856_100226287 | 3300005614 | Bacteria | 1886 |
| 122 | Ga0068856_100306390 | 3300005614 | Bacteria | 1606 |
| 123 | Ga0068856_100510166 | 3300005614 | Bacteria | 1223 |
| 124 | Ga0068856_101103005 | 3300005614 | Bacteria | 811 |
| 125 | Ga0070702_100031508 | 3300005615 | Bacteria | 2903 |
| 126 | Ga0068852_100249382 | 3300005616 | Bacteria | 1700 |
| 127 | Ga0068852_100733023 | 3300005616 | Bacteria | 1000 |
| 128 | Ga0068859_100333723 | 3300005617 | Bacteria | 1610 |
| 129 | Ga0068859_101821673 | 3300005617 | Bacteria | 672 |
| 130 | Ga0068864_100220997 | 3300005618 | Bacteria | 1748 |
| 131 | Ga0068864_100380179 | 3300005618 | Bacteria | 1338 |
| 132 | Ga0068866_10184837 | 3300005718 | Bacteria | 1234 |
| 133 | Ga0068861_100340880 | 3300005719 | Bacteria | 1312 |
| 134 | Ga0068870_10191530 | 3300005840 | Bacteria | 1234 |
| 135 | Ga0068863_100040082 | 3300005841 | Bacteria | 4454 |
| 136 | Ga0068863_100283865 | 3300005841 | Bacteria | 1604 |
| 137 | Ga0068863_100678809 | 3300005841 | Bacteria | 1023 |
| 138 | Ga0068858_100145149 | 3300005842 | Bacteria | 2228 |
| 139 | Ga0068858_100364829 | 3300005842 | Bacteria | 1385 |
| 140 | Ga0068860_100673450 | 3300005843 | Bacteria | 1043 |
| 141 | Ga0081455_10096210 | 3300005937 | Bacteria | 2388 |
| 142 | Ga0081540_1000352 | 3300005983 | Bacteria | 46545 |
| 143 | Ga0081540_1001842 | 3300005983 | Bacteria | 17783 |
| 144 | Ga0070717_10002549 | 3300006028 | Bacteria | 12843 |
| 145 | Ga0070717_10012325 | 3300006028 | Bacteria | 6516 |
| 146 | Ga0070717_10019617 | 3300006028 | Bacteria | 5306 |
| 147 | Ga0070717_10027320 | 3300006028 | Bacteria | 4561 |
| 148 | Ga0070717_10213967 | 3300006028 | Bacteria | 1692 |
| 149 | Ga0070717_10256788 | 3300006028 | Bacteria | 1545 |
| 150 | Ga0070717_10320678 | 3300006028 | Bacteria | 1380 |
| 151 | Ga0070717_10455395 | 3300006028 | Bacteria | 1153 |
| 152 | Ga0070717_10553771 | 3300006028 | Bacteria | 1041 |
| 153 | Ga0070717_11261817 | 3300006028 | Bacteria | 672 |
| 154 | Ga0070715_10002283 | 3300006163 | Bacteria | 5834 |
| 155 | Ga0070715_10062450 | 3300006163 | Bacteria | 1639 |
| 156 | Ga0070715_10138160 | 3300006163 | Bacteria | 1180 |
| 157 | Ga0070716_100096503 | 3300006173 | Bacteria | 1802 |
| 158 | Ga0070716_100123514 | 3300006173 | Bacteria | 1625 |
| 159 | Ga0070716_100186605 | 3300006173 | Bacteria | 1366 |
| 160 | Ga0070716_100448851 | 3300006173 | Bacteria | 939 |
| 161 | Ga0070712_100018294 | 3300006175 | Bacteria | 4549 |
| 162 | Ga0070712_100032788 | 3300006175 | Bacteria | 3510 |
| 163 | Ga0070712_100143593 | 3300006175 | Bacteria | 1824 |
| 164 | Ga0070712_100161552 | 3300006175 | Bacteria | 1730 |
| 165 | Ga0070712_100279419 | 3300006175 | Bacteria | 1344 |
| 166 | Ga0070712_100393264 | 3300006175 | Bacteria | 1143 |
| 167 | Ga0070712_100740756 | 3300006175 | Bacteria | 840 |
| 168 | Ga0070712_100751508 | 3300006175 | Bacteria | 834 |
| 169 | Ga0097621_100231564 | 3300006237 | Bacteria | 1613 |
| 170 | Ga0097621_100340096 | 3300006237 | Bacteria | 1332 |
| 171 | Ga0068871_100123246 | 3300006358 | Bacteria | 2192 |
| 172 | Ga0068871_100150020 | 3300006358 | Bacteria | 1987 |
| 173 | Ga0075433_10651067 | 3300006852 | Bacteria | 924 |
| 174 | Ga0075434_100027090 | 3300006871 | Bacteria | 5625 |
| 175 | Ga0075434_100225849 | 3300006871 | Bacteria | 1892 |
| 176 | Ga0075434_100660462 | 3300006871 | Bacteria | 1064 |
| 177 | Ga0068865_100493401 | 3300006881 | Bacteria | 1020 |
| 178 | Ga0075436_100149231 | 3300006914 | Bacteria | 1644 |
| 179 | Ga0097620_100333714 | 3300006931 | Bacteria | 1610 |
| 180 | Ga0097620_101822104 | 3300006931 | Bacteria | 672 |
| 181 | Ga0075435_100117766 | 3300007076 | Bacteria | 2214 |
| 182 | Ga0075435_100240500 | 3300007076 | Bacteria | 1540 |
| 183 | Ga0075435_100367054 | 3300007076 | Bacteria | 1235 |
| 184 | Ga0105240_10214568 | 3300009093 | Bacteria | 2246 |
| 185 | Ga0105245_10124345 | 3300009098 | Bacteria | 2413 |
| 186 | Ga0105245_11134070 | 3300009098 | Bacteria | 829 |
| 187 | Ga0105247_10022850 | 3300009101 | Bacteria | 3767 |
| 188 | Ga0105247_10146479 | 3300009101 | Bacteria | 1552 |
| 189 | Ga0114129_11254739 | 3300009147 | Bacteria | 920 |
| 190 | Ga0105241_10067204 | 3300009174 | Bacteria | 2774 |
| 191 | Ga0105241_10069659 | 3300009174 | Bacteria | 2727 |
| 192 | Ga0105242_10050687 | 3300009176 | Bacteria | 3380 |
| 193 | Ga0105248_11866145 | 3300009177 | Bacteria | 682 |
| 194 | Ga0105237_10192750 | 3300009545 | Bacteria | 2038 |
| 195 | Ga0105237_10720286 | 3300009545 | Bacteria | 1004 |
| 196 | Ga0105238_10234862 | 3300009551 | Bacteria | 1811 |
| 197 | Ga0105238_10900028 | 3300009551 | Bacteria | 903 |
| 198 | Ga0105249_10421801 | 3300009553 | Bacteria | 1368 |
| 199 | Ga0105239_11487150 | 3300010375 | Bacteria | 782 |
| 200 | Ga0105246_10123769 | 3300011119 | Bacteria | 1921 |
| 201 | Ga0105246_10761913 | 3300011119 | Bacteria | 855 |
| 202 | Ga0157338_1001270 | 3300012515 | Bacteria | 1765 |
| 203 | Ga0157373_10054631 | 3300013100 | Bacteria | 2838 |
| 204 | Ga0157373_10389808 | 3300013100 | Bacteria | 997 |
| 205 | Ga0157370_10126004 | 3300013104 | Bacteria | 2390 |
| 206 | Ga0157370_10344989 | 3300013104 | Bacteria | 1372 |
| 207 | Ga0157369_10055956 | 3300013105 | Bacteria | 4257 |
| 208 | Ga0157369_10652239 | 3300013105 | Bacteria | 1085 |
| 209 | Ga0157369_10693217 | 3300013105 | Bacteria | 1049 |
| 210 | Ga0157369_11114813 | 3300013105 | Bacteria | 806 |
| 211 | Ga0157374_11440129 | 3300013296 | Bacteria | 712 |
| 212 | Ga0157378_10476288 | 3300013297 | Bacteria | 1243 |
| 213 | Ga0163162_10078559 | 3300013306 | Bacteria | 3365 |
| 214 | Ga0157375_10193237 | 3300013308 | Bacteria | 2190 |
| 215 | Ga0157375_10200151 | 3300013308 | Bacteria | 2153 |
| 216 | Ga0163163_10064154 | 3300014325 | Bacteria | 3645 |
| 217 | Ga0163163_10109157 | 3300014325 | Bacteria | 2794 |
| 218 | Ga0163163_10448519 | 3300014325 | Bacteria | 1350 |
| 219 | Ga0163163_10733302 | 3300014325 | Bacteria | 1052 |
| 220 | Ga0163163_12047778 | 3300014325 | Bacteria | 632 |
| 221 | Ga0157377_10033699 | 3300014745 | Bacteria | 2797 |
| 222 | Ga0157379_10008747 | 3300014968 | Bacteria | 8824 |
| 223 | Ga0157379_10809685 | 3300014968 | Bacteria | 885 |
| 224 | Ga0157376_10715502 | 3300014969 | Bacteria | 1008 |
| 225 | Ga0157376_10794144 | 3300014969 | Bacteria | 959 |
| 226 | Ga0163161_10139020 | 3300017792 | Bacteria | 1838 |
| 227 | Ga0197907_10862668 | 3300020069 | Bacteria | 3123 |
| 228 | Ga0206356_11478300 | 3300020070 | Bacteria | 766 |
| 229 | Ga0213875_10001850 | 3300021388 | Bacteria | 13157 |
| 230 | Ga0213875_10037330 | 3300021388 | Bacteria | 2289 |
| 231 | Ga0213875_10285646 | 3300021388 | Bacteria | 779 |
| 232 | Ga0224712_10018640 | 3300022467 | Bacteria | 2324 |
| 233 | Ga0224572_1003002 | 3300024225 | Bacteria | 2797 |
| 234 | Ga0207656_10181556 | 3300025321 | Bacteria | 1010 |
| 235 | Ga0207653_10007472 | 3300025885 | Bacteria | 3406 |
| 236 | Ga0207692_10011283 | 3300025898 | Bacteria | 3796 |
| 237 | Ga0207692_10017490 | 3300025898 | Bacteria | 3199 |
| 238 | Ga0207692_10020494 | 3300025898 | Bacteria | 3008 |
| 239 | Ga0207692_10021207 | 3300025898 | Bacteria | 2969 |
| 240 | Ga0207692_10055442 | 3300025898 | Bacteria | 2029 |
| 241 | Ga0207692_10084294 | 3300025898 | Bacteria | 1707 |
| 242 | Ga0207692_10188985 | 3300025898 | Bacteria | 1204 |
| 243 | Ga0207692_10357987 | 3300025898 | Bacteria | 901 |
| 244 | Ga0207642_10062907 | 3300025899 | Bacteria | 1733 |
| 245 | Ga0207680_10877279 | 3300025903 | Bacteria | 643 |
| 246 | Ga0207685_10013968 | 3300025905 | Bacteria | 2501 |
| 247 | Ga0207685_10020987 | 3300025905 | Bacteria | 2181 |
| 248 | Ga0207685_10034664 | 3300025905 | Bacteria | 1835 |
| 249 | Ga0207685_10080607 | 3300025905 | Bacteria | 1346 |
| 250 | Ga0207699_10005459 | 3300025906 | Bacteria | 6085 |
| 251 | Ga0207699_10006754 | 3300025906 | Bacteria | 5573 |
| 252 | Ga0207699_10030995 | 3300025906 | Bacteria | 2998 |
| 253 | Ga0207699_10031694 | 3300025906 | Bacteria | 2971 |
| 254 | Ga0207699_10055208 | 3300025906 | Bacteria | 2363 |
| 255 | Ga0207699_10100271 | 3300025906 | Bacteria | 1836 |
| 256 | Ga0207643_10093812 | 3300025908 | Bacteria | 1753 |
| 257 | Ga0207705_10033882 | 3300025909 | Bacteria | 3649 |
| 258 | Ga0207684_10001543 | 3300025910 | Bacteria | 24639 |
| 259 | Ga0207684_10051282 | 3300025910 | Bacteria | 3501 |
| 260 | Ga0207684_10051638 | 3300025910 | Bacteria | 3489 |
| 261 | Ga0207684_10053845 | 3300025910 | Bacteria | 3414 |
| 262 | Ga0207684_11066377 | 3300025910 | Bacteria | 674 |
| 263 | Ga0207654_10052803 | 3300025911 | Bacteria | 2344 |
| 264 | Ga0207707_10427185 | 3300025912 | Bacteria | 1135 |
| 265 | Ga0207695_10278460 | 3300025913 | Bacteria | 1567 |
| 266 | Ga0207671_10153014 | 3300025914 | Bacteria | 1783 |
| 267 | Ga0207693_10009156 | 3300025915 | Bacteria | 8083 |
| 268 | Ga0207693_10017411 | 3300025915 | Bacteria | 5733 |
| 269 | Ga0207693_10020333 | 3300025915 | Bacteria | 5281 |
| 270 | Ga0207693_10057579 | 3300025915 | Bacteria | 3046 |
| 271 | Ga0207693_10058585 | 3300025915 | Bacteria | 3017 |
| 272 | Ga0207693_10173378 | 3300025915 | Bacteria | 1698 |
| 273 | Ga0207693_10201153 | 3300025915 | Bacteria | 1567 |
| 274 | Ga0207693_10320794 | 3300025915 | Bacteria | 1213 |
| 275 | Ga0207693_10397116 | 3300025915 | Bacteria | 1078 |
| 276 | Ga0207663_10026354 | 3300025916 | Bacteria | 3373 |
| 277 | Ga0207663_10034770 | 3300025916 | Bacteria | 3017 |
| 278 | Ga0207663_10066797 | 3300025916 | Bacteria | 2303 |
| 279 | Ga0207663_10104929 | 3300025916 | Bacteria | 1906 |
| 280 | Ga0207663_10232130 | 3300025916 | Bacteria | 1349 |
| 281 | Ga0207663_10358784 | 3300025916 | Bacteria | 1105 |
| 282 | Ga0207660_10111488 | 3300025917 | Bacteria | 2059 |
| 283 | Ga0207662_10022378 | 3300025918 | Bacteria | 3624 |
| 284 | Ga0207657_10006630 | 3300025919 | Bacteria | 11983 |
| 285 | Ga0207649_10294701 | 3300025920 | Bacteria | 1184 |
| 286 | Ga0207649_10526681 | 3300025920 | Bacteria | 902 |
| 287 | Ga0207652_10045079 | 3300025921 | Bacteria | 3759 |
| 288 | Ga0207652_10199759 | 3300025921 | Bacteria | 1799 |
| 289 | Ga0207646_10003893 | 3300025922 | Bacteria | 16567 |
| 290 | Ga0207646_10049592 | 3300025922 | Bacteria | 3759 |
| 291 | Ga0207646_10070637 | 3300025922 | Bacteria | 3118 |
| 292 | Ga0207646_10159093 | 3300025922 | Bacteria | 2038 |
| 293 | Ga0207646_10509490 | 3300025922 | Bacteria | 1084 |
| 294 | Ga0207659_10106127 | 3300025926 | Bacteria | 2126 |
| 295 | Ga0207687_10214137 | 3300025927 | Bacteria | 1513 |
| 296 | Ga0207700_10003743 | 3300025928 | Bacteria | 8880 |
| 297 | Ga0207700_10017050 | 3300025928 | Bacteria | 4840 |
| 298 | Ga0207700_10020297 | 3300025928 | Bacteria | 4509 |
| 299 | Ga0207700_10035633 | 3300025928 | Bacteria | 3586 |
| 300 | Ga0207700_10091899 | 3300025928 | Bacteria | 2398 |
| 301 | Ga0207700_10402203 | 3300025928 | Bacteria | 1200 |
| 302 | Ga0207700_10437208 | 3300025928 | Bacteria | 1151 |
| 303 | Ga0207700_10547245 | 3300025928 | Bacteria | 1027 |
| 304 | Ga0207700_10610206 | 3300025928 | Bacteria | 971 |
| 305 | Ga0207700_10648005 | 3300025928 | Bacteria | 942 |
| 306 | Ga0207700_11154036 | 3300025928 | Bacteria | 692 |
| 307 | Ga0207664_10001454 | 3300025929 | Bacteria | 15550 |
| 308 | Ga0207664_10008935 | 3300025929 | Bacteria | 7017 |
| 309 | Ga0207664_10010443 | 3300025929 | Bacteria | 6557 |
| 310 | Ga0207664_10020033 | 3300025929 | Bacteria | 4951 |
| 311 | Ga0207664_10024883 | 3300025929 | Bacteria | 4502 |
| 312 | Ga0207664_10029411 | 3300025929 | Bacteria | 4184 |
| 313 | Ga0207664_10063837 | 3300025929 | Bacteria | 2944 |
| 314 | Ga0207664_10087096 | 3300025929 | Bacteria | 2552 |
| 315 | Ga0207664_10107699 | 3300025929 | Bacteria | 2312 |
| 316 | Ga0207664_10127474 | 3300025929 | Bacteria | 2138 |
| 317 | Ga0207664_10128468 | 3300025929 | Bacteria | 2130 |
| 318 | Ga0207664_10187106 | 3300025929 | Bacteria | 1781 |
| 319 | Ga0207664_10193335 | 3300025929 | Bacteria | 1752 |
| 320 | Ga0207664_10266704 | 3300025929 | Bacteria | 1499 |
| 321 | Ga0207664_10338458 | 3300025929 | Bacteria | 1330 |
| 322 | Ga0207664_10685791 | 3300025929 | Bacteria | 921 |
| 323 | Ga0207664_10689917 | 3300025929 | Bacteria | 918 |
| 324 | Ga0207644_10363379 | 3300025931 | Bacteria | 1178 |
| 325 | Ga0207644_10826802 | 3300025931 | Bacteria | 775 |
| 326 | Ga0207690_10073008 | 3300025932 | Bacteria | 2371 |
| 327 | Ga0207706_10082353 | 3300025933 | Bacteria | 2828 |
| 328 | Ga0207709_10296870 | 3300025935 | Bacteria | 1200 |
| 329 | Ga0207704_10235782 | 3300025938 | Bacteria | 1364 |
| 330 | Ga0207665_10016654 | 3300025939 | Bacteria | 4828 |
| 331 | Ga0207665_10018169 | 3300025939 | Bacteria | 4621 |
| 332 | Ga0207665_10023453 | 3300025939 | Bacteria | 4066 |
| 333 | Ga0207665_10034441 | 3300025939 | Bacteria | 3359 |
| 334 | Ga0207665_10035970 | 3300025939 | Bacteria | 3290 |
| 335 | Ga0207665_10077981 | 3300025939 | Bacteria | 2275 |
| 336 | Ga0207665_10154828 | 3300025939 | Bacteria | 1644 |
| 337 | Ga0207691_10099233 | 3300025940 | Bacteria | 2600 |
| 338 | Ga0207711_10069983 | 3300025941 | Bacteria | 3042 |
| 339 | Ga0207711_10127261 | 3300025941 | Bacteria | 2280 |
| 340 | Ga0207661_10355329 | 3300025944 | Bacteria | 1323 |
| 341 | Ga0207661_10741186 | 3300025944 | Bacteria | 904 |
| 342 | Ga0207679_10142124 | 3300025945 | Bacteria | 1941 |
| 343 | Ga0207651_10091917 | 3300025960 | Bacteria | 2224 |
| 344 | Ga0207712_10809793 | 3300025961 | Bacteria | 824 |
| 345 | Ga0207712_10978549 | 3300025961 | Bacteria | 750 |
| 346 | Ga0207640_10014870 | 3300025981 | Bacteria | 4490 |
| 347 | Ga0207677_10448404 | 3300026023 | Bacteria | 1105 |
| 348 | Ga0207639_10152675 | 3300026041 | Bacteria | 1936 |
| 349 | Ga0207678_10025231 | 3300026067 | Bacteria | 5188 |
| 350 | Ga0207708_10122687 | 3300026075 | Bacteria | 2025 |
| 351 | Ga0207702_10031853 | 3300026078 | Bacteria | 4397 |
| 352 | Ga0207702_10035699 | 3300026078 | Bacteria | 4156 |
| 353 | Ga0207702_10288381 | 3300026078 | Bacteria | 1554 |
| 354 | Ga0207702_10418018 | 3300026078 | Bacteria | 1296 |
| 355 | Ga0207702_10569597 | 3300026078 | Bacteria | 1109 |
| 356 | Ga0207702_11037777 | 3300026078 | Bacteria | 813 |
| 357 | Ga0207641_10071925 | 3300026088 | Bacteria | 2977 |
| 358 | Ga0207648_10118491 | 3300026089 | Bacteria | 2327 |
| 359 | Ga0207676_10152726 | 3300026095 | Bacteria | 1991 |
| 360 | Ga0207676_10324529 | 3300026095 | Bacteria | 1414 |
| 361 | Ga0207676_10618572 | 3300026095 | Bacteria | 1042 |
| 362 | Ga0207674_10015027 | 3300026116 | Bacteria | 8527 |
| 363 | Ga0207675_100713717 | 3300026118 | Bacteria | 1012 |
| 364 | Ga0207683_10141737 | 3300026121 | Bacteria | 2166 |
| 365 | Ga0207698_10625168 | 3300026142 | Bacteria | 1064 |
| 366 | Ga0268266_10145267 | 3300028379 | Bacteria | 2132 |
| 367 | Ga0268266_10242126 | 3300028379 | Bacteria | 1665 |
| 368 | Ga0268266_10473472 | 3300028379 | Bacteria | 1193 |
| 369 | Ga0268265_10285094 | 3300028380 | Bacteria | 1480 |
| 370 | Ga0268264_10224715 | 3300028381 | Bacteria | 1730 |
| 371 | Ga0268264_10274635 | 3300028381 | Bacteria | 1576 |
| 372 | Ga0265337_1000014 | 3300028556 | Bacteria | 81870 |
| 373 | Ga0265326_10000631 | 3300028558 | Bacteria | 13166 |
| 374 | Ga0265319_1007325 | 3300028563 | Bacteria | 4974 |
| 375 | Ga0265334_10001701 | 3300028573 | Bacteria | 10510 |
| 376 | Ga0265318_10001324 | 3300028577 | Bacteria | 14831 |
| 377 | Ga0265323_10001386 | 3300028653 | Bacteria | 11988 |
| 378 | Ga0265322_10046930 | 3300028654 | Bacteria | 1228 |
| 379 | Ga0265336_10001146 | 3300028666 | Bacteria | 12687 |
| 380 | Ga0265336_10005343 | 3300028666 | Bacteria | 4749 |
| 381 | Ga0265338_10000577 | 3300028800 | Bacteria | 64591 |
| 382 | Ga0265338_10000785 | 3300028800 | Bacteria | 53719 |
| 383 | Ga0265338_10422915 | 3300028800 | Bacteria | 947 |
| 384 | Ga0265332_10001642 | 3300031238 | Bacteria | 12213 |
| 385 | Ga0265325_10034251 | 3300031241 | Bacteria | 2703 |
| 386 | Ga0265340_10000640 | 3300031247 | Bacteria | 19622 |
| 387 | Ga0265339_10006174 | 3300031249 | Bacteria | 7894 |
| 388 | Ga0265316_10008119 | 3300031344 | Bacteria | 9779 |
| 389 | Ga0307408_100499700 | 3300031548 | Bacteria | 1064 |
| 390 | Ga0265313_10012855 | 3300031595 | Bacteria | 5079 |
| 391 | Ga0265314_10028515 | 3300031711 | Bacteria | 4161 |
| 392 | Ga0265342_10002040 | 3300031712 | Bacteria | 17947 |
| 393 | Ga0307405_10499589 | 3300031731 | Bacteria | 975 |
| 394 | Ga0307416_100362911 | 3300032002 | Bacteria | 1471 |
| 395 | Ga0307416_100621785 | 3300032002 | Bacteria | 1162 |
| 396 | Ga0307415_101270076 | 3300032126 | Bacteria | 696 |
| 397 | Ga0373930_0126237 | 3300034816 | Bacteria | 627 |
| 398 | Ga0373959_0027959 | 3300034820 | Bacteria | 1124 |
| 399 | Ga0373959_0137193 | 3300034820 | Bacteria | 610 |
| 400 | Ga0373926_0002908 | 3300035083 | Bacteria | 5494 |
| 401 | Ga0373926_0008765 | 3300035083 | Bacteria | 3367 |
| 402 | Ga0373926_0255371 | 3300035083 | Bacteria | 680 |
| 403 | Ga0373934_0000054 | 3300035086 | Bacteria | 38975 |
| 404 | Ga0373934_0010113 | 3300035086 | Bacteria | 3542 |
| 405 | Ga0373934_0012523 | 3300035086 | Bacteria | 3201 |
| 406 | Ga0373934_0014314 | 3300035086 | Bacteria | 3006 |
| 407 | Ga0373934_0023831 | 3300035086 | Bacteria | 2366 |
| 408 | Ga0373944_0000487 | 3300035089 | Bacteria | 9214 |
| 409 | Ga0373944_0006476 | 3300035089 | Bacteria | 3110 |
| 410 | Ga0373944_0163722 | 3300035089 | Bacteria | 790 |
| 411 | Ga0373949_0015385 | 3300035090 | Bacteria | 1709 |
| 412 | Ga0373952_0074784 | 3300035092 | Bacteria | 854 |
| 413 | Ga0373923_0001497 | 3300035111 | Bacteria | 6724 |
| 414 | Ga0373923_0005890 | 3300035111 | Bacteria | 4189 |
| 415 | Ga0373923_0011836 | 3300035111 | Bacteria | 3211 |
| 416 | Ga0373936_0003881 | 3300035113 | Bacteria | 5634 |
| 417 | Ga0373936_0006867 | 3300035113 | Bacteria | 4283 |
| 418 | Ga0373936_0085333 | 3300035113 | Bacteria | 1318 |
| 419 | Ga0373941_0238179 | 3300035115 | Bacteria | 706 |
| 420 | Ga0373945_0000672 | 3300035116 | Bacteria | 9897 |
| 421 | Ga0373945_0105882 | 3300035116 | Bacteria | 1105 |
| 422 | Ga0373953_0015410 | 3300035117 | Bacteria | 2770 |
| 423 | Ga0373953_0022888 | 3300035117 | Bacteria | 2362 |
| 424 | Ga0373953_0026177 | 3300035117 | Bacteria | 2233 |
| 425 | Ga0373953_0125573 | 3300035117 | Bacteria | 1092 |
| 426 | Ga0373954_0033816 | 3300035118 | Bacteria | 2365 |
| 427 | Ga0373954_0087165 | 3300035118 | Bacteria | 1496 |
| 428 | Ga0373956_0000348 | 3300035119 | Bacteria | 18711 |
| 429 | Ga0373956_0005044 | 3300035119 | Bacteria | 5290 |
| 430 | Ga0373956_0048329 | 3300035119 | Bacteria | 1905 |
| 431 | Ga0373956_0056906 | 3300035119 | Bacteria | 1766 |
| 432 | Ga0373956_0133923 | 3300035119 | Bacteria | 1161 |
| 433 | Ga0373957_0000329 | 3300035120 | Bacteria | 11934 |
| 434 | Ga0373957_0003152 | 3300035120 | Bacteria | 4824 |
| 435 | Ga0373957_0040109 | 3300035120 | Bacteria | 1759 |
| 436 | Ga0373957_0041086 | 3300035120 | Bacteria | 1741 |
| 437 | Ga0373957_0052760 | 3300035120 | Bacteria | 1558 |
| 438 | Ga0373957_0338459 | 3300035120 | Bacteria | 641 |
| 439 | Ga0373943_0013028 | 3300035170 | Bacteria | 3751 |
| 440 | Ga0373943_0160559 | 3300035170 | Bacteria | 1223 |
| 441 | Ga0373943_0254336 | 3300035170 | Bacteria | 987 |
| 442 | Ga0373943_0361343 | 3300035170 | Bacteria | 833 |
| 443 | Ga0373946_0000361 | 3300035171 | Bacteria | 14688 |
| 444 | Ga0373946_0001103 | 3300035171 | Bacteria | 9322 |
| 445 | Ga0373946_0168086 | 3300035171 | Bacteria | 1033 |
| 446 | Ga0373946_0277544 | 3300035171 | Bacteria | 823 |
| 447 | Ga0373955_0000009 | 3300035172 | Bacteria | 81129 |
| 448 | Ga0373955_0020641 | 3300035172 | Bacteria | 3315 |
| 449 | Ga0373955_0041029 | 3300035172 | Bacteria | 2478 |
| 450 | Ga0373955_0044907 | 3300035172 | Bacteria | 2382 |
| 451 | Ga0373955_0061283 | 3300035172 | Bacteria | 2077 |
| 452 | Ga0373955_0712958 | 3300035172 | Bacteria | 616 |
| 453 | Ga0373924_0000534 | 3300035410 | Bacteria | 11700 |
| 454 | Ga0373924_0002485 | 3300035410 | Bacteria | 6193 |
| 455 | Ga0373924_0015496 | 3300035410 | Bacteria | 2900 |
| 456 | Ga0373924_0029218 | 3300035410 | Bacteria | 2202 |
| 457 | Ga0373924_0042367 | 3300035410 | Bacteria | 1867 |
| 458 | Ga0373924_0154176 | 3300035410 | Bacteria | 1006 |
| 459 | Ga0373935_0001028 | 3300035692 | Bacteria | 15181 |
| 460 | Ga0373935_0011605 | 3300035692 | Bacteria | 5290 |
| 461 | Ga0373935_0316936 | 3300035692 | Bacteria | 1105 |
| 462 | Ga0373935_0352212 | 3300035692 | Bacteria | 1050 |
| 463 | Ga0373935_0466632 | 3300035692 | Bacteria | 913 |
| 464 | Ga0373935_0608448 | 3300035692 | Bacteria | 799 |
| 465 | Ga0373927_0002131 | 3300035695 | Bacteria | 14572 |
| 466 | Ga0373927_0066743 | 3300035695 | Bacteria | 2327 |
| 467 | Ga0373927_0270092 | 3300035695 | Bacteria | 1118 |
| 468 | Ga0373927_0330416 | 3300035695 | Bacteria | 1004 |
| 469 | Ga0373927_0527419 | 3300035695 | Bacteria | 780 |
| 470 | Ga0373933_0000006 | 3300035724 | Bacteria | 125141 |
| 471 | Ga0373933_0008866 | 3300035724 | Bacteria | 5483 |
| 472 | Ga0373933_0061159 | 3300035724 | Bacteria | 2272 |
| 473 | Ga0373933_0063434 | 3300035724 | Bacteria | 2233 |
| 474 | Ga0373933_0087049 | 3300035724 | Bacteria | 1923 |
| 475 | Ga0373933_0595024 | 3300035724 | Bacteria | 726 |
| 476 | Ga0373947_0004988 | 3300035725 | Bacteria | 7769 |
| 477 | Ga0373947_0009493 | 3300035725 | Bacteria | 5586 |
| 478 | Ga0373947_0015119 | 3300035725 | Bacteria | 4430 |
| 479 | Ga0373947_0035144 | 3300035725 | Bacteria | 2966 |
| 480 | Ga0373947_0097316 | 3300035725 | Bacteria | 1844 |
| 481 | Ga0373937_0000137 | 3300036401 | Bacteria | 70670 |
| 482 | Ga0373937_0071260 | 3300036401 | Bacteria | 3205 |
| 483 | Ga0373937_0193725 | 3300036401 | Bacteria | 1910 |
| 484 | Ga0373937_0269592 | 3300036401 | Bacteria | 1606 |
| 485 | Ga0373937_0316421 | 3300036401 | Bacteria | 1476 |
| 486 | Ga0373937_0615719 | 3300036401 | Bacteria | 1030 |
| 487 | Ga0373937_0643766 | 3300036401 | Bacteria | 1005 |
| 488 | Ga0373925_0009693 | 3300037068 | Bacteria | 7007 |
| 489 | Ga0373925_0075241 | 3300037068 | Bacteria | 2558 |
| 490 | Ga0373925_0277113 | 3300037068 | Bacteria | 1350 |
| 491 | Ga0373925_0499808 | 3300037068 | Bacteria | 998 |
| 492 | Ga0436364_0115578 | 3300037853 | Bacteria | 5083 |
| 493 | Ga0436364_0481785 | 3300037853 | Bacteria | 1011 |
| 494 | Ga0436364_0656945 | 3300037853 | Bacteria | 2182 |
| 495 | Ga0436364_0683808 | 3300037853 | Bacteria | 828 |
| 496 | Ga0436364_0859559 | 3300037853 | Bacteria | 3024 |
| 497 | Ga0436364_1101958 | 3300037853 | Bacteria | 22922 |
| 498 | Ga0436364_1408240 | 3300037853 | Bacteria | 1081 |
| 499 | Ga0436364_1456399 | 3300037853 | Bacteria | 627 |
| 500 | Ga0436360_0594066 | 3300039438 | Bacteria | 807 |
| 501 | Ga0436363_1229149 | 3300039450 | Bacteria | 924 |
| 502 | Ga0436362_0449328 | 3300039453 | Bacteria | 580 |
| 503 | Ga0436362_1072729 | 3300039453 | Bacteria | 958 |
| 504 | Ga0439463_005007 | 3300042016 | Bacteria | 3303 |
| 505 | Ga0450914_054080 | 3300042118 | Bacteria | 534 |
| 506 | Ga0450890_028549 | 3300042127 | Bacteria | 785 |
| 507 | Ga0439459_0012169 | 3300042438 | Bacteria | 1528 |
| 508 | Ga0439464_0131536 | 3300042439 | Bacteria | 775 |
| 509 | Ga0439440_0070240 | 3300042993 | Bacteria | 910 |
| 510 | Ga0439440_0117277 | 3300042993 | Bacteria | 738 |
| 511 | Ga0466963_0029505 | 3300044694 | Bacteria | 3532 |
| 512 | Ga0466963_0067066 | 3300044694 | Bacteria | 2408 |
| 513 | Ga0466963_0198034 | 3300044694 | Bacteria | 1405 |
| 514 | Ga0466968_0407066 | 3300044735 | Bacteria | 668 |
| 515 | Ga0466967_0128447 | 3300045976 | Bacteria | 2350 |
| 516 | Ga0466967_0234676 | 3300045976 | Bacteria | 1747 |
| 517 | Ga0495592_0000189 | 3300046454 | Bacteria | 54324 |
| 518 | Ga0495592_0012943 | 3300046454 | Bacteria | 6342 |
| 519 | Ga0495592_0017133 | 3300046454 | Bacteria | 5501 |
| 520 | Ga0495592_0044544 | 3300046454 | Bacteria | 3314 |
| 521 | Ga0495592_0055380 | 3300046454 | Bacteria | 2934 |
| 522 | Ga0495592_0228355 | 3300046454 | Bacteria | 1241 |
| 523 | Ga0495603_0066453 | 3300046455 | Bacteria | 2123 |
| 524 | Ga0495603_0238171 | 3300046455 | Bacteria | 1048 |
| 525 | Ga0495629_0007556 | 3300046459 | Bacteria | 8010 |
| 526 | Ga0495629_0199074 | 3300046459 | Bacteria | 1385 |
| 527 | Ga0495629_0242924 | 3300046459 | Bacteria | 1239 |
| 528 | Ga0495641_0008878 | 3300046461 | Bacteria | 6054 |
| 529 | Ga0495641_0018883 | 3300046461 | Bacteria | 3544 |
| 530 | Ga0495641_0036550 | 3300046461 | Bacteria | 2307 |
| 531 | Ga0495641_0073557 | 3300046461 | Bacteria | 1533 |
| 532 | Ga0495641_0183996 | 3300046461 | Bacteria | 935 |
| 533 | Ga0495651_0000071 | 3300046462 | Bacteria | 73914 |
| 534 | Ga0495651_0008956 | 3300046462 | Bacteria | 7683 |
| 535 | Ga0495651_0015837 | 3300046462 | Bacteria | 5836 |
| 536 | Ga0495651_0037625 | 3300046462 | Bacteria | 3767 |
| 537 | Ga0495651_0057616 | 3300046462 | Bacteria | 2982 |
| 538 | Ga0495651_0058914 | 3300046462 | Bacteria | 2946 |
| 539 | Ga0495651_0064315 | 3300046462 | Bacteria | 2803 |
| 540 | Ga0495651_0064573 | 3300046462 | Bacteria | 2797 |
| 541 | Ga0495651_0103327 | 3300046462 | Bacteria | 2117 |
| 542 | Ga0495653_0000440 | 3300046463 | Bacteria | 32649 |
| 543 | Ga0495653_0001696 | 3300046463 | Bacteria | 17322 |
| 544 | Ga0495653_0010123 | 3300046463 | Bacteria | 7715 |
| 545 | Ga0495653_0014979 | 3300046463 | Bacteria | 6324 |
| 546 | Ga0495653_0025484 | 3300046463 | Bacteria | 4752 |
| 547 | Ga0495653_0039666 | 3300046463 | Bacteria | 3687 |
| 548 | Ga0495653_0102228 | 3300046463 | Bacteria | 2074 |
| 549 | Ga0495653_0114652 | 3300046463 | Bacteria | 1930 |
| 550 | Ga0495653_0138791 | 3300046463 | Bacteria | 1712 |
| 551 | Ga0495653_0158087 | 3300046463 | Bacteria | 1576 |
| 552 | Ga0495580_0037200 | 3300046472 | Bacteria | 3494 |
| 553 | Ga0495582_0020982 | 3300046473 | Bacteria | 3577 |
| 554 | Ga0495582_0041032 | 3300046473 | Bacteria | 2549 |
| 555 | Ga0495582_0244030 | 3300046473 | Bacteria | 1029 |
| 556 | Ga0495639_0111802 | 3300046475 | Bacteria | 1297 |
| 557 | Ga0495639_0309062 | 3300046475 | Bacteria | 789 |
| 558 | Ga0495662_0027711 | 3300046476 | Bacteria | 2736 |
| 559 | Ga0495662_0047807 | 3300046476 | Bacteria | 2065 |
| 560 | Ga0495662_0054185 | 3300046476 | Bacteria | 1937 |
| 561 | Ga0495664_0015522 | 3300046477 | Bacteria | 4330 |
| 562 | Ga0495664_0016996 | 3300046477 | Bacteria | 4154 |
| 563 | Ga0495664_0062881 | 3300046477 | Bacteria | 2211 |
| 564 | Ga0495664_0207885 | 3300046477 | Bacteria | 1185 |
| 565 | Ga0495664_0230720 | 3300046477 | Bacteria | 1120 |
| 566 | Ga0495664_0232485 | 3300046477 | Bacteria | 1115 |
| 567 | Ga0495664_0237910 | 3300046477 | Bacteria | 1101 |
| 568 | Ga0495664_0264077 | 3300046477 | Bacteria | 1040 |
| 569 | Ga0495594_0037729 | 3300046499 | Bacteria | 2637 |
| 570 | Ga0495608_0000107 | 3300046511 | Bacteria | 59326 |
| 571 | Ga0495608_0002066 | 3300046511 | Bacteria | 14449 |
| 572 | Ga0495608_0003637 | 3300046511 | Bacteria | 11070 |
| 573 | Ga0495608_0021626 | 3300046511 | Bacteria | 4414 |
| 574 | Ga0495608_0043776 | 3300046511 | Bacteria | 2990 |
| 575 | Ga0495608_0066507 | 3300046511 | Bacteria | 2359 |
| 576 | Ga0495618_0016510 | 3300046514 | Bacteria | 4518 |
| 577 | Ga0495618_0016870 | 3300046514 | Bacteria | 4473 |
| 578 | Ga0495618_0036120 | 3300046514 | Bacteria | 3100 |
| 579 | Ga0495618_0041529 | 3300046514 | Bacteria | 2897 |
| 580 | Ga0495618_0057611 | 3300046514 | Bacteria | 2460 |
| 581 | Ga0495618_0090809 | 3300046514 | Bacteria | 1952 |
| 582 | Ga0495628_0000136 | 3300046516 | Bacteria | 62431 |
| 583 | Ga0495628_0034116 | 3300046516 | Bacteria | 4096 |
| 584 | Ga0495628_0036466 | 3300046516 | Bacteria | 3945 |
| 585 | Ga0495628_0183741 | 3300046516 | Bacteria | 1580 |
| 586 | Ga0495628_0211363 | 3300046516 | Bacteria | 1459 |
| 587 | Ga0495628_0293126 | 3300046516 | Bacteria | 1205 |
| 588 | Ga0495630_0013910 | 3300046517 | Bacteria | 5853 |
| 589 | Ga0495630_0092218 | 3300046517 | Bacteria | 2289 |
| 590 | Ga0495630_0092443 | 3300046517 | Bacteria | 2287 |
| 591 | Ga0495630_0117715 | 3300046517 | Bacteria | 2014 |
| 592 | Ga0495630_0280634 | 3300046517 | Bacteria | 1272 |
| 593 | Ga0495630_0428317 | 3300046517 | Bacteria | 1014 |
| 594 | Ga0495666_0010981 | 3300046526 | Bacteria | 4517 |
| 595 | Ga0495666_0017237 | 3300046526 | Bacteria | 3597 |
| 596 | Ga0495652_0000273 | 3300046529 | Bacteria | 61215 |
| 597 | Ga0495652_0009562 | 3300046529 | Bacteria | 8802 |
| 598 | Ga0495652_0019154 | 3300046529 | Bacteria | 6097 |
| 599 | Ga0495652_0031702 | 3300046529 | Bacteria | 4626 |
| 600 | Ga0495652_0049231 | 3300046529 | Bacteria | 3608 |
| 601 | Ga0495652_0090035 | 3300046529 | Bacteria | 2511 |
| 602 | Ga0495652_0178780 | 3300046529 | Bacteria | 1630 |
| 603 | Ga0495652_0266431 | 3300046529 | Bacteria | 1261 |
| 604 | Ga0495652_0792161 | 3300046529 | Bacteria | 631 |
| 605 | Ga0495665_0001336 | 3300046531 | Bacteria | 13167 |
| 606 | Ga0495665_0019416 | 3300046531 | Bacteria | 3655 |
| 607 | Ga0495665_0038008 | 3300046531 | Bacteria | 2567 |
| 608 | Ga0495665_0322783 | 3300046531 | Bacteria | 788 |
| 609 | Ga0495665_0512905 | 3300046531 | Bacteria | 603 |
| 610 | Ga0495640_0059935 | 3300046533 | Bacteria | 2590 |
| 611 | Ga0495640_0074714 | 3300046533 | Bacteria | 2265 |
| 612 | Ga0495640_0148678 | 3300046533 | Bacteria | 1506 |
| 613 | Ga0495640_0308251 | 3300046533 | Bacteria | 982 |
| 614 | Ga0495586_0025432 | 3300046535 | Bacteria | 3168 |
| 615 | Ga0495586_0025530 | 3300046535 | Bacteria | 3162 |
| 616 | Ga0495586_0030782 | 3300046535 | Bacteria | 2872 |
| 617 | Ga0495586_0079771 | 3300046535 | Bacteria | 1797 |
| 618 | Ga0495586_0220821 | 3300046535 | Bacteria | 1077 |
| 619 | Ga0495587_0000070 | 3300046536 | Bacteria | 85402 |
| 620 | Ga0495587_0001614 | 3300046536 | Bacteria | 15003 |
| 621 | Ga0495587_0021510 | 3300046536 | Bacteria | 3977 |
| 622 | Ga0495587_0046214 | 3300046536 | Bacteria | 2585 |
| 623 | Ga0495587_0057369 | 3300046536 | Bacteria | 2289 |
| 624 | Ga0495587_0097819 | 3300046536 | Bacteria | 1692 |
| 625 | Ga0495645_0023119 | 3300046543 | Bacteria | 4500 |
| 626 | Ga0495645_0027710 | 3300046543 | Bacteria | 4115 |
| 627 | Ga0495645_0060242 | 3300046543 | Bacteria | 2751 |
| 628 | Ga0495645_0183190 | 3300046543 | Bacteria | 1433 |
| 629 | Ga0495645_0208376 | 3300046543 | Bacteria | 1321 |
| 630 | Ga0495645_0886278 | 3300046543 | Bacteria | 530 |
| 631 | Ga0495667_0000048 | 3300046559 | Bacteria | 117509 |
| 632 | Ga0495667_0000183 | 3300046559 | Bacteria | 42442 |
| 633 | Ga0495667_0005886 | 3300046559 | Bacteria | 8303 |
| 634 | Ga0495667_0023204 | 3300046559 | Bacteria | 4180 |
| 635 | Ga0495667_0028695 | 3300046559 | Bacteria | 3747 |
| 636 | Ga0495667_0044109 | 3300046559 | Bacteria | 2953 |
| 637 | Ga0495667_0049352 | 3300046559 | Bacteria | 2778 |
| 638 | Ga0495667_0052864 | 3300046559 | Bacteria | 2675 |
| 639 | Ga0495667_0104600 | 3300046559 | Bacteria | 1830 |
| 640 | Ga0495667_0141945 | 3300046559 | Bacteria | 1547 |
| 641 | Ga0495667_0455517 | 3300046559 | Bacteria | 803 |
| 642 | Ga0495656_0286980 | 3300046615 | Unclassified | 840 |
| 643 | Ga0495634_0005086 | 3300046642 | Bacteria | 10154 |
| 644 | Ga0495634_0053735 | 3300046642 | Bacteria | 2697 |
| 645 | Ga0495634_0073569 | 3300046642 | Bacteria | 2247 |
| 646 | Ga0495634_0084406 | 3300046642 | Bacteria | 2071 |
| 647 | Ga0495634_0087862 | 3300046642 | Bacteria | 2022 |
| 648 | Ga0495634_0148706 | 3300046642 | Bacteria | 1482 |
| 649 | Ga0495635_0009154 | 3300046663 | Bacteria | 6911 |
| 650 | Ga0495635_0018487 | 3300046663 | Bacteria | 4862 |
| 651 | Ga0495635_0021653 | 3300046663 | Bacteria | 4481 |
| 652 | Ga0495635_0041203 | 3300046663 | Bacteria | 3190 |
| 653 | Ga0495635_0114747 | 3300046663 | Bacteria | 1839 |
| 654 | Ga0495635_0246269 | 3300046663 | Bacteria | 1205 |
| 655 | Ga0495635_0246871 | 3300046663 | Bacteria | 1204 |
| 656 | Ga0495635_0297620 | 3300046663 | Bacteria | 1082 |
| 657 | Ga0495588_0039429 | 3300046674 | Bacteria | 2406 |
| 658 | Ga0495588_0208879 | 3300046674 | Bacteria | 1031 |
| 659 | Ga0495657_0000046 | 3300046675 | Bacteria | 106064 |
| 660 | Ga0495657_0015776 | 3300046675 | Bacteria | 5519 |
| 661 | Ga0495657_0017777 | 3300046675 | Bacteria | 5157 |
| 662 | Ga0495657_0022180 | 3300046675 | Bacteria | 4552 |
| 663 | Ga0495657_0092487 | 3300046675 | Bacteria | 1937 |
| 664 | Ga0495657_0264920 | 3300046675 | Bacteria | 1031 |
| 665 | Ga0495657_0299554 | 3300046675 | Bacteria | 959 |
| 666 | Ga0495657_0326491 | 3300046675 | Bacteria | 911 |
| 667 | Ga0495657_0468318 | 3300046675 | Bacteria | 737 |
| 668 | Ga0495599_0000023 | 3300046678 | Bacteria | 125139 |
| 669 | Ga0495599_0001737 | 3300046678 | Bacteria | 12601 |
| 670 | Ga0495599_0008495 | 3300046678 | Bacteria | 6245 |
| 671 | Ga0495599_0016522 | 3300046678 | Bacteria | 4583 |
| 672 | Ga0495599_0017052 | 3300046678 | Bacteria | 4513 |
| 673 | Ga0495599_0026084 | 3300046678 | Bacteria | 3661 |
| 674 | Ga0495599_0082477 | 3300046678 | Bacteria | 2008 |
| 675 | Ga0495599_0083357 | 3300046678 | Bacteria | 1997 |
| 676 | Ga0495623_0000157 | 3300046679 | Bacteria | 42271 |
| 677 | Ga0495623_0013680 | 3300046679 | Bacteria | 5260 |
| 678 | Ga0495623_0035232 | 3300046679 | Bacteria | 3208 |
| 679 | Ga0495646_0000304 | 3300046680 | Bacteria | 25237 |
| 680 | Ga0495646_0018360 | 3300046680 | Bacteria | 4430 |
| 681 | Ga0495646_0019197 | 3300046680 | Bacteria | 4329 |
| 682 | Ga0495646_0173103 | 3300046680 | Bacteria | 1188 |
| 683 | Ga0495646_0495856 | 3300046680 | Bacteria | 627 |
| 684 | Ga0495647_0039238 | 3300046681 | Bacteria | 1794 |
| 685 | Ga0495613_0064728 | 3300046689 | Bacteria | 2673 |
| 686 | Ga0495613_0096210 | 3300046689 | Bacteria | 2141 |
| 687 | Ga0495613_0288918 | 3300046689 | Bacteria | 1137 |
| 688 | Ga0495624_0011807 | 3300046690 | Bacteria | 5993 |
| 689 | Ga0495624_0015893 | 3300046690 | Bacteria | 5069 |
| 690 | Ga0495624_0483078 | 3300046690 | Bacteria | 741 |
| 691 | Ga0495624_0860394 | 3300046690 | Bacteria | 534 |
| 692 | Ga0495600_0011538 | 3300046809 | Bacteria | 5509 |
| 693 | Ga0495600_0013146 | 3300046809 | Bacteria | 5192 |
| 694 | Ga0495600_0124236 | 3300046809 | Bacteria | 1678 |
| 695 | Ga0495600_0169535 | 3300046809 | Bacteria | 1409 |
| 696 | Ga0495600_0202716 | 3300046809 | Bacteria | 1273 |
| 697 | Ga0495581_0003943 | 3300047315 | Bacteria | 8545 |
| 698 | Ga0495581_0011146 | 3300047315 | Bacteria | 5194 |
| 699 | Ga0495581_0041040 | 3300047315 | Bacteria | 2677 |
| 700 | Ga0495581_0060369 | 3300047315 | Bacteria | 2191 |
| 701 | Ga0495604_0000037 | 3300047317 | Bacteria | 125140 |
| 702 | Ga0495604_0000831 | 3300047317 | Bacteria | 25774 |
| 703 | Ga0495604_0017074 | 3300047317 | Bacteria | 5806 |
| 704 | Ga0495604_0018550 | 3300047317 | Bacteria | 5574 |
| 705 | Ga0495604_0032937 | 3300047317 | Bacteria | 4104 |
| 706 | Ga0495604_0035364 | 3300047317 | Bacteria | 3945 |
| 707 | Ga0495604_0037551 | 3300047317 | Bacteria | 3813 |
| 708 | Ga0495604_0098632 | 3300047317 | Bacteria | 2152 |
| 709 | Ga0495604_0261910 | 3300047317 | Bacteria | 1175 |
| 710 | Ga0495674_0002352 | 3300047319 | Bacteria | 18545 |
| 711 | Ga0495674_0009843 | 3300047319 | Bacteria | 9073 |
| 712 | Ga0495674_0012129 | 3300047319 | Bacteria | 8123 |
| 713 | Ga0495674_0041784 | 3300047319 | Bacteria | 4093 |
| 714 | Ga0495674_0054130 | 3300047319 | Bacteria | 3525 |
| 715 | Ga0495674_0080967 | 3300047319 | Bacteria | 2786 |
| 716 | Ga0495674_0393565 | 3300047319 | Bacteria | 1119 |
| 717 | Ga0495674_0419358 | 3300047319 | Bacteria | 1078 |
| 718 | Ga0495674_0824739 | 3300047319 | Bacteria | 720 |
| 719 | Ga0495676_0039938 | 3300047321 | Bacteria | 3879 |
| 720 | Ga0495676_0092300 | 3300047321 | Bacteria | 2260 |
| 721 | Ga0495676_0110564 | 3300047321 | Bacteria | 2017 |
| 722 | Ga0495676_0118503 | 3300047321 | Bacteria | 1930 |
| 723 | Ga0495676_0185373 | 3300047321 | Bacteria | 1455 |
| 724 | Ga0495680_0000260 | 3300047322 | Bacteria | 58455 |
| 725 | Ga0495680_0006883 | 3300047322 | Bacteria | 10495 |
| 726 | Ga0495680_0008303 | 3300047322 | Bacteria | 9454 |
| 727 | Ga0495680_0014059 | 3300047322 | Bacteria | 6953 |
| 728 | Ga0495680_0031036 | 3300047322 | Bacteria | 4353 |
| 729 | Ga0495680_0035625 | 3300047322 | Bacteria | 4006 |
| 730 | Ga0495680_0065532 | 3300047322 | Bacteria | 2781 |
| 731 | Ga0495680_0402548 | 3300047322 | Bacteria | 945 |
| 732 | Ga0495675_0000359 | 3300047444 | Bacteria | 31787 |
| 733 | Ga0495675_0013383 | 3300047444 | Bacteria | 5178 |
| 734 | Ga0495675_0020902 | 3300047444 | Bacteria | 4166 |
| 735 | Ga0495675_0071856 | 3300047444 | Bacteria | 2183 |
| 736 | Ga0495675_0294839 | 3300047444 | Bacteria | 964 |
| 737 | Ga0495684_0005428 | 3300047471 | Bacteria | 9919 |
| 738 | Ga0495684_0013919 | 3300047471 | Bacteria | 6188 |
| 739 | Ga0495684_0025499 | 3300047471 | Bacteria | 4544 |
| 740 | Ga0495684_0029362 | 3300047471 | Bacteria | 4220 |
| 741 | Ga0495684_0051796 | 3300047471 | Bacteria | 3132 |
| 742 | Ga0495684_0059458 | 3300047471 | Bacteria | 2910 |
| 743 | Ga0495593_0007056 | 3300047673 | Bacteria | 6589 |
| 744 | Ga0495593_0028366 | 3300047673 | Bacteria | 3074 |
| 745 | Ga0495593_0065071 | 3300047673 | Bacteria | 1902 |
| 746 | Ga0495593_0080065 | 3300047673 | Bacteria | 1690 |
| 747 | Ga0495602_0000118 | 3300048088 | Bacteria | 74925 |
| 748 | Ga0495602_0015865 | 3300048088 | Bacteria | 7588 |
| 749 | Ga0495602_0045394 | 3300048088 | Bacteria | 3976 |
| 750 | Ga0495602_0062668 | 3300048088 | Bacteria | 3225 |
| 751 | Ga0495602_0066761 | 3300048088 | Bacteria | 3098 |
| 752 | Ga0495602_0069028 | 3300048088 | Bacteria | 3032 |
| 753 | Ga0495602_0099042 | 3300048088 | Bacteria | 2397 |
| 754 | Ga0495602_0103296 | 3300048088 | Bacteria | 2333 |
| 755 | Ga0495602_0116430 | 3300048088 | Bacteria | 2159 |
| 756 | Ga0495602_0383385 | 3300048088 | Bacteria | 1006 |
| 757 | Ga0495614_0156041 | 3300048089 | Bacteria | 1020 |
| 758 | Ga0496100_0498829 | 3300048903 | Bacteria | 938 |
| 759 | Ga0496100_0578620 | 3300048903 | Bacteria | 870 |
| 760 | Ga0496100_0842321 | 3300048903 | Bacteria | 719 |
| 761 | Ga0496101_0056885 | 3300048904 | Bacteria | 2827 |
| 762 | Ga0496101_0155317 | 3300048904 | Bacteria | 1752 |
| 763 | Ga0496102_0025053 | 3300048905 | Bacteria | 5307 |
| 764 | Ga0496103_0044328 | 3300048906 | Bacteria | 2740 |
| 765 | Ga0496103_0547784 | 3300048906 | Bacteria | 739 |
| 766 | Ga0496104_0000760 | 3300048907 | Bacteria | 27616 |
| 767 | Ga0496104_0003780 | 3300048907 | Bacteria | 13096 |
| 768 | Ga0496104_0275459 | 3300048907 | Bacteria | 1595 |
| 769 | Ga0496105_0024389 | 3300048908 | Bacteria | 4913 |
| 770 | Ga0496105_0032602 | 3300048908 | Bacteria | 4277 |
| 771 | Ga0496105_0036121 | 3300048908 | Bacteria | 4069 |
| 772 | Ga0496105_0272426 | 3300048908 | Bacteria | 1367 |
| 773 | Ga0496106_0112262 | 3300048909 | Bacteria | 2123 |
| 774 | Ga0496106_0385382 | 3300048909 | Bacteria | 1126 |
| 775 | Ga0496107_0149964 | 3300048910 | Bacteria | 1724 |
| 776 | Ga0496107_0360127 | 3300048910 | Bacteria | 1082 |
| 777 | Ga0496108_0085567 | 3300048911 | Bacteria | 2676 |
| 778 | Ga0496108_0733344 | 3300048911 | Bacteria | 855 |
| 779 | Ga0496109_0053625 | 3300048912 | Bacteria | 3678 |
| 780 | Ga0496109_0129918 | 3300048912 | Bacteria | 2350 |
| 781 | Ga0496109_0215597 | 3300048912 | Bacteria | 1805 |
| 782 | Ga0496110_0015154 | 3300048913 | Bacteria | 6410 |
| 783 | Ga0496110_0058547 | 3300048913 | Bacteria | 3393 |
| 784 | Ga0496111_0139778 | 3300048914 | Bacteria | 1794 |
| 785 | Ga0496112_0000984 | 3300048915 | Bacteria | 20802 |
| 786 | Ga0496112_0274813 | 3300048915 | Bacteria | 1632 |
| 787 | Ga0496112_0426159 | 3300048915 | Bacteria | 1265 |
| 788 | Ga0496112_0751277 | 3300048915 | Bacteria | 901 |
| 789 | Ga0496113_0751646 | 3300048916 | Bacteria | 776 |
| 790 | Ga0496114_0120894 | 3300048917 | Bacteria | 2252 |
| 791 | Ga0496115_0043190 | 3300048918 | Bacteria | 3594 |
| 792 | Ga0496115_0286506 | 3300048918 | Bacteria | 1352 |
| 793 | Ga0496115_0843324 | 3300048918 | Bacteria | 710 |
| 794 | Ga0501225_0310984 | 3300049705 | Bacteria | 536 |
| 795 | nmdc:mga0n895_160943_c1 | 3300050512 | Bacteria | 2276 |
| 796 | nmdc:mga0n895_2225_c1 | 3300050512 | Bacteria | 15000 |
| 797 | nmdc:mga0n895_347986_c1 | 3300050512 | Bacteria | 1501 |
| 798 | nmdc:mga0n895_730466_c1 | 3300050512 | Bacteria | 984 |
| 799 | nmdc:mga0rr50_122743_c1 | 3300050513 | Bacteria | 2070 |
| 800 | nmdc:mga0rr50_296316_c1 | 3300050513 | Bacteria | 1352 |
| 801 | nmdc:mga0rr50_732986_c1 | 3300050513 | Bacteria | 843 |
| 802 | nmdc:mga08x19_119545_c1 | 3300050514 | Bacteria | 1765 |
| 803 | nmdc:mga08x19_291818_c1 | 3300050514 | Bacteria | 1131 |
| 804 | nmdc:mga08x19_532654_c1 | 3300050514 | Bacteria | 830 |
| 805 | nmdc:mga0a205_488752_c1 | 3300050515 | Bacteria | 1088 |
| 806 | Ga0495601_0053967 | 3300053077 | Bacteria | 2541 |
| 807 | Ga0495601_0080308 | 3300053077 | Bacteria | 2092 |
| 808 | Ga0495601_0136261 | 3300053077 | Bacteria | 1600 |
| 809 | Ga0495601_0201196 | 3300053077 | Bacteria | 1301 |
| 810 | Ga0495601_0325203 | 3300053077 | Bacteria | 1001 |
| 811 | Ga0495612_0004967 | 3300053078 | Bacteria | 5503 |
| 812 | Ga0495612_0144591 | 3300053078 | Bacteria | 1033 |
| 813 | Ga0495612_0181928 | 3300053078 | Bacteria | 923 |
| 814 | Ga0495612_0361170 | 3300053078 | Bacteria | 656 |
| 815 | Ga0495595_0002310 | 3300053084 | Bacteria | 7433 |
| 816 | Ga0495595_0003631 | 3300053084 | Bacteria | 6132 |
| 817 | Ga0495595_0023110 | 3300053084 | Bacteria | 2734 |
| 818 | Ga0495595_0170061 | 3300053084 | Bacteria | 1078 |
| 819 | Ga0495619_0085583 | 3300053085 | Bacteria | 2129 |
| 820 | Ga0495619_0092705 | 3300053085 | Bacteria | 2046 |
| 821 | Ga0495619_0110355 | 3300053085 | Bacteria | 1879 |
| 822 | Ga0495619_0224412 | 3300053085 | Bacteria | 1301 |
| 823 | Ga0495619_0304386 | 3300053085 | Bacteria | 1104 |
| 824 | Ga0070707_100864637 | |||
| 825 | JGI25407J50210_10013314 | |||
| 826 | JGI25404J52841_10000310 | |||
| 827 | Ga0070658_10102376 | |||
| 828 | Ga0070683_100267951 | |||
| 829 | Ga0070683_100546892 | |||
| 830 | Ga0068869_100102426 | |||
| 831 | Ga0070666_10047240 | |||
| 832 | Ga0070680_100166929 | |||
| 833 | Ga0068868_100048233 | |||
| 834 | Ga0068868_100913577 | |||
| 835 | Ga0070660_100256345 | |||
| 836 | Ga0070689_100874902 | |||
| 837 | Ga0070691_10186858 | |||
| 838 | Ga0070675_100060805 | |||
| 839 | Ga0070671_100919814 | |||
| 840 | Ga0070673_100195179 | |||
| 841 | Ga0070659_100045863 | |||
| 842 | Ga0070667_100910092 | |||
| 843 | Ga0070709_10039770 | |||
| 844 | Ga0070709_10043542 | |||
| 845 | Ga0070709_10129451 | |||
| 846 | Ga0070709_10138419 | |||
| 847 | Ga0070709_10158953 | |||
| 848 | Ga0070709_10176687 | |||
| 849 | Ga0070709_10324784 | |||
| 850 | Ga0070709_10411571 | |||
| 851 | Ga0070714_100024977 | |||
| 852 | Ga0070714_100044665 | |||
| 853 | Ga0070714_100057055 | |||
| 854 | Ga0070714_100066933 | |||
| 855 | Ga0070714_100173088 | |||
| 856 | Ga0070714_100193703 | |||
| 857 | Ga0070714_100212514 | |||
| 858 | Ga0070714_100269245 | |||
| 859 | Ga0070714_100329603 | |||
| 860 | Ga0070714_100350549 | |||
| 861 | Ga0070714_100555503 | |||
| 862 | Ga0070714_100565660 | |||
| 863 | Ga0070714_100640505 | |||
| 864 | Ga0070714_100952389 | |||
| 865 | Ga0070713_100012145 | |||
| 866 | Ga0070713_100097618 | |||
| 867 | Ga0070713_100097921 | |||
| 868 | Ga0070713_100206595 | |||
| 869 | Ga0070713_100431075 | |||
| 870 | Ga0070713_100447657 | |||
| 871 | Ga0070713_100783577 | |||
| 872 | Ga0070713_100800574 | |||
| 873 | Ga0070713_100830704 | |||
| 874 | Ga0070710_10006448 | |||
| 875 | Ga0070710_10010218 | |||
| 876 | Ga0070710_10019136 | |||
| 877 | Ga0070710_10049771 | |||
| 878 | Ga0070710_10141176 | |||
| 879 | Ga0070710_10153878 | |||
| 880 | Ga0070710_10233393 | |||
| 881 | Ga0070710_10425878 | |||
| 882 | Ga0070710_10436166 | |||
| 883 | Ga0070710_10458451 | |||
| 884 | Ga0070711_100037014 | |||
| 885 | Ga0070711_100164268 | |||
| 886 | Ga0070711_100167965 | |||
| 887 | Ga0070711_100273184 | |||
| 888 | Ga0070711_100345855 | |||
| 889 | Ga0070711_100577402 | |||
| 890 | Ga0070705_100090754 | |||
| 891 | Ga0070705_100094434 | |||
| 892 | Ga0070705_100146870 | |||
| 893 | Ga0070694_100601502 | |||
| 894 | Ga0070708_100001881 | |||
| 895 | Ga0070708_100024317 | |||
| 896 | Ga0070708_100241243 | |||
| 897 | Ga0070708_100316337 | |||
| 898 | Ga0070708_100424157 | |||
| 899 | Ga0070708_100652393 | |||
| 900 | Ga0070708_101114582 | |||
| 901 | Ga0070678_100044593 | |||
| 902 | Ga0070662_100555028 | |||
| 903 | Ga0070681_10081332 | |||
| 904 | Ga0070681_10425969 | |||
| 905 | Ga0070681_10809881 | |||
| 906 | Ga0070685_10363324 | |||
| 907 | Ga0070706_100007753 | |||
| 908 | Ga0070706_100023920 | |||
| 909 | Ga0070706_100037414 | |||
| 910 | Ga0070706_100149267 | |||
| 911 | Ga0070706_100155037 | |||
| 912 | Ga0070706_100502524 | |||
| 913 | Ga0070707_100084049 | |||
| 914 | Ga0070707_100137185 | |||
| 915 | Ga0070707_100210452 | |||
| 916 | Ga0070707_100309098 | |||
| 917 | Ga0070698_100000840 | |||
| 918 | Ga0070698_100011091 | |||
| 919 | Ga0070698_100040235 | |||
| 920 | Ga0070698_100104505 | |||
| 921 | Ga0070698_100126977 | |||
| 922 | Ga0070698_100518082 | |||
| 923 | Ga0070698_100550993 | |||
| 924 | Ga0070698_100686576 | |||
| 925 | Ga0070699_100000896 | |||
| 926 | Ga0070699_100088126 | |||
| 927 | Ga0070699_100285777 | |||
| 928 | Ga0070699_100988678 | |||
| 929 | Ga0070679_100050333 | |||
| 930 | Ga0070679_101324828 | |||
| 931 | Ga0070697_100001714 | |||
| 932 | Ga0068853_100158691 | |||
| 933 | Ga0070686_100313982 | |||
| 934 | Ga0070695_100384027 | |||
| 935 | Ga0070696_100019246 | |||
| 936 | Ga0070696_100050512 | |||
| 937 | Ga0070693_100163679 | |||
| 938 | Ga0070665_100137708 | |||
| 939 | Ga0070665_100299019 | |||
| 940 | Ga0070665_101014733 | |||
| 941 | Ga0070664_100102935 | |||
| 942 | Ga0068854_100095502 | |||
| 943 | Ga0068856_100026135 | |||
| 944 | Ga0068856_100226287 | |||
| 945 | Ga0068856_100306390 | |||
| 946 | Ga0068856_100510166 | |||
| 947 | Ga0068856_101103005 | |||
| 948 | Ga0070702_100031508 | |||
| 949 | Ga0068852_100249382 | |||
| 950 | Ga0068852_100733023 | |||
| 951 | Ga0068859_100333723 | |||
| 952 | Ga0068859_101821673 | |||
| 953 | Ga0068864_100220997 | |||
| 954 | Ga0068864_100380179 | |||
| 955 | Ga0068866_10184837 | |||
| 956 | Ga0068861_100340880 | |||
| 957 | Ga0068870_10191530 | |||
| 958 | Ga0068863_100040082 | |||
| 959 | Ga0068863_100283865 | |||
| 960 | Ga0068863_100678809 | |||
| 961 | Ga0068858_100145149 | |||
| 962 | Ga0068858_100364829 | |||
| 963 | Ga0068860_100673450 | |||
| 964 | Ga0081455_10096210 | |||
| 965 | Ga0081540_1000352 | |||
| 966 | Ga0081540_1001842 | |||
| 967 | Ga0070717_10002549 | |||
| 968 | Ga0070717_10012325 | |||
| 969 | Ga0070717_10019617 | |||
| 970 | Ga0070717_10027320 | |||
| 971 | Ga0070717_10213967 | |||
| 972 | Ga0070717_10256788 | |||
| 973 | Ga0070717_10320678 | |||
| 974 | Ga0070717_10455395 | |||
| 975 | Ga0070717_10553771 | |||
| 976 | Ga0070717_11261817 | |||
| 977 | Ga0070715_10002283 | |||
| 978 | Ga0070715_10062450 | |||
| 979 | Ga0070715_10138160 | |||
| 980 | Ga0070716_100096503 | |||
| 981 | Ga0070716_100123514 | |||
| 982 | Ga0070716_100186605 | |||
| 983 | Ga0070716_100448851 | |||
| 984 | Ga0070712_100018294 | |||
| 985 | Ga0070712_100032788 | |||
| 986 | Ga0070712_100143593 | |||
| 987 | Ga0070712_100161552 | |||
| 988 | Ga0070712_100279419 | |||
| 989 | Ga0070712_100393264 | |||
| 990 | Ga0070712_100740756 | |||
| 991 | Ga0070712_100751508 | |||
| 992 | Ga0097621_100231564 | |||
| 993 | Ga0097621_100340096 | |||
| 994 | Ga0068871_100123246 | |||
| 995 | Ga0068871_100150020 | |||
| 996 | Ga0075433_10651067 | |||
| 997 | Ga0075434_100027090 | |||
| 998 | Ga0075434_100225849 | |||
| 999 | Ga0075434_100660462 | |||
| 1000 | Ga0068865_100493401 | |||
| 1001 | Ga0075436_100149231 | |||
| 1002 | Ga0097620_100333714 | |||
| 1003 | Ga0097620_101822104 | |||
| 1004 | Ga0075435_100117766 | |||
| 1005 | Ga0075435_100240500 | |||
| 1006 | Ga0075435_100367054 | |||
| 1007 | Ga0105240_10214568 | |||
| 1008 | Ga0105245_10124345 | |||
| 1009 | Ga0105245_11134070 | |||
| 1010 | Ga0105247_10022850 | |||
| 1011 | Ga0105247_10146479 | |||
| 1012 | Ga0114129_11254739 | |||
| 1013 | Ga0105241_10067204 | |||
| 1014 | Ga0105241_10069659 | |||
| 1015 | Ga0105242_10050687 | |||
| 1016 | Ga0105248_11866145 | |||
| 1017 | Ga0105237_10192750 | |||
| 1018 | Ga0105237_10720286 | |||
| 1019 | Ga0105238_10234862 | |||
| 1020 | Ga0105238_10900028 | |||
| 1021 | Ga0105249_10421801 | |||
| 1022 | Ga0105239_11487150 | |||
| 1023 | Ga0105246_10123769 | |||
| 1024 | Ga0105246_10761913 | |||
| 1025 | Ga0157338_1001270 | |||
| 1026 | Ga0157373_10054631 | |||
| 1027 | Ga0157373_10389808 | |||
| 1028 | Ga0157370_10126004 | |||
| 1029 | Ga0157370_10344989 | |||
| 1030 | Ga0157369_10055956 | |||
| 1031 | Ga0157369_10652239 | |||
| 1032 | Ga0157369_10693217 | |||
| 1033 | Ga0157369_11114813 | |||
| 1034 | Ga0157374_11440129 | |||
| 1035 | Ga0157378_10476288 | |||
| 1036 | Ga0163162_10078559 | |||
| 1037 | Ga0157375_10193237 | |||
| 1038 | Ga0157375_10200151 | |||
| 1039 | Ga0163163_10064154 | |||
| 1040 | Ga0163163_10109157 | |||
| 1041 | Ga0163163_10448519 | |||
| 1042 | Ga0163163_10733302 | |||
| 1043 | Ga0163163_12047778 | |||
| 1044 | Ga0157377_10033699 | |||
| 1045 | Ga0157379_10008747 | |||
| 1046 | Ga0157379_10809685 | |||
| 1047 | Ga0157376_10715502 | |||
| 1048 | Ga0157376_10794144 | |||
| 1049 | Ga0163161_10139020 | |||
| 1050 | Ga0197907_10862668 | |||
| 1051 | Ga0206356_11478300 | |||
| 1052 | Ga0213875_10001850 | |||
| 1053 | Ga0213875_10037330 | |||
| 1054 | Ga0213875_10285646 | |||
| 1055 | Ga0224712_10018640 | |||
| 1056 | Ga0224572_1003002 | |||
| 1057 | Ga0207656_10181556 | |||
| 1058 | Ga0207653_10007472 | |||
| 1059 | Ga0207692_10011283 | |||
| 1060 | Ga0207692_10017490 | |||
| 1061 | Ga0207692_10020494 | |||
| 1062 | Ga0207692_10021207 | |||
| 1063 | Ga0207692_10055442 | |||
| 1064 | Ga0207692_10084294 | |||
| 1065 | Ga0207692_10188985 | |||
| 1066 | Ga0207692_10357987 | |||
| 1067 | Ga0207642_10062907 | |||
| 1068 | Ga0207680_10877279 | |||
| 1069 | Ga0207685_10013968 | |||
| 1070 | Ga0207685_10020987 | |||
| 1071 | Ga0207685_10034664 | |||
| 1072 | Ga0207685_10080607 | |||
| 1073 | Ga0207699_10005459 | |||
| 1074 | Ga0207699_10006754 | |||
| 1075 | Ga0207699_10030995 | |||
| 1076 | Ga0207699_10031694 | |||
| 1077 | Ga0207699_10055208 | |||
| 1078 | Ga0207699_10100271 | |||
| 1079 | Ga0207643_10093812 | |||
| 1080 | Ga0207705_10033882 | |||
| 1081 | Ga0207684_10001543 | |||
| 1082 | Ga0207684_10051282 | |||
| 1083 | Ga0207684_10051638 | |||
| 1084 | Ga0207684_10053845 | |||
| 1085 | Ga0207684_11066377 | |||
| 1086 | Ga0207654_10052803 | |||
| 1087 | Ga0207707_10427185 | |||
| 1088 | Ga0207695_10278460 | |||
| 1089 | Ga0207671_10153014 | |||
| 1090 | Ga0207693_10009156 | |||
| 1091 | Ga0207693_10017411 | |||
| 1092 | Ga0207693_10020333 | |||
| 1093 | Ga0207693_10057579 | |||
| 1094 | Ga0207693_10058585 | |||
| 1095 | Ga0207693_10173378 | |||
| 1096 | Ga0207693_10201153 | |||
| 1097 | Ga0207693_10320794 | |||
| 1098 | Ga0207693_10397116 | |||
| 1099 | Ga0207663_10026354 | |||
| 1100 | Ga0207663_10034770 | |||
| 1101 | Ga0207663_10066797 | |||
| 1102 | Ga0207663_10104929 | |||
| 1103 | Ga0207663_10232130 | |||
| 1104 | Ga0207663_10358784 | |||
| 1105 | Ga0207660_10111488 | |||
| 1106 | Ga0207662_10022378 | |||
| 1107 | Ga0207657_10006630 | |||
| 1108 | Ga0207649_10294701 | |||
| 1109 | Ga0207649_10526681 | |||
| 1110 | Ga0207652_10045079 | |||
| 1111 | Ga0207652_10199759 | |||
| 1112 | Ga0207646_10003893 | |||
| 1113 | Ga0207646_10049592 | |||
| 1114 | Ga0207646_10070637 | |||
| 1115 | Ga0207646_10159093 | |||
| 1116 | Ga0207646_10509490 | |||
| 1117 | Ga0207659_10106127 | |||
| 1118 | Ga0207687_10214137 | |||
| 1119 | Ga0207700_10003743 | |||
| 1120 | Ga0207700_10017050 | |||
| 1121 | Ga0207700_10020297 | |||
| 1122 | Ga0207700_10035633 | |||
| 1123 | Ga0207700_10091899 | |||
| 1124 | Ga0207700_10402203 | |||
| 1125 | Ga0207700_10437208 | |||
| 1126 | Ga0207700_10547245 | |||
| 1127 | Ga0207700_10610206 | |||
| 1128 | Ga0207700_10648005 | |||
| 1129 | Ga0207700_11154036 | |||
| 1130 | Ga0207664_10001454 | |||
| 1131 | Ga0207664_10008935 | |||
| 1132 | Ga0207664_10010443 | |||
| 1133 | Ga0207664_10020033 | |||
| 1134 | Ga0207664_10024883 | |||
| 1135 | Ga0207664_10029411 | |||
| 1136 | Ga0207664_10063837 | |||
| 1137 | Ga0207664_10087096 | |||
| 1138 | Ga0207664_10107699 | |||
| 1139 | Ga0207664_10127474 | |||
| 1140 | Ga0207664_10128468 | |||
| 1141 | Ga0207664_10187106 | |||
| 1142 | Ga0207664_10193335 | |||
| 1143 | Ga0207664_10266704 | |||
| 1144 | Ga0207664_10338458 | |||
| 1145 | Ga0207664_10685791 | |||
| 1146 | Ga0207664_10689917 | |||
| 1147 | Ga0207644_10363379 | |||
| 1148 | Ga0207644_10826802 | |||
| 1149 | Ga0207690_10073008 | |||
| 1150 | Ga0207706_10082353 | |||
| 1151 | Ga0207709_10296870 | |||
| 1152 | Ga0207704_10235782 | |||
| 1153 | Ga0207665_10016654 | |||
| 1154 | Ga0207665_10018169 | |||
| 1155 | Ga0207665_10023453 | |||
| 1156 | Ga0207665_10034441 | |||
| 1157 | Ga0207665_10035970 | |||
| 1158 | Ga0207665_10077981 | |||
| 1159 | Ga0207665_10154828 | |||
| 1160 | Ga0207691_10099233 | |||
| 1161 | Ga0207711_10069983 | |||
| 1162 | Ga0207711_10127261 | |||
| 1163 | Ga0207661_10355329 | |||
| 1164 | Ga0207661_10741186 | |||
| 1165 | Ga0207679_10142124 | |||
| 1166 | Ga0207651_10091917 | |||
| 1167 | Ga0207712_10809793 | |||
| 1168 | Ga0207712_10978549 | |||
| 1169 | Ga0207640_10014870 | |||
| 1170 | Ga0207677_10448404 | |||
| 1171 | Ga0207639_10152675 | |||
| 1172 | Ga0207678_10025231 | |||
| 1173 | Ga0207708_10122687 | |||
| 1174 | Ga0207702_10031853 | |||
| 1175 | Ga0207702_10035699 | |||
| 1176 | Ga0207702_10288381 | |||
| 1177 | Ga0207702_10418018 | |||
| 1178 | Ga0207702_10569597 | |||
| 1179 | Ga0207702_11037777 | |||
| 1180 | Ga0207641_10071925 | |||
| 1181 | Ga0207648_10118491 | |||
| 1182 | Ga0207676_10152726 | |||
| 1183 | Ga0207676_10324529 | |||
| 1184 | Ga0207676_10618572 | |||
| 1185 | Ga0207674_10015027 | |||
| 1186 | Ga0207675_100713717 | |||
| 1187 | Ga0207683_10141737 | |||
| 1188 | Ga0207698_10625168 | |||
| 1189 | Ga0268266_10145267 | |||
| 1190 | Ga0268266_10242126 | |||
| 1191 | Ga0268266_10473472 | |||
| 1192 | Ga0268265_10285094 | |||
| 1193 | Ga0268264_10224715 | |||
| 1194 | Ga0268264_10274635 | |||
| 1195 | Ga0265337_1000014 | |||
| 1196 | Ga0265326_10000631 | |||
| 1197 | Ga0265319_1007325 | |||
| 1198 | Ga0265334_10001701 | |||
| 1199 | Ga0265318_10001324 | |||
| 1200 | Ga0265323_10001386 | |||
| 1201 | Ga0265322_10046930 | |||
| 1202 | Ga0265336_10001146 | |||
| 1203 | Ga0265336_10005343 | |||
| 1204 | Ga0265338_10000577 | |||
| 1205 | Ga0265338_10000785 | |||
| 1206 | Ga0265338_10422915 | |||
| 1207 | Ga0265332_10001642 | |||
| 1208 | Ga0265325_10034251 | |||
| 1209 | Ga0265340_10000640 | |||
| 1210 | Ga0265339_10006174 | |||
| 1211 | Ga0265316_10008119 | |||
| 1212 | Ga0307408_100499700 | |||
| 1213 | Ga0265313_10012855 | |||
| 1214 | Ga0265314_10028515 | |||
| 1215 | Ga0265342_10002040 | |||
| 1216 | Ga0307405_10499589 | |||
| 1217 | Ga0307416_100362911 | |||
| 1218 | Ga0307416_100621785 | |||
| 1219 | Ga0307415_101270076 | |||
| 1220 | Ga0373930_0126237 | |||
| 1221 | Ga0373959_0027959 | |||
| 1222 | Ga0373959_0137193 | |||
| 1223 | Ga0373926_0002908 | |||
| 1224 | Ga0373926_0008765 | |||
| 1225 | Ga0373926_0255371 | |||
| 1226 | Ga0373934_0000054 | |||
| 1227 | Ga0373934_0010113 | |||
| 1228 | Ga0373934_0012523 | |||
| 1229 | Ga0373934_0014314 | |||
| 1230 | Ga0373934_0023831 | |||
| 1231 | Ga0373944_0000487 | |||
| 1232 | Ga0373944_0006476 | |||
| 1233 | Ga0373944_0163722 | |||
| 1234 | Ga0373949_0015385 | |||
| 1235 | Ga0373952_0074784 | |||
| 1236 | Ga0373923_0001497 | |||
| 1237 | Ga0373923_0005890 | |||
| 1238 | Ga0373923_0011836 | |||
| 1239 | Ga0373936_0003881 | |||
| 1240 | Ga0373936_0006867 | |||
| 1241 | Ga0373936_0085333 | |||
| 1242 | Ga0373941_0238179 | |||
| 1243 | Ga0373945_0000672 | |||
| 1244 | Ga0373945_0105882 | |||
| 1245 | Ga0373953_0015410 | |||
| 1246 | Ga0373953_0022888 | |||
| 1247 | Ga0373953_0026177 | |||
| 1248 | Ga0373953_0125573 | |||
| 1249 | Ga0373954_0033816 | |||
| 1250 | Ga0373954_0087165 | |||
| 1251 | Ga0373956_0000348 | |||
| 1252 | Ga0373956_0005044 | |||
| 1253 | Ga0373956_0048329 | |||
| 1254 | Ga0373956_0056906 | |||
| 1255 | Ga0373956_0133923 | |||
| 1256 | Ga0373957_0000329 | |||
| 1257 | Ga0373957_0003152 | |||
| 1258 | Ga0373957_0040109 | |||
| 1259 | Ga0373957_0041086 | |||
| 1260 | Ga0373957_0052760 | |||
| 1261 | Ga0373957_0338459 | |||
| 1262 | Ga0373943_0013028 | |||
| 1263 | Ga0373943_0160559 | |||
| 1264 | Ga0373943_0254336 | |||
| 1265 | Ga0373943_0361343 | |||
| 1266 | Ga0373946_0000361 | |||
| 1267 | Ga0373946_0001103 | |||
| 1268 | Ga0373946_0168086 | |||
| 1269 | Ga0373946_0277544 | |||
| 1270 | Ga0373955_0000009 | |||
| 1271 | Ga0373955_0020641 | |||
| 1272 | Ga0373955_0041029 | |||
| 1273 | Ga0373955_0044907 | |||
| 1274 | Ga0373955_0061283 | |||
| 1275 | Ga0373955_0712958 | |||
| 1276 | Ga0373924_0000534 | |||
| 1277 | Ga0373924_0002485 | |||
| 1278 | Ga0373924_0015496 | |||
| 1279 | Ga0373924_0029218 | |||
| 1280 | Ga0373924_0042367 | |||
| 1281 | Ga0373924_0154176 | |||
| 1282 | Ga0373935_0001028 | |||
| 1283 | Ga0373935_0011605 | |||
| 1284 | Ga0373935_0316936 | |||
| 1285 | Ga0373935_0352212 | |||
| 1286 | Ga0373935_0466632 | |||
| 1287 | Ga0373935_0608448 | |||
| 1288 | Ga0373927_0002131 | |||
| 1289 | Ga0373927_0066743 | |||
| 1290 | Ga0373927_0270092 | |||
| 1291 | Ga0373927_0330416 | |||
| 1292 | Ga0373927_0527419 | |||
| 1293 | Ga0373933_0000006 | |||
| 1294 | Ga0373933_0008866 | |||
| 1295 | Ga0373933_0061159 | |||
| 1296 | Ga0373933_0063434 | |||
| 1297 | Ga0373933_0087049 | |||
| 1298 | Ga0373933_0595024 | |||
| 1299 | Ga0373947_0004988 | |||
| 1300 | Ga0373947_0009493 | |||
| 1301 | Ga0373947_0015119 | |||
| 1302 | Ga0373947_0035144 | |||
| 1303 | Ga0373947_0097316 | |||
| 1304 | Ga0373937_0000137 | |||
| 1305 | Ga0373937_0071260 | |||
| 1306 | Ga0373937_0193725 | |||
| 1307 | Ga0373937_0269592 | |||
| 1308 | Ga0373937_0316421 | |||
| 1309 | Ga0373937_0615719 | |||
| 1310 | Ga0373937_0643766 | |||
| 1311 | Ga0373925_0009693 | |||
| 1312 | Ga0373925_0075241 | |||
| 1313 | Ga0373925_0277113 | |||
| 1314 | Ga0373925_0499808 | |||
| 1315 | Ga0436364_0115578 | |||
| 1316 | Ga0436364_0481785 | |||
| 1317 | Ga0436364_0656945 | |||
| 1318 | Ga0436364_0683808 | |||
| 1319 | Ga0436364_0859559 | |||
| 1320 | Ga0436364_1101958 | |||
| 1321 | Ga0436364_1408240 | |||
| 1322 | Ga0436364_1456399 | |||
| 1323 | Ga0436360_0594066 | |||
| 1324 | Ga0436363_1229149 | |||
| 1325 | Ga0436362_0449328 | |||
| 1326 | Ga0436362_1072729 | |||
| 1327 | Ga0439463_005007 | |||
| 1328 | Ga0450914_054080 | |||
| 1329 | Ga0450890_028549 | |||
| 1330 | Ga0439459_0012169 | |||
| 1331 | Ga0439464_0131536 | |||
| 1332 | Ga0439440_0070240 | |||
| 1333 | Ga0439440_0117277 | |||
| 1334 | Ga0466963_0029505 | |||
| 1335 | Ga0466963_0067066 | |||
| 1336 | Ga0466963_0198034 | |||
| 1337 | Ga0466968_0407066 | |||
| 1338 | Ga0466967_0128447 | |||
| 1339 | Ga0466967_0234676 | |||
| 1340 | Ga0495592_0000189 | |||
| 1341 | Ga0495592_0012943 | |||
| 1342 | Ga0495592_0017133 | |||
| 1343 | Ga0495592_0044544 | |||
| 1344 | Ga0495592_0055380 | |||
| 1345 | Ga0495592_0228355 | |||
| 1346 | Ga0495603_0066453 | |||
| 1347 | Ga0495603_0238171 | |||
| 1348 | Ga0495629_0007556 | |||
| 1349 | Ga0495629_0199074 | |||
| 1350 | Ga0495629_0242924 | |||
| 1351 | Ga0495641_0008878 | |||
| 1352 | Ga0495641_0018883 | |||
| 1353 | Ga0495641_0036550 | |||
| 1354 | Ga0495641_0073557 | |||
| 1355 | Ga0495641_0183996 | |||
| 1356 | Ga0495651_0000071 | |||
| 1357 | Ga0495651_0008956 | |||
| 1358 | Ga0495651_0015837 | |||
| 1359 | Ga0495651_0037625 | |||
| 1360 | Ga0495651_0057616 | |||
| 1361 | Ga0495651_0058914 | |||
| 1362 | Ga0495651_0064315 | |||
| 1363 | Ga0495651_0064573 | |||
| 1364 | Ga0495651_0103327 | |||
| 1365 | Ga0495653_0000440 | |||
| 1366 | Ga0495653_0001696 | |||
| 1367 | Ga0495653_0010123 | |||
| 1368 | Ga0495653_0014979 | |||
| 1369 | Ga0495653_0025484 | |||
| 1370 | Ga0495653_0039666 | |||
| 1371 | Ga0495653_0102228 | |||
| 1372 | Ga0495653_0114652 | |||
| 1373 | Ga0495653_0138791 | |||
| 1374 | Ga0495653_0158087 | |||
| 1375 | Ga0495580_0037200 | |||
| 1376 | Ga0495582_0020982 | |||
| 1377 | Ga0495582_0041032 | |||
| 1378 | Ga0495582_0244030 | |||
| 1379 | Ga0495639_0111802 | |||
| 1380 | Ga0495639_0309062 | |||
| 1381 | Ga0495662_0027711 | |||
| 1382 | Ga0495662_0047807 | |||
| 1383 | Ga0495662_0054185 | |||
| 1384 | Ga0495664_0015522 | |||
| 1385 | Ga0495664_0016996 | |||
| 1386 | Ga0495664_0062881 | |||
| 1387 | Ga0495664_0207885 | |||
| 1388 | Ga0495664_0230720 | |||
| 1389 | Ga0495664_0232485 | |||
| 1390 | Ga0495664_0237910 | |||
| 1391 | Ga0495664_0264077 | |||
| 1392 | Ga0495594_0037729 | |||
| 1393 | Ga0495608_0000107 | |||
| 1394 | Ga0495608_0002066 | |||
| 1395 | Ga0495608_0003637 | |||
| 1396 | Ga0495608_0021626 | |||
| 1397 | Ga0495608_0043776 | |||
| 1398 | Ga0495608_0066507 | |||
| 1399 | Ga0495618_0016510 | |||
| 1400 | Ga0495618_0016870 | |||
| 1401 | Ga0495618_0036120 | |||
| 1402 | Ga0495618_0041529 | |||
| 1403 | Ga0495618_0057611 | |||
| 1404 | Ga0495618_0090809 | |||
| 1405 | Ga0495628_0000136 | |||
| 1406 | Ga0495628_0034116 | |||
| 1407 | Ga0495628_0036466 | |||
| 1408 | Ga0495628_0183741 | |||
| 1409 | Ga0495628_0211363 | |||
| 1410 | Ga0495628_0293126 | |||
| 1411 | Ga0495630_0013910 | |||
| 1412 | Ga0495630_0092218 | |||
| 1413 | Ga0495630_0092443 | |||
| 1414 | Ga0495630_0117715 | |||
| 1415 | Ga0495630_0280634 | |||
| 1416 | Ga0495630_0428317 | |||
| 1417 | Ga0495666_0010981 | |||
| 1418 | Ga0495666_0017237 | |||
| 1419 | Ga0495652_0000273 | |||
| 1420 | Ga0495652_0009562 | |||
| 1421 | Ga0495652_0019154 | |||
| 1422 | Ga0495652_0031702 | |||
| 1423 | Ga0495652_0049231 | |||
| 1424 | Ga0495652_0090035 | |||
| 1425 | Ga0495652_0178780 | |||
| 1426 | Ga0495652_0266431 | |||
| 1427 | Ga0495652_0792161 | |||
| 1428 | Ga0495665_0001336 | |||
| 1429 | Ga0495665_0019416 | |||
| 1430 | Ga0495665_0038008 | |||
| 1431 | Ga0495665_0322783 | |||
| 1432 | Ga0495665_0512905 | |||
| 1433 | Ga0495640_0059935 | |||
| 1434 | Ga0495640_0074714 | |||
| 1435 | Ga0495640_0148678 | |||
| 1436 | Ga0495640_0308251 | |||
| 1437 | Ga0495586_0025432 | |||
| 1438 | Ga0495586_0025530 | |||
| 1439 | Ga0495586_0030782 | |||
| 1440 | Ga0495586_0079771 | |||
| 1441 | Ga0495586_0220821 | |||
| 1442 | Ga0495587_0000070 | |||
| 1443 | Ga0495587_0001614 | |||
| 1444 | Ga0495587_0021510 | |||
| 1445 | Ga0495587_0046214 | |||
| 1446 | Ga0495587_0057369 | |||
| 1447 | Ga0495587_0097819 | |||
| 1448 | Ga0495645_0023119 | |||
| 1449 | Ga0495645_0027710 | |||
| 1450 | Ga0495645_0060242 | |||
| 1451 | Ga0495645_0183190 | |||
| 1452 | Ga0495645_0208376 | |||
| 1453 | Ga0495645_0886278 | |||
| 1454 | Ga0495667_0000048 | |||
| 1455 | Ga0495667_0000183 | |||
| 1456 | Ga0495667_0005886 | |||
| 1457 | Ga0495667_0023204 | |||
| 1458 | Ga0495667_0028695 | |||
| 1459 | Ga0495667_0044109 | |||
| 1460 | Ga0495667_0049352 | |||
| 1461 | Ga0495667_0052864 | |||
| 1462 | Ga0495667_0104600 | |||
| 1463 | Ga0495667_0141945 | |||
| 1464 | Ga0495667_0455517 | |||
| 1465 | Ga0495656_0286980 | |||
| 1466 | Ga0495634_0005086 | |||
| 1467 | Ga0495634_0053735 | |||
| 1468 | Ga0495634_0073569 | |||
| 1469 | Ga0495634_0084406 | |||
| 1470 | Ga0495634_0087862 | |||
| 1471 | Ga0495634_0148706 | |||
| 1472 | Ga0495635_0009154 | |||
| 1473 | Ga0495635_0018487 | |||
| 1474 | Ga0495635_0021653 | |||
| 1475 | Ga0495635_0041203 | |||
| 1476 | Ga0495635_0114747 | |||
| 1477 | Ga0495635_0246269 | |||
| 1478 | Ga0495635_0246871 | |||
| 1479 | Ga0495635_0297620 | |||
| 1480 | Ga0495588_0039429 | |||
| 1481 | Ga0495588_0208879 | |||
| 1482 | Ga0495657_0000046 | |||
| 1483 | Ga0495657_0015776 | |||
| 1484 | Ga0495657_0017777 | |||
| 1485 | Ga0495657_0022180 | |||
| 1486 | Ga0495657_0092487 | |||
| 1487 | Ga0495657_0264920 | |||
| 1488 | Ga0495657_0299554 | |||
| 1489 | Ga0495657_0326491 | |||
| 1490 | Ga0495657_0468318 | |||
| 1491 | Ga0495599_0000023 | |||
| 1492 | Ga0495599_0001737 | |||
| 1493 | Ga0495599_0008495 | |||
| 1494 | Ga0495599_0016522 | |||
| 1495 | Ga0495599_0017052 | |||
| 1496 | Ga0495599_0026084 | |||
| 1497 | Ga0495599_0082477 | |||
| 1498 | Ga0495599_0083357 | |||
| 1499 | Ga0495623_0000157 | |||
| 1500 | Ga0495623_0013680 | |||
| 1501 | Ga0495623_0035232 | |||
| 1502 | Ga0495646_0000304 | |||
| 1503 | Ga0495646_0018360 | |||
| 1504 | Ga0495646_0019197 | |||
| 1505 | Ga0495646_0173103 | |||
| 1506 | Ga0495646_0495856 | |||
| 1507 | Ga0495647_0039238 | |||
| 1508 | Ga0495613_0064728 | |||
| 1509 | Ga0495613_0096210 | |||
| 1510 | Ga0495613_0288918 | |||
| 1511 | Ga0495624_0011807 | |||
| 1512 | Ga0495624_0015893 | |||
| 1513 | Ga0495624_0483078 | |||
| 1514 | Ga0495624_0860394 | |||
| 1515 | Ga0495600_0011538 | |||
| 1516 | Ga0495600_0013146 | |||
| 1517 | Ga0495600_0124236 | |||
| 1518 | Ga0495600_0169535 | |||
| 1519 | Ga0495600_0202716 | |||
| 1520 | Ga0495581_0003943 | |||
| 1521 | Ga0495581_0011146 | |||
| 1522 | Ga0495581_0041040 | |||
| 1523 | Ga0495581_0060369 | |||
| 1524 | Ga0495604_0000037 | |||
| 1525 | Ga0495604_0000831 | |||
| 1526 | Ga0495604_0017074 | |||
| 1527 | Ga0495604_0018550 | |||
| 1528 | Ga0495604_0032937 | |||
| 1529 | Ga0495604_0035364 | |||
| 1530 | Ga0495604_0037551 | |||
| 1531 | Ga0495604_0098632 | |||
| 1532 | Ga0495604_0261910 | |||
| 1533 | Ga0495674_0002352 | |||
| 1534 | Ga0495674_0009843 | |||
| 1535 | Ga0495674_0012129 | |||
| 1536 | Ga0495674_0041784 | |||
| 1537 | Ga0495674_0054130 | |||
| 1538 | Ga0495674_0080967 | |||
| 1539 | Ga0495674_0393565 | |||
| 1540 | Ga0495674_0419358 | |||
| 1541 | Ga0495674_0824739 | |||
| 1542 | Ga0495676_0039938 | |||
| 1543 | Ga0495676_0092300 | |||
| 1544 | Ga0495676_0110564 | |||
| 1545 | Ga0495676_0118503 | |||
| 1546 | Ga0495676_0185373 | |||
| 1547 | Ga0495680_0000260 | |||
| 1548 | Ga0495680_0006883 | |||
| 1549 | Ga0495680_0008303 | |||
| 1550 | Ga0495680_0014059 | |||
| 1551 | Ga0495680_0031036 | |||
| 1552 | Ga0495680_0035625 | |||
| 1553 | Ga0495680_0065532 | |||
| 1554 | Ga0495680_0402548 | |||
| 1555 | Ga0495675_0000359 | |||
| 1556 | Ga0495675_0013383 | |||
| 1557 | Ga0495675_0020902 | |||
| 1558 | Ga0495675_0071856 | |||
| 1559 | Ga0495675_0294839 | |||
| 1560 | Ga0495684_0005428 | |||
| 1561 | Ga0495684_0013919 | |||
| 1562 | Ga0495684_0025499 | |||
| 1563 | Ga0495684_0029362 | |||
| 1564 | Ga0495684_0051796 | |||
| 1565 | Ga0495684_0059458 | |||
| 1566 | Ga0495593_0007056 | |||
| 1567 | Ga0495593_0028366 | |||
| 1568 | Ga0495593_0065071 | |||
| 1569 | Ga0495593_0080065 | |||
| 1570 | Ga0495602_0000118 | |||
| 1571 | Ga0495602_0015865 | |||
| 1572 | Ga0495602_0045394 | |||
| 1573 | Ga0495602_0062668 | |||
| 1574 | Ga0495602_0066761 | |||
| 1575 | Ga0495602_0069028 | |||
| 1576 | Ga0495602_0099042 | |||
| 1577 | Ga0495602_0103296 | |||
| 1578 | Ga0495602_0116430 | |||
| 1579 | Ga0495602_0383385 | |||
| 1580 | Ga0495614_0156041 | |||
| 1581 | Ga0496100_0498829 | |||
| 1582 | Ga0496100_0578620 | |||
| 1583 | Ga0496100_0842321 | |||
| 1584 | Ga0496101_0056885 | |||
| 1585 | Ga0496101_0155317 | |||
| 1586 | Ga0496102_0025053 | |||
| 1587 | Ga0496103_0044328 | |||
| 1588 | Ga0496103_0547784 | |||
| 1589 | Ga0496104_0000760 | |||
| 1590 | Ga0496104_0003780 | |||
| 1591 | Ga0496104_0275459 | |||
| 1592 | Ga0496105_0024389 | |||
| 1593 | Ga0496105_0032602 | |||
| 1594 | Ga0496105_0036121 | |||
| 1595 | Ga0496105_0272426 | |||
| 1596 | Ga0496106_0112262 | |||
| 1597 | Ga0496106_0385382 | |||
| 1598 | Ga0496107_0149964 | |||
| 1599 | Ga0496107_0360127 | |||
| 1600 | Ga0496108_0085567 | |||
| 1601 | Ga0496108_0733344 | |||
| 1602 | Ga0496109_0053625 | |||
| 1603 | Ga0496109_0129918 | |||
| 1604 | Ga0496109_0215597 | |||
| 1605 | Ga0496110_0015154 | |||
| 1606 | Ga0496110_0058547 | |||
| 1607 | Ga0496111_0139778 | |||
| 1608 | Ga0496112_0000984 | |||
| 1609 | Ga0496112_0274813 | |||
| 1610 | Ga0496112_0426159 | |||
| 1611 | Ga0496112_0751277 | |||
| 1612 | Ga0496113_0751646 | |||
| 1613 | Ga0496114_0120894 | |||
| 1614 | Ga0496115_0043190 | |||
| 1615 | Ga0496115_0286506 | |||
| 1616 | Ga0496115_0843324 | |||
| 1617 | Ga0501225_0310984 | |||
| 1618 | nmdc:mga0n895_160943_c1 | |||
| 1619 | nmdc:mga0n895_2225_c1 | |||
| 1620 | nmdc:mga0n895_347986_c1 | |||
| 1621 | nmdc:mga0n895_730466_c1 | |||
| 1622 | nmdc:mga0rr50_122743_c1 | |||
| 1623 | nmdc:mga0rr50_296316_c1 | |||
| 1624 | nmdc:mga0rr50_732986_c1 | |||
| 1625 | nmdc:mga08x19_119545_c1 | |||
| 1626 | nmdc:mga08x19_291818_c1 | |||
| 1627 | nmdc:mga08x19_532654_c1 | |||
| 1628 | nmdc:mga0a205_488752_c1 | |||
| 1629 | Ga0495601_0053967 | |||
| 1630 | Ga0495601_0080308 | |||
| 1631 | Ga0495601_0136261 | |||
| 1632 | Ga0495601_0201196 | |||
| 1633 | Ga0495601_0325203 | |||
| 1634 | Ga0495612_0004967 | |||
| 1635 | Ga0495612_0144591 | |||
| 1636 | Ga0495612_0181928 | |||
| 1637 | Ga0495612_0361170 | |||
| 1638 | Ga0495595_0002310 | |||
| 1639 | Ga0495595_0003631 | |||
| 1640 | Ga0495595_0023110 | |||
| 1641 | Ga0495595_0170061 | |||
| 1642 | Ga0495619_0085583 | |||
| 1643 | Ga0495619_0092705 | |||
| 1644 | Ga0495619_0110355 | |||
| 1645 | Ga0495619_0224412 | |||
| 1646 | Ga0495619_0304386 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7r8y-assembly1.cif.gz_B | ancestral protein ancthen of phosphomethylpyrimidine kinases family | 0.458 | 127 | 157 |
| 1wpn-assembly1.cif.gz_B | crystal structure of the n-terminal core of bacillus subtilis inorganic pyrophosphatase | 0.4087 | 127 | 160 |
| 8hhm-assembly1.cif.gz_A | cryo-em structure of the cas12m2-crrna-target dna ternary complex intermediate state | 0.3453 | 74 | 157 |
| 8czg-assembly4.cif.gz_D | human bak in complex with the df3 peptide | 0.3343 | 86 | 157 |
| 5hgl-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.2948 | 61 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hawA01 | Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) | 0.4139 | 127 | 160 | 3.90.1640.10 |
| af_I1KBF6_325_392_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.4137 | 85 | 158 | 1.10.10.60 |
| af_I1KBF6_325_392_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.4033 | 85 | 158 | 1.10.10.60 |
| af_A0A0R0LBR5_269_432_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3797 | 59 | 105 | 1.20.1250.20 |
| 1volA02 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.3516 | 73 | 160 | 1.10.472.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8LMX5-F1-model_v4 | deleted | 0.9885 | 5 | 64 |
|
| AF-A0A3S3LH18-F1-model_v4 | DUF501 domain-containing protein | 0.975 | 2 | 58 |
|
| AF-A0A2S8MK75-F1-model_v4 | deleted | 0.9739 | 5 | 77 |
|
| AF-A0A7V9ZHG7-F1-model_v4 | DUF501 domain-containing protein | 0.9711 | 4 | 112 |
|
| AF-A0A127T3I5-F1-model_v4 | DUF501 domain-containing protein | 0.9656 | 6 | 69 |
|