F482328

General Info

Members Datasets Scaffolds Average Seq Length
823 281 1646 168

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100864637|Ga0070707_1008646371
Length 199
Sequence VRALSAADVTAVTLQLGRAPRGLLGVAHRCPCGLPDVVETAPRLPDGTPFPTLYYLTCPRAAAAVGRLEAGGLMREMTQRLAAEPGLRQAYLAAHRDYLARRDEAARASGVEPLPPGTPSAGGMPDRVKCLHALVAHELAVPGTSPLGREALLAAGEWWRAGRCVSEPTVEGAGAAGGAPEASGRHGVAVPAEPRAAVP

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
153 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
158 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
203 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
204 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.37
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100864637 3300005468 Bacteria 868
2 JGI25407J50210_10013314 3300003373 Bacteria 2114
3 JGI25404J52841_10000310 3300003659 Bacteria 6411
4 Ga0070658_10102376 3300005327 Bacteria 2368
5 Ga0070683_100267951 3300005329 Bacteria 1624
6 Ga0070683_100546892 3300005329 Bacteria 1107
7 Ga0068869_100102426 3300005334 Bacteria 2167
8 Ga0070666_10047240 3300005335 Bacteria 2890
9 Ga0070680_100166929 3300005336 Bacteria 1851
10 Ga0068868_100048233 3300005338 Bacteria 3340
11 Ga0068868_100913577 3300005338 Bacteria 798
12 Ga0070660_100256345 3300005339 Bacteria 1427
13 Ga0070689_100874902 3300005340 Bacteria 794
14 Ga0070691_10186858 3300005341 Bacteria 1081
15 Ga0070675_100060805 3300005354 Bacteria 3118
16 Ga0070671_100919814 3300005355 Bacteria 764
17 Ga0070673_100195179 3300005364 Bacteria 1741
18 Ga0070659_100045863 3300005366 Bacteria 3425
19 Ga0070667_100910092 3300005367 Bacteria 819
20 Ga0070709_10039770 3300005434 Bacteria 2887
21 Ga0070709_10043542 3300005434 Bacteria 2776
22 Ga0070709_10129451 3300005434 Bacteria 1721
23 Ga0070709_10138419 3300005434 Bacteria 1670
24 Ga0070709_10158953 3300005434 Bacteria 1569
25 Ga0070709_10176687 3300005434 Bacteria 1496
26 Ga0070709_10324784 3300005434 Bacteria 1130
27 Ga0070709_10411571 3300005434 Bacteria 1011
28 Ga0070714_100024977 3300005435 Bacteria 4927
29 Ga0070714_100044665 3300005435 Bacteria 3751
30 Ga0070714_100057055 3300005435 Bacteria 3341
31 Ga0070714_100066933 3300005435 Bacteria 3096
32 Ga0070714_100173088 3300005435 Bacteria 1960
33 Ga0070714_100193703 3300005435 Bacteria 1856
34 Ga0070714_100212514 3300005435 Bacteria 1774
35 Ga0070714_100269245 3300005435 Bacteria 1579
36 Ga0070714_100329603 3300005435 Bacteria 1429
37 Ga0070714_100350549 3300005435 Bacteria 1386
38 Ga0070714_100555503 3300005435 Bacteria 1099
39 Ga0070714_100565660 3300005435 Bacteria 1089
40 Ga0070714_100640505 3300005435 Bacteria 1023
41 Ga0070714_100952389 3300005435 Bacteria 834
42 Ga0070713_100012145 3300005436 Bacteria 6307
43 Ga0070713_100097618 3300005436 Bacteria 2539
44 Ga0070713_100097921 3300005436 Bacteria 2535
45 Ga0070713_100206595 3300005436 Bacteria 1776
46 Ga0070713_100431075 3300005436 Bacteria 1235
47 Ga0070713_100447657 3300005436 Bacteria 1212
48 Ga0070713_100783577 3300005436 Bacteria 913
49 Ga0070713_100800574 3300005436 Bacteria 903
50 Ga0070713_100830704 3300005436 Bacteria 886
51 Ga0070710_10006448 3300005437 Bacteria 5638
52 Ga0070710_10010218 3300005437 Bacteria 4606
53 Ga0070710_10019136 3300005437 Bacteria 3535
54 Ga0070710_10049771 3300005437 Bacteria 2345
55 Ga0070710_10141176 3300005437 Bacteria 1477
56 Ga0070710_10153878 3300005437 Bacteria 1420
57 Ga0070710_10233393 3300005437 Bacteria 1175
58 Ga0070710_10425878 3300005437 Bacteria 895
59 Ga0070710_10436166 3300005437 Bacteria 885
60 Ga0070710_10458451 3300005437 Bacteria 865
61 Ga0070711_100037014 3300005439 Bacteria 3272
62 Ga0070711_100164268 3300005439 Bacteria 1686
63 Ga0070711_100167965 3300005439 Bacteria 1669
64 Ga0070711_100273184 3300005439 Bacteria 1334
65 Ga0070711_100345855 3300005439 Bacteria 1194
66 Ga0070711_100577402 3300005439 Bacteria 935
67 Ga0070705_100090754 3300005440 Bacteria 1902
68 Ga0070705_100094434 3300005440 Bacteria 1872
69 Ga0070705_100146870 3300005440 Bacteria 1559
70 Ga0070694_100601502 3300005444 Bacteria 885
71 Ga0070708_100001881 3300005445 Bacteria 16105
72 Ga0070708_100024317 3300005445 Bacteria 5166
73 Ga0070708_100241243 3300005445 Bacteria 1697
74 Ga0070708_100316337 3300005445 Bacteria 1470
75 Ga0070708_100424157 3300005445 Bacteria 1254
76 Ga0070708_100652393 3300005445 Bacteria 992
77 Ga0070708_101114582 3300005445 Bacteria 739
78 Ga0070678_100044593 3300005456 Bacteria 3167
79 Ga0070662_100555028 3300005457 Bacteria 963
80 Ga0070681_10081332 3300005458 Bacteria 3195
81 Ga0070681_10425969 3300005458 Bacteria 1239
82 Ga0070681_10809881 3300005458 Bacteria 854
83 Ga0070685_10363324 3300005466 Bacteria 993
84 Ga0070706_100007753 3300005467 Bacteria 10039
85 Ga0070706_100023920 3300005467 Bacteria 5624
86 Ga0070706_100037414 3300005467 Bacteria 4482
87 Ga0070706_100149267 3300005467 Bacteria 2182
88 Ga0070706_100155037 3300005467 Bacteria 2138
89 Ga0070706_100502524 3300005467 Bacteria 1128
90 Ga0070707_100084049 3300005468 Bacteria 3076
91 Ga0070707_100137185 3300005468 Bacteria 2380
92 Ga0070707_100210452 3300005468 Bacteria 1895
93 Ga0070707_100309098 3300005468 Bacteria 1536
94 Ga0070698_100000840 3300005471 Bacteria 33618
95 Ga0070698_100011091 3300005471 Bacteria 9577
96 Ga0070698_100040235 3300005471 Bacteria 4806
97 Ga0070698_100104505 3300005471 Bacteria 2802
98 Ga0070698_100126977 3300005471 Bacteria 2508
99 Ga0070698_100518082 3300005471 Bacteria 1131
100 Ga0070698_100550993 3300005471 Bacteria 1092
101 Ga0070698_100686576 3300005471 Bacteria 966
102 Ga0070699_100000896 3300005518 Bacteria 27814
103 Ga0070699_100088126 3300005518 Bacteria 2710
104 Ga0070699_100285777 3300005518 Bacteria 1478
105 Ga0070699_100988678 3300005518 Bacteria 771
106 Ga0070679_100050333 3300005530 Bacteria 4150
107 Ga0070679_101324828 3300005530 Bacteria 666
108 Ga0070697_100001714 3300005536 Bacteria 16736
109 Ga0068853_100158691 3300005539 Bacteria 2039
110 Ga0070686_100313982 3300005544 Bacteria 1166
111 Ga0070695_100384027 3300005545 Bacteria 1060
112 Ga0070696_100019246 3300005546 Bacteria 4623
113 Ga0070696_100050512 3300005546 Bacteria 2890
114 Ga0070693_100163679 3300005547 Bacteria 1419
115 Ga0070665_100137708 3300005548 Bacteria 2444
116 Ga0070665_100299019 3300005548 Bacteria 1612
117 Ga0070665_101014733 3300005548 Bacteria 842
118 Ga0070664_100102935 3300005564 Bacteria 2485
119 Ga0068854_100095502 3300005578 Bacteria 2219
120 Ga0068856_100026135 3300005614 Bacteria 5692
121 Ga0068856_100226287 3300005614 Bacteria 1886
122 Ga0068856_100306390 3300005614 Bacteria 1606
123 Ga0068856_100510166 3300005614 Bacteria 1223
124 Ga0068856_101103005 3300005614 Bacteria 811
125 Ga0070702_100031508 3300005615 Bacteria 2903
126 Ga0068852_100249382 3300005616 Bacteria 1700
127 Ga0068852_100733023 3300005616 Bacteria 1000
128 Ga0068859_100333723 3300005617 Bacteria 1610
129 Ga0068859_101821673 3300005617 Bacteria 672
130 Ga0068864_100220997 3300005618 Bacteria 1748
131 Ga0068864_100380179 3300005618 Bacteria 1338
132 Ga0068866_10184837 3300005718 Bacteria 1234
133 Ga0068861_100340880 3300005719 Bacteria 1312
134 Ga0068870_10191530 3300005840 Bacteria 1234
135 Ga0068863_100040082 3300005841 Bacteria 4454
136 Ga0068863_100283865 3300005841 Bacteria 1604
137 Ga0068863_100678809 3300005841 Bacteria 1023
138 Ga0068858_100145149 3300005842 Bacteria 2228
139 Ga0068858_100364829 3300005842 Bacteria 1385
140 Ga0068860_100673450 3300005843 Bacteria 1043
141 Ga0081455_10096210 3300005937 Bacteria 2388
142 Ga0081540_1000352 3300005983 Bacteria 46545
143 Ga0081540_1001842 3300005983 Bacteria 17783
144 Ga0070717_10002549 3300006028 Bacteria 12843
145 Ga0070717_10012325 3300006028 Bacteria 6516
146 Ga0070717_10019617 3300006028 Bacteria 5306
147 Ga0070717_10027320 3300006028 Bacteria 4561
148 Ga0070717_10213967 3300006028 Bacteria 1692
149 Ga0070717_10256788 3300006028 Bacteria 1545
150 Ga0070717_10320678 3300006028 Bacteria 1380
151 Ga0070717_10455395 3300006028 Bacteria 1153
152 Ga0070717_10553771 3300006028 Bacteria 1041
153 Ga0070717_11261817 3300006028 Bacteria 672
154 Ga0070715_10002283 3300006163 Bacteria 5834
155 Ga0070715_10062450 3300006163 Bacteria 1639
156 Ga0070715_10138160 3300006163 Bacteria 1180
157 Ga0070716_100096503 3300006173 Bacteria 1802
158 Ga0070716_100123514 3300006173 Bacteria 1625
159 Ga0070716_100186605 3300006173 Bacteria 1366
160 Ga0070716_100448851 3300006173 Bacteria 939
161 Ga0070712_100018294 3300006175 Bacteria 4549
162 Ga0070712_100032788 3300006175 Bacteria 3510
163 Ga0070712_100143593 3300006175 Bacteria 1824
164 Ga0070712_100161552 3300006175 Bacteria 1730
165 Ga0070712_100279419 3300006175 Bacteria 1344
166 Ga0070712_100393264 3300006175 Bacteria 1143
167 Ga0070712_100740756 3300006175 Bacteria 840
168 Ga0070712_100751508 3300006175 Bacteria 834
169 Ga0097621_100231564 3300006237 Bacteria 1613
170 Ga0097621_100340096 3300006237 Bacteria 1332
171 Ga0068871_100123246 3300006358 Bacteria 2192
172 Ga0068871_100150020 3300006358 Bacteria 1987
173 Ga0075433_10651067 3300006852 Bacteria 924
174 Ga0075434_100027090 3300006871 Bacteria 5625
175 Ga0075434_100225849 3300006871 Bacteria 1892
176 Ga0075434_100660462 3300006871 Bacteria 1064
177 Ga0068865_100493401 3300006881 Bacteria 1020
178 Ga0075436_100149231 3300006914 Bacteria 1644
179 Ga0097620_100333714 3300006931 Bacteria 1610
180 Ga0097620_101822104 3300006931 Bacteria 672
181 Ga0075435_100117766 3300007076 Bacteria 2214
182 Ga0075435_100240500 3300007076 Bacteria 1540
183 Ga0075435_100367054 3300007076 Bacteria 1235
184 Ga0105240_10214568 3300009093 Bacteria 2246
185 Ga0105245_10124345 3300009098 Bacteria 2413
186 Ga0105245_11134070 3300009098 Bacteria 829
187 Ga0105247_10022850 3300009101 Bacteria 3767
188 Ga0105247_10146479 3300009101 Bacteria 1552
189 Ga0114129_11254739 3300009147 Bacteria 920
190 Ga0105241_10067204 3300009174 Bacteria 2774
191 Ga0105241_10069659 3300009174 Bacteria 2727
192 Ga0105242_10050687 3300009176 Bacteria 3380
193 Ga0105248_11866145 3300009177 Bacteria 682
194 Ga0105237_10192750 3300009545 Bacteria 2038
195 Ga0105237_10720286 3300009545 Bacteria 1004
196 Ga0105238_10234862 3300009551 Bacteria 1811
197 Ga0105238_10900028 3300009551 Bacteria 903
198 Ga0105249_10421801 3300009553 Bacteria 1368
199 Ga0105239_11487150 3300010375 Bacteria 782
200 Ga0105246_10123769 3300011119 Bacteria 1921
201 Ga0105246_10761913 3300011119 Bacteria 855
202 Ga0157338_1001270 3300012515 Bacteria 1765
203 Ga0157373_10054631 3300013100 Bacteria 2838
204 Ga0157373_10389808 3300013100 Bacteria 997
205 Ga0157370_10126004 3300013104 Bacteria 2390
206 Ga0157370_10344989 3300013104 Bacteria 1372
207 Ga0157369_10055956 3300013105 Bacteria 4257
208 Ga0157369_10652239 3300013105 Bacteria 1085
209 Ga0157369_10693217 3300013105 Bacteria 1049
210 Ga0157369_11114813 3300013105 Bacteria 806
211 Ga0157374_11440129 3300013296 Bacteria 712
212 Ga0157378_10476288 3300013297 Bacteria 1243
213 Ga0163162_10078559 3300013306 Bacteria 3365
214 Ga0157375_10193237 3300013308 Bacteria 2190
215 Ga0157375_10200151 3300013308 Bacteria 2153
216 Ga0163163_10064154 3300014325 Bacteria 3645
217 Ga0163163_10109157 3300014325 Bacteria 2794
218 Ga0163163_10448519 3300014325 Bacteria 1350
219 Ga0163163_10733302 3300014325 Bacteria 1052
220 Ga0163163_12047778 3300014325 Bacteria 632
221 Ga0157377_10033699 3300014745 Bacteria 2797
222 Ga0157379_10008747 3300014968 Bacteria 8824
223 Ga0157379_10809685 3300014968 Bacteria 885
224 Ga0157376_10715502 3300014969 Bacteria 1008
225 Ga0157376_10794144 3300014969 Bacteria 959
226 Ga0163161_10139020 3300017792 Bacteria 1838
227 Ga0197907_10862668 3300020069 Bacteria 3123
228 Ga0206356_11478300 3300020070 Bacteria 766
229 Ga0213875_10001850 3300021388 Bacteria 13157
230 Ga0213875_10037330 3300021388 Bacteria 2289
231 Ga0213875_10285646 3300021388 Bacteria 779
232 Ga0224712_10018640 3300022467 Bacteria 2324
233 Ga0224572_1003002 3300024225 Bacteria 2797
234 Ga0207656_10181556 3300025321 Bacteria 1010
235 Ga0207653_10007472 3300025885 Bacteria 3406
236 Ga0207692_10011283 3300025898 Bacteria 3796
237 Ga0207692_10017490 3300025898 Bacteria 3199
238 Ga0207692_10020494 3300025898 Bacteria 3008
239 Ga0207692_10021207 3300025898 Bacteria 2969
240 Ga0207692_10055442 3300025898 Bacteria 2029
241 Ga0207692_10084294 3300025898 Bacteria 1707
242 Ga0207692_10188985 3300025898 Bacteria 1204
243 Ga0207692_10357987 3300025898 Bacteria 901
244 Ga0207642_10062907 3300025899 Bacteria 1733
245 Ga0207680_10877279 3300025903 Bacteria 643
246 Ga0207685_10013968 3300025905 Bacteria 2501
247 Ga0207685_10020987 3300025905 Bacteria 2181
248 Ga0207685_10034664 3300025905 Bacteria 1835
249 Ga0207685_10080607 3300025905 Bacteria 1346
250 Ga0207699_10005459 3300025906 Bacteria 6085
251 Ga0207699_10006754 3300025906 Bacteria 5573
252 Ga0207699_10030995 3300025906 Bacteria 2998
253 Ga0207699_10031694 3300025906 Bacteria 2971
254 Ga0207699_10055208 3300025906 Bacteria 2363
255 Ga0207699_10100271 3300025906 Bacteria 1836
256 Ga0207643_10093812 3300025908 Bacteria 1753
257 Ga0207705_10033882 3300025909 Bacteria 3649
258 Ga0207684_10001543 3300025910 Bacteria 24639
259 Ga0207684_10051282 3300025910 Bacteria 3501
260 Ga0207684_10051638 3300025910 Bacteria 3489
261 Ga0207684_10053845 3300025910 Bacteria 3414
262 Ga0207684_11066377 3300025910 Bacteria 674
263 Ga0207654_10052803 3300025911 Bacteria 2344
264 Ga0207707_10427185 3300025912 Bacteria 1135
265 Ga0207695_10278460 3300025913 Bacteria 1567
266 Ga0207671_10153014 3300025914 Bacteria 1783
267 Ga0207693_10009156 3300025915 Bacteria 8083
268 Ga0207693_10017411 3300025915 Bacteria 5733
269 Ga0207693_10020333 3300025915 Bacteria 5281
270 Ga0207693_10057579 3300025915 Bacteria 3046
271 Ga0207693_10058585 3300025915 Bacteria 3017
272 Ga0207693_10173378 3300025915 Bacteria 1698
273 Ga0207693_10201153 3300025915 Bacteria 1567
274 Ga0207693_10320794 3300025915 Bacteria 1213
275 Ga0207693_10397116 3300025915 Bacteria 1078
276 Ga0207663_10026354 3300025916 Bacteria 3373
277 Ga0207663_10034770 3300025916 Bacteria 3017
278 Ga0207663_10066797 3300025916 Bacteria 2303
279 Ga0207663_10104929 3300025916 Bacteria 1906
280 Ga0207663_10232130 3300025916 Bacteria 1349
281 Ga0207663_10358784 3300025916 Bacteria 1105
282 Ga0207660_10111488 3300025917 Bacteria 2059
283 Ga0207662_10022378 3300025918 Bacteria 3624
284 Ga0207657_10006630 3300025919 Bacteria 11983
285 Ga0207649_10294701 3300025920 Bacteria 1184
286 Ga0207649_10526681 3300025920 Bacteria 902
287 Ga0207652_10045079 3300025921 Bacteria 3759
288 Ga0207652_10199759 3300025921 Bacteria 1799
289 Ga0207646_10003893 3300025922 Bacteria 16567
290 Ga0207646_10049592 3300025922 Bacteria 3759
291 Ga0207646_10070637 3300025922 Bacteria 3118
292 Ga0207646_10159093 3300025922 Bacteria 2038
293 Ga0207646_10509490 3300025922 Bacteria 1084
294 Ga0207659_10106127 3300025926 Bacteria 2126
295 Ga0207687_10214137 3300025927 Bacteria 1513
296 Ga0207700_10003743 3300025928 Bacteria 8880
297 Ga0207700_10017050 3300025928 Bacteria 4840
298 Ga0207700_10020297 3300025928 Bacteria 4509
299 Ga0207700_10035633 3300025928 Bacteria 3586
300 Ga0207700_10091899 3300025928 Bacteria 2398
301 Ga0207700_10402203 3300025928 Bacteria 1200
302 Ga0207700_10437208 3300025928 Bacteria 1151
303 Ga0207700_10547245 3300025928 Bacteria 1027
304 Ga0207700_10610206 3300025928 Bacteria 971
305 Ga0207700_10648005 3300025928 Bacteria 942
306 Ga0207700_11154036 3300025928 Bacteria 692
307 Ga0207664_10001454 3300025929 Bacteria 15550
308 Ga0207664_10008935 3300025929 Bacteria 7017
309 Ga0207664_10010443 3300025929 Bacteria 6557
310 Ga0207664_10020033 3300025929 Bacteria 4951
311 Ga0207664_10024883 3300025929 Bacteria 4502
312 Ga0207664_10029411 3300025929 Bacteria 4184
313 Ga0207664_10063837 3300025929 Bacteria 2944
314 Ga0207664_10087096 3300025929 Bacteria 2552
315 Ga0207664_10107699 3300025929 Bacteria 2312
316 Ga0207664_10127474 3300025929 Bacteria 2138
317 Ga0207664_10128468 3300025929 Bacteria 2130
318 Ga0207664_10187106 3300025929 Bacteria 1781
319 Ga0207664_10193335 3300025929 Bacteria 1752
320 Ga0207664_10266704 3300025929 Bacteria 1499
321 Ga0207664_10338458 3300025929 Bacteria 1330
322 Ga0207664_10685791 3300025929 Bacteria 921
323 Ga0207664_10689917 3300025929 Bacteria 918
324 Ga0207644_10363379 3300025931 Bacteria 1178
325 Ga0207644_10826802 3300025931 Bacteria 775
326 Ga0207690_10073008 3300025932 Bacteria 2371
327 Ga0207706_10082353 3300025933 Bacteria 2828
328 Ga0207709_10296870 3300025935 Bacteria 1200
329 Ga0207704_10235782 3300025938 Bacteria 1364
330 Ga0207665_10016654 3300025939 Bacteria 4828
331 Ga0207665_10018169 3300025939 Bacteria 4621
332 Ga0207665_10023453 3300025939 Bacteria 4066
333 Ga0207665_10034441 3300025939 Bacteria 3359
334 Ga0207665_10035970 3300025939 Bacteria 3290
335 Ga0207665_10077981 3300025939 Bacteria 2275
336 Ga0207665_10154828 3300025939 Bacteria 1644
337 Ga0207691_10099233 3300025940 Bacteria 2600
338 Ga0207711_10069983 3300025941 Bacteria 3042
339 Ga0207711_10127261 3300025941 Bacteria 2280
340 Ga0207661_10355329 3300025944 Bacteria 1323
341 Ga0207661_10741186 3300025944 Bacteria 904
342 Ga0207679_10142124 3300025945 Bacteria 1941
343 Ga0207651_10091917 3300025960 Bacteria 2224
344 Ga0207712_10809793 3300025961 Bacteria 824
345 Ga0207712_10978549 3300025961 Bacteria 750
346 Ga0207640_10014870 3300025981 Bacteria 4490
347 Ga0207677_10448404 3300026023 Bacteria 1105
348 Ga0207639_10152675 3300026041 Bacteria 1936
349 Ga0207678_10025231 3300026067 Bacteria 5188
350 Ga0207708_10122687 3300026075 Bacteria 2025
351 Ga0207702_10031853 3300026078 Bacteria 4397
352 Ga0207702_10035699 3300026078 Bacteria 4156
353 Ga0207702_10288381 3300026078 Bacteria 1554
354 Ga0207702_10418018 3300026078 Bacteria 1296
355 Ga0207702_10569597 3300026078 Bacteria 1109
356 Ga0207702_11037777 3300026078 Bacteria 813
357 Ga0207641_10071925 3300026088 Bacteria 2977
358 Ga0207648_10118491 3300026089 Bacteria 2327
359 Ga0207676_10152726 3300026095 Bacteria 1991
360 Ga0207676_10324529 3300026095 Bacteria 1414
361 Ga0207676_10618572 3300026095 Bacteria 1042
362 Ga0207674_10015027 3300026116 Bacteria 8527
363 Ga0207675_100713717 3300026118 Bacteria 1012
364 Ga0207683_10141737 3300026121 Bacteria 2166
365 Ga0207698_10625168 3300026142 Bacteria 1064
366 Ga0268266_10145267 3300028379 Bacteria 2132
367 Ga0268266_10242126 3300028379 Bacteria 1665
368 Ga0268266_10473472 3300028379 Bacteria 1193
369 Ga0268265_10285094 3300028380 Bacteria 1480
370 Ga0268264_10224715 3300028381 Bacteria 1730
371 Ga0268264_10274635 3300028381 Bacteria 1576
372 Ga0265337_1000014 3300028556 Bacteria 81870
373 Ga0265326_10000631 3300028558 Bacteria 13166
374 Ga0265319_1007325 3300028563 Bacteria 4974
375 Ga0265334_10001701 3300028573 Bacteria 10510
376 Ga0265318_10001324 3300028577 Bacteria 14831
377 Ga0265323_10001386 3300028653 Bacteria 11988
378 Ga0265322_10046930 3300028654 Bacteria 1228
379 Ga0265336_10001146 3300028666 Bacteria 12687
380 Ga0265336_10005343 3300028666 Bacteria 4749
381 Ga0265338_10000577 3300028800 Bacteria 64591
382 Ga0265338_10000785 3300028800 Bacteria 53719
383 Ga0265338_10422915 3300028800 Bacteria 947
384 Ga0265332_10001642 3300031238 Bacteria 12213
385 Ga0265325_10034251 3300031241 Bacteria 2703
386 Ga0265340_10000640 3300031247 Bacteria 19622
387 Ga0265339_10006174 3300031249 Bacteria 7894
388 Ga0265316_10008119 3300031344 Bacteria 9779
389 Ga0307408_100499700 3300031548 Bacteria 1064
390 Ga0265313_10012855 3300031595 Bacteria 5079
391 Ga0265314_10028515 3300031711 Bacteria 4161
392 Ga0265342_10002040 3300031712 Bacteria 17947
393 Ga0307405_10499589 3300031731 Bacteria 975
394 Ga0307416_100362911 3300032002 Bacteria 1471
395 Ga0307416_100621785 3300032002 Bacteria 1162
396 Ga0307415_101270076 3300032126 Bacteria 696
397 Ga0373930_0126237 3300034816 Bacteria 627
398 Ga0373959_0027959 3300034820 Bacteria 1124
399 Ga0373959_0137193 3300034820 Bacteria 610
400 Ga0373926_0002908 3300035083 Bacteria 5494
401 Ga0373926_0008765 3300035083 Bacteria 3367
402 Ga0373926_0255371 3300035083 Bacteria 680
403 Ga0373934_0000054 3300035086 Bacteria 38975
404 Ga0373934_0010113 3300035086 Bacteria 3542
405 Ga0373934_0012523 3300035086 Bacteria 3201
406 Ga0373934_0014314 3300035086 Bacteria 3006
407 Ga0373934_0023831 3300035086 Bacteria 2366
408 Ga0373944_0000487 3300035089 Bacteria 9214
409 Ga0373944_0006476 3300035089 Bacteria 3110
410 Ga0373944_0163722 3300035089 Bacteria 790
411 Ga0373949_0015385 3300035090 Bacteria 1709
412 Ga0373952_0074784 3300035092 Bacteria 854
413 Ga0373923_0001497 3300035111 Bacteria 6724
414 Ga0373923_0005890 3300035111 Bacteria 4189
415 Ga0373923_0011836 3300035111 Bacteria 3211
416 Ga0373936_0003881 3300035113 Bacteria 5634
417 Ga0373936_0006867 3300035113 Bacteria 4283
418 Ga0373936_0085333 3300035113 Bacteria 1318
419 Ga0373941_0238179 3300035115 Bacteria 706
420 Ga0373945_0000672 3300035116 Bacteria 9897
421 Ga0373945_0105882 3300035116 Bacteria 1105
422 Ga0373953_0015410 3300035117 Bacteria 2770
423 Ga0373953_0022888 3300035117 Bacteria 2362
424 Ga0373953_0026177 3300035117 Bacteria 2233
425 Ga0373953_0125573 3300035117 Bacteria 1092
426 Ga0373954_0033816 3300035118 Bacteria 2365
427 Ga0373954_0087165 3300035118 Bacteria 1496
428 Ga0373956_0000348 3300035119 Bacteria 18711
429 Ga0373956_0005044 3300035119 Bacteria 5290
430 Ga0373956_0048329 3300035119 Bacteria 1905
431 Ga0373956_0056906 3300035119 Bacteria 1766
432 Ga0373956_0133923 3300035119 Bacteria 1161
433 Ga0373957_0000329 3300035120 Bacteria 11934
434 Ga0373957_0003152 3300035120 Bacteria 4824
435 Ga0373957_0040109 3300035120 Bacteria 1759
436 Ga0373957_0041086 3300035120 Bacteria 1741
437 Ga0373957_0052760 3300035120 Bacteria 1558
438 Ga0373957_0338459 3300035120 Bacteria 641
439 Ga0373943_0013028 3300035170 Bacteria 3751
440 Ga0373943_0160559 3300035170 Bacteria 1223
441 Ga0373943_0254336 3300035170 Bacteria 987
442 Ga0373943_0361343 3300035170 Bacteria 833
443 Ga0373946_0000361 3300035171 Bacteria 14688
444 Ga0373946_0001103 3300035171 Bacteria 9322
445 Ga0373946_0168086 3300035171 Bacteria 1033
446 Ga0373946_0277544 3300035171 Bacteria 823
447 Ga0373955_0000009 3300035172 Bacteria 81129
448 Ga0373955_0020641 3300035172 Bacteria 3315
449 Ga0373955_0041029 3300035172 Bacteria 2478
450 Ga0373955_0044907 3300035172 Bacteria 2382
451 Ga0373955_0061283 3300035172 Bacteria 2077
452 Ga0373955_0712958 3300035172 Bacteria 616
453 Ga0373924_0000534 3300035410 Bacteria 11700
454 Ga0373924_0002485 3300035410 Bacteria 6193
455 Ga0373924_0015496 3300035410 Bacteria 2900
456 Ga0373924_0029218 3300035410 Bacteria 2202
457 Ga0373924_0042367 3300035410 Bacteria 1867
458 Ga0373924_0154176 3300035410 Bacteria 1006
459 Ga0373935_0001028 3300035692 Bacteria 15181
460 Ga0373935_0011605 3300035692 Bacteria 5290
461 Ga0373935_0316936 3300035692 Bacteria 1105
462 Ga0373935_0352212 3300035692 Bacteria 1050
463 Ga0373935_0466632 3300035692 Bacteria 913
464 Ga0373935_0608448 3300035692 Bacteria 799
465 Ga0373927_0002131 3300035695 Bacteria 14572
466 Ga0373927_0066743 3300035695 Bacteria 2327
467 Ga0373927_0270092 3300035695 Bacteria 1118
468 Ga0373927_0330416 3300035695 Bacteria 1004
469 Ga0373927_0527419 3300035695 Bacteria 780
470 Ga0373933_0000006 3300035724 Bacteria 125141
471 Ga0373933_0008866 3300035724 Bacteria 5483
472 Ga0373933_0061159 3300035724 Bacteria 2272
473 Ga0373933_0063434 3300035724 Bacteria 2233
474 Ga0373933_0087049 3300035724 Bacteria 1923
475 Ga0373933_0595024 3300035724 Bacteria 726
476 Ga0373947_0004988 3300035725 Bacteria 7769
477 Ga0373947_0009493 3300035725 Bacteria 5586
478 Ga0373947_0015119 3300035725 Bacteria 4430
479 Ga0373947_0035144 3300035725 Bacteria 2966
480 Ga0373947_0097316 3300035725 Bacteria 1844
481 Ga0373937_0000137 3300036401 Bacteria 70670
482 Ga0373937_0071260 3300036401 Bacteria 3205
483 Ga0373937_0193725 3300036401 Bacteria 1910
484 Ga0373937_0269592 3300036401 Bacteria 1606
485 Ga0373937_0316421 3300036401 Bacteria 1476
486 Ga0373937_0615719 3300036401 Bacteria 1030
487 Ga0373937_0643766 3300036401 Bacteria 1005
488 Ga0373925_0009693 3300037068 Bacteria 7007
489 Ga0373925_0075241 3300037068 Bacteria 2558
490 Ga0373925_0277113 3300037068 Bacteria 1350
491 Ga0373925_0499808 3300037068 Bacteria 998
492 Ga0436364_0115578 3300037853 Bacteria 5083
493 Ga0436364_0481785 3300037853 Bacteria 1011
494 Ga0436364_0656945 3300037853 Bacteria 2182
495 Ga0436364_0683808 3300037853 Bacteria 828
496 Ga0436364_0859559 3300037853 Bacteria 3024
497 Ga0436364_1101958 3300037853 Bacteria 22922
498 Ga0436364_1408240 3300037853 Bacteria 1081
499 Ga0436364_1456399 3300037853 Bacteria 627
500 Ga0436360_0594066 3300039438 Bacteria 807
501 Ga0436363_1229149 3300039450 Bacteria 924
502 Ga0436362_0449328 3300039453 Bacteria 580
503 Ga0436362_1072729 3300039453 Bacteria 958
504 Ga0439463_005007 3300042016 Bacteria 3303
505 Ga0450914_054080 3300042118 Bacteria 534
506 Ga0450890_028549 3300042127 Bacteria 785
507 Ga0439459_0012169 3300042438 Bacteria 1528
508 Ga0439464_0131536 3300042439 Bacteria 775
509 Ga0439440_0070240 3300042993 Bacteria 910
510 Ga0439440_0117277 3300042993 Bacteria 738
511 Ga0466963_0029505 3300044694 Bacteria 3532
512 Ga0466963_0067066 3300044694 Bacteria 2408
513 Ga0466963_0198034 3300044694 Bacteria 1405
514 Ga0466968_0407066 3300044735 Bacteria 668
515 Ga0466967_0128447 3300045976 Bacteria 2350
516 Ga0466967_0234676 3300045976 Bacteria 1747
517 Ga0495592_0000189 3300046454 Bacteria 54324
518 Ga0495592_0012943 3300046454 Bacteria 6342
519 Ga0495592_0017133 3300046454 Bacteria 5501
520 Ga0495592_0044544 3300046454 Bacteria 3314
521 Ga0495592_0055380 3300046454 Bacteria 2934
522 Ga0495592_0228355 3300046454 Bacteria 1241
523 Ga0495603_0066453 3300046455 Bacteria 2123
524 Ga0495603_0238171 3300046455 Bacteria 1048
525 Ga0495629_0007556 3300046459 Bacteria 8010
526 Ga0495629_0199074 3300046459 Bacteria 1385
527 Ga0495629_0242924 3300046459 Bacteria 1239
528 Ga0495641_0008878 3300046461 Bacteria 6054
529 Ga0495641_0018883 3300046461 Bacteria 3544
530 Ga0495641_0036550 3300046461 Bacteria 2307
531 Ga0495641_0073557 3300046461 Bacteria 1533
532 Ga0495641_0183996 3300046461 Bacteria 935
533 Ga0495651_0000071 3300046462 Bacteria 73914
534 Ga0495651_0008956 3300046462 Bacteria 7683
535 Ga0495651_0015837 3300046462 Bacteria 5836
536 Ga0495651_0037625 3300046462 Bacteria 3767
537 Ga0495651_0057616 3300046462 Bacteria 2982
538 Ga0495651_0058914 3300046462 Bacteria 2946
539 Ga0495651_0064315 3300046462 Bacteria 2803
540 Ga0495651_0064573 3300046462 Bacteria 2797
541 Ga0495651_0103327 3300046462 Bacteria 2117
542 Ga0495653_0000440 3300046463 Bacteria 32649
543 Ga0495653_0001696 3300046463 Bacteria 17322
544 Ga0495653_0010123 3300046463 Bacteria 7715
545 Ga0495653_0014979 3300046463 Bacteria 6324
546 Ga0495653_0025484 3300046463 Bacteria 4752
547 Ga0495653_0039666 3300046463 Bacteria 3687
548 Ga0495653_0102228 3300046463 Bacteria 2074
549 Ga0495653_0114652 3300046463 Bacteria 1930
550 Ga0495653_0138791 3300046463 Bacteria 1712
551 Ga0495653_0158087 3300046463 Bacteria 1576
552 Ga0495580_0037200 3300046472 Bacteria 3494
553 Ga0495582_0020982 3300046473 Bacteria 3577
554 Ga0495582_0041032 3300046473 Bacteria 2549
555 Ga0495582_0244030 3300046473 Bacteria 1029
556 Ga0495639_0111802 3300046475 Bacteria 1297
557 Ga0495639_0309062 3300046475 Bacteria 789
558 Ga0495662_0027711 3300046476 Bacteria 2736
559 Ga0495662_0047807 3300046476 Bacteria 2065
560 Ga0495662_0054185 3300046476 Bacteria 1937
561 Ga0495664_0015522 3300046477 Bacteria 4330
562 Ga0495664_0016996 3300046477 Bacteria 4154
563 Ga0495664_0062881 3300046477 Bacteria 2211
564 Ga0495664_0207885 3300046477 Bacteria 1185
565 Ga0495664_0230720 3300046477 Bacteria 1120
566 Ga0495664_0232485 3300046477 Bacteria 1115
567 Ga0495664_0237910 3300046477 Bacteria 1101
568 Ga0495664_0264077 3300046477 Bacteria 1040
569 Ga0495594_0037729 3300046499 Bacteria 2637
570 Ga0495608_0000107 3300046511 Bacteria 59326
571 Ga0495608_0002066 3300046511 Bacteria 14449
572 Ga0495608_0003637 3300046511 Bacteria 11070
573 Ga0495608_0021626 3300046511 Bacteria 4414
574 Ga0495608_0043776 3300046511 Bacteria 2990
575 Ga0495608_0066507 3300046511 Bacteria 2359
576 Ga0495618_0016510 3300046514 Bacteria 4518
577 Ga0495618_0016870 3300046514 Bacteria 4473
578 Ga0495618_0036120 3300046514 Bacteria 3100
579 Ga0495618_0041529 3300046514 Bacteria 2897
580 Ga0495618_0057611 3300046514 Bacteria 2460
581 Ga0495618_0090809 3300046514 Bacteria 1952
582 Ga0495628_0000136 3300046516 Bacteria 62431
583 Ga0495628_0034116 3300046516 Bacteria 4096
584 Ga0495628_0036466 3300046516 Bacteria 3945
585 Ga0495628_0183741 3300046516 Bacteria 1580
586 Ga0495628_0211363 3300046516 Bacteria 1459
587 Ga0495628_0293126 3300046516 Bacteria 1205
588 Ga0495630_0013910 3300046517 Bacteria 5853
589 Ga0495630_0092218 3300046517 Bacteria 2289
590 Ga0495630_0092443 3300046517 Bacteria 2287
591 Ga0495630_0117715 3300046517 Bacteria 2014
592 Ga0495630_0280634 3300046517 Bacteria 1272
593 Ga0495630_0428317 3300046517 Bacteria 1014
594 Ga0495666_0010981 3300046526 Bacteria 4517
595 Ga0495666_0017237 3300046526 Bacteria 3597
596 Ga0495652_0000273 3300046529 Bacteria 61215
597 Ga0495652_0009562 3300046529 Bacteria 8802
598 Ga0495652_0019154 3300046529 Bacteria 6097
599 Ga0495652_0031702 3300046529 Bacteria 4626
600 Ga0495652_0049231 3300046529 Bacteria 3608
601 Ga0495652_0090035 3300046529 Bacteria 2511
602 Ga0495652_0178780 3300046529 Bacteria 1630
603 Ga0495652_0266431 3300046529 Bacteria 1261
604 Ga0495652_0792161 3300046529 Bacteria 631
605 Ga0495665_0001336 3300046531 Bacteria 13167
606 Ga0495665_0019416 3300046531 Bacteria 3655
607 Ga0495665_0038008 3300046531 Bacteria 2567
608 Ga0495665_0322783 3300046531 Bacteria 788
609 Ga0495665_0512905 3300046531 Bacteria 603
610 Ga0495640_0059935 3300046533 Bacteria 2590
611 Ga0495640_0074714 3300046533 Bacteria 2265
612 Ga0495640_0148678 3300046533 Bacteria 1506
613 Ga0495640_0308251 3300046533 Bacteria 982
614 Ga0495586_0025432 3300046535 Bacteria 3168
615 Ga0495586_0025530 3300046535 Bacteria 3162
616 Ga0495586_0030782 3300046535 Bacteria 2872
617 Ga0495586_0079771 3300046535 Bacteria 1797
618 Ga0495586_0220821 3300046535 Bacteria 1077
619 Ga0495587_0000070 3300046536 Bacteria 85402
620 Ga0495587_0001614 3300046536 Bacteria 15003
621 Ga0495587_0021510 3300046536 Bacteria 3977
622 Ga0495587_0046214 3300046536 Bacteria 2585
623 Ga0495587_0057369 3300046536 Bacteria 2289
624 Ga0495587_0097819 3300046536 Bacteria 1692
625 Ga0495645_0023119 3300046543 Bacteria 4500
626 Ga0495645_0027710 3300046543 Bacteria 4115
627 Ga0495645_0060242 3300046543 Bacteria 2751
628 Ga0495645_0183190 3300046543 Bacteria 1433
629 Ga0495645_0208376 3300046543 Bacteria 1321
630 Ga0495645_0886278 3300046543 Bacteria 530
631 Ga0495667_0000048 3300046559 Bacteria 117509
632 Ga0495667_0000183 3300046559 Bacteria 42442
633 Ga0495667_0005886 3300046559 Bacteria 8303
634 Ga0495667_0023204 3300046559 Bacteria 4180
635 Ga0495667_0028695 3300046559 Bacteria 3747
636 Ga0495667_0044109 3300046559 Bacteria 2953
637 Ga0495667_0049352 3300046559 Bacteria 2778
638 Ga0495667_0052864 3300046559 Bacteria 2675
639 Ga0495667_0104600 3300046559 Bacteria 1830
640 Ga0495667_0141945 3300046559 Bacteria 1547
641 Ga0495667_0455517 3300046559 Bacteria 803
642 Ga0495656_0286980 3300046615 Unclassified 840
643 Ga0495634_0005086 3300046642 Bacteria 10154
644 Ga0495634_0053735 3300046642 Bacteria 2697
645 Ga0495634_0073569 3300046642 Bacteria 2247
646 Ga0495634_0084406 3300046642 Bacteria 2071
647 Ga0495634_0087862 3300046642 Bacteria 2022
648 Ga0495634_0148706 3300046642 Bacteria 1482
649 Ga0495635_0009154 3300046663 Bacteria 6911
650 Ga0495635_0018487 3300046663 Bacteria 4862
651 Ga0495635_0021653 3300046663 Bacteria 4481
652 Ga0495635_0041203 3300046663 Bacteria 3190
653 Ga0495635_0114747 3300046663 Bacteria 1839
654 Ga0495635_0246269 3300046663 Bacteria 1205
655 Ga0495635_0246871 3300046663 Bacteria 1204
656 Ga0495635_0297620 3300046663 Bacteria 1082
657 Ga0495588_0039429 3300046674 Bacteria 2406
658 Ga0495588_0208879 3300046674 Bacteria 1031
659 Ga0495657_0000046 3300046675 Bacteria 106064
660 Ga0495657_0015776 3300046675 Bacteria 5519
661 Ga0495657_0017777 3300046675 Bacteria 5157
662 Ga0495657_0022180 3300046675 Bacteria 4552
663 Ga0495657_0092487 3300046675 Bacteria 1937
664 Ga0495657_0264920 3300046675 Bacteria 1031
665 Ga0495657_0299554 3300046675 Bacteria 959
666 Ga0495657_0326491 3300046675 Bacteria 911
667 Ga0495657_0468318 3300046675 Bacteria 737
668 Ga0495599_0000023 3300046678 Bacteria 125139
669 Ga0495599_0001737 3300046678 Bacteria 12601
670 Ga0495599_0008495 3300046678 Bacteria 6245
671 Ga0495599_0016522 3300046678 Bacteria 4583
672 Ga0495599_0017052 3300046678 Bacteria 4513
673 Ga0495599_0026084 3300046678 Bacteria 3661
674 Ga0495599_0082477 3300046678 Bacteria 2008
675 Ga0495599_0083357 3300046678 Bacteria 1997
676 Ga0495623_0000157 3300046679 Bacteria 42271
677 Ga0495623_0013680 3300046679 Bacteria 5260
678 Ga0495623_0035232 3300046679 Bacteria 3208
679 Ga0495646_0000304 3300046680 Bacteria 25237
680 Ga0495646_0018360 3300046680 Bacteria 4430
681 Ga0495646_0019197 3300046680 Bacteria 4329
682 Ga0495646_0173103 3300046680 Bacteria 1188
683 Ga0495646_0495856 3300046680 Bacteria 627
684 Ga0495647_0039238 3300046681 Bacteria 1794
685 Ga0495613_0064728 3300046689 Bacteria 2673
686 Ga0495613_0096210 3300046689 Bacteria 2141
687 Ga0495613_0288918 3300046689 Bacteria 1137
688 Ga0495624_0011807 3300046690 Bacteria 5993
689 Ga0495624_0015893 3300046690 Bacteria 5069
690 Ga0495624_0483078 3300046690 Bacteria 741
691 Ga0495624_0860394 3300046690 Bacteria 534
692 Ga0495600_0011538 3300046809 Bacteria 5509
693 Ga0495600_0013146 3300046809 Bacteria 5192
694 Ga0495600_0124236 3300046809 Bacteria 1678
695 Ga0495600_0169535 3300046809 Bacteria 1409
696 Ga0495600_0202716 3300046809 Bacteria 1273
697 Ga0495581_0003943 3300047315 Bacteria 8545
698 Ga0495581_0011146 3300047315 Bacteria 5194
699 Ga0495581_0041040 3300047315 Bacteria 2677
700 Ga0495581_0060369 3300047315 Bacteria 2191
701 Ga0495604_0000037 3300047317 Bacteria 125140
702 Ga0495604_0000831 3300047317 Bacteria 25774
703 Ga0495604_0017074 3300047317 Bacteria 5806
704 Ga0495604_0018550 3300047317 Bacteria 5574
705 Ga0495604_0032937 3300047317 Bacteria 4104
706 Ga0495604_0035364 3300047317 Bacteria 3945
707 Ga0495604_0037551 3300047317 Bacteria 3813
708 Ga0495604_0098632 3300047317 Bacteria 2152
709 Ga0495604_0261910 3300047317 Bacteria 1175
710 Ga0495674_0002352 3300047319 Bacteria 18545
711 Ga0495674_0009843 3300047319 Bacteria 9073
712 Ga0495674_0012129 3300047319 Bacteria 8123
713 Ga0495674_0041784 3300047319 Bacteria 4093
714 Ga0495674_0054130 3300047319 Bacteria 3525
715 Ga0495674_0080967 3300047319 Bacteria 2786
716 Ga0495674_0393565 3300047319 Bacteria 1119
717 Ga0495674_0419358 3300047319 Bacteria 1078
718 Ga0495674_0824739 3300047319 Bacteria 720
719 Ga0495676_0039938 3300047321 Bacteria 3879
720 Ga0495676_0092300 3300047321 Bacteria 2260
721 Ga0495676_0110564 3300047321 Bacteria 2017
722 Ga0495676_0118503 3300047321 Bacteria 1930
723 Ga0495676_0185373 3300047321 Bacteria 1455
724 Ga0495680_0000260 3300047322 Bacteria 58455
725 Ga0495680_0006883 3300047322 Bacteria 10495
726 Ga0495680_0008303 3300047322 Bacteria 9454
727 Ga0495680_0014059 3300047322 Bacteria 6953
728 Ga0495680_0031036 3300047322 Bacteria 4353
729 Ga0495680_0035625 3300047322 Bacteria 4006
730 Ga0495680_0065532 3300047322 Bacteria 2781
731 Ga0495680_0402548 3300047322 Bacteria 945
732 Ga0495675_0000359 3300047444 Bacteria 31787
733 Ga0495675_0013383 3300047444 Bacteria 5178
734 Ga0495675_0020902 3300047444 Bacteria 4166
735 Ga0495675_0071856 3300047444 Bacteria 2183
736 Ga0495675_0294839 3300047444 Bacteria 964
737 Ga0495684_0005428 3300047471 Bacteria 9919
738 Ga0495684_0013919 3300047471 Bacteria 6188
739 Ga0495684_0025499 3300047471 Bacteria 4544
740 Ga0495684_0029362 3300047471 Bacteria 4220
741 Ga0495684_0051796 3300047471 Bacteria 3132
742 Ga0495684_0059458 3300047471 Bacteria 2910
743 Ga0495593_0007056 3300047673 Bacteria 6589
744 Ga0495593_0028366 3300047673 Bacteria 3074
745 Ga0495593_0065071 3300047673 Bacteria 1902
746 Ga0495593_0080065 3300047673 Bacteria 1690
747 Ga0495602_0000118 3300048088 Bacteria 74925
748 Ga0495602_0015865 3300048088 Bacteria 7588
749 Ga0495602_0045394 3300048088 Bacteria 3976
750 Ga0495602_0062668 3300048088 Bacteria 3225
751 Ga0495602_0066761 3300048088 Bacteria 3098
752 Ga0495602_0069028 3300048088 Bacteria 3032
753 Ga0495602_0099042 3300048088 Bacteria 2397
754 Ga0495602_0103296 3300048088 Bacteria 2333
755 Ga0495602_0116430 3300048088 Bacteria 2159
756 Ga0495602_0383385 3300048088 Bacteria 1006
757 Ga0495614_0156041 3300048089 Bacteria 1020
758 Ga0496100_0498829 3300048903 Bacteria 938
759 Ga0496100_0578620 3300048903 Bacteria 870
760 Ga0496100_0842321 3300048903 Bacteria 719
761 Ga0496101_0056885 3300048904 Bacteria 2827
762 Ga0496101_0155317 3300048904 Bacteria 1752
763 Ga0496102_0025053 3300048905 Bacteria 5307
764 Ga0496103_0044328 3300048906 Bacteria 2740
765 Ga0496103_0547784 3300048906 Bacteria 739
766 Ga0496104_0000760 3300048907 Bacteria 27616
767 Ga0496104_0003780 3300048907 Bacteria 13096
768 Ga0496104_0275459 3300048907 Bacteria 1595
769 Ga0496105_0024389 3300048908 Bacteria 4913
770 Ga0496105_0032602 3300048908 Bacteria 4277
771 Ga0496105_0036121 3300048908 Bacteria 4069
772 Ga0496105_0272426 3300048908 Bacteria 1367
773 Ga0496106_0112262 3300048909 Bacteria 2123
774 Ga0496106_0385382 3300048909 Bacteria 1126
775 Ga0496107_0149964 3300048910 Bacteria 1724
776 Ga0496107_0360127 3300048910 Bacteria 1082
777 Ga0496108_0085567 3300048911 Bacteria 2676
778 Ga0496108_0733344 3300048911 Bacteria 855
779 Ga0496109_0053625 3300048912 Bacteria 3678
780 Ga0496109_0129918 3300048912 Bacteria 2350
781 Ga0496109_0215597 3300048912 Bacteria 1805
782 Ga0496110_0015154 3300048913 Bacteria 6410
783 Ga0496110_0058547 3300048913 Bacteria 3393
784 Ga0496111_0139778 3300048914 Bacteria 1794
785 Ga0496112_0000984 3300048915 Bacteria 20802
786 Ga0496112_0274813 3300048915 Bacteria 1632
787 Ga0496112_0426159 3300048915 Bacteria 1265
788 Ga0496112_0751277 3300048915 Bacteria 901
789 Ga0496113_0751646 3300048916 Bacteria 776
790 Ga0496114_0120894 3300048917 Bacteria 2252
791 Ga0496115_0043190 3300048918 Bacteria 3594
792 Ga0496115_0286506 3300048918 Bacteria 1352
793 Ga0496115_0843324 3300048918 Bacteria 710
794 Ga0501225_0310984 3300049705 Bacteria 536
795 nmdc:mga0n895_160943_c1 3300050512 Bacteria 2276
796 nmdc:mga0n895_2225_c1 3300050512 Bacteria 15000
797 nmdc:mga0n895_347986_c1 3300050512 Bacteria 1501
798 nmdc:mga0n895_730466_c1 3300050512 Bacteria 984
799 nmdc:mga0rr50_122743_c1 3300050513 Bacteria 2070
800 nmdc:mga0rr50_296316_c1 3300050513 Bacteria 1352
801 nmdc:mga0rr50_732986_c1 3300050513 Bacteria 843
802 nmdc:mga08x19_119545_c1 3300050514 Bacteria 1765
803 nmdc:mga08x19_291818_c1 3300050514 Bacteria 1131
804 nmdc:mga08x19_532654_c1 3300050514 Bacteria 830
805 nmdc:mga0a205_488752_c1 3300050515 Bacteria 1088
806 Ga0495601_0053967 3300053077 Bacteria 2541
807 Ga0495601_0080308 3300053077 Bacteria 2092
808 Ga0495601_0136261 3300053077 Bacteria 1600
809 Ga0495601_0201196 3300053077 Bacteria 1301
810 Ga0495601_0325203 3300053077 Bacteria 1001
811 Ga0495612_0004967 3300053078 Bacteria 5503
812 Ga0495612_0144591 3300053078 Bacteria 1033
813 Ga0495612_0181928 3300053078 Bacteria 923
814 Ga0495612_0361170 3300053078 Bacteria 656
815 Ga0495595_0002310 3300053084 Bacteria 7433
816 Ga0495595_0003631 3300053084 Bacteria 6132
817 Ga0495595_0023110 3300053084 Bacteria 2734
818 Ga0495595_0170061 3300053084 Bacteria 1078
819 Ga0495619_0085583 3300053085 Bacteria 2129
820 Ga0495619_0092705 3300053085 Bacteria 2046
821 Ga0495619_0110355 3300053085 Bacteria 1879
822 Ga0495619_0224412 3300053085 Bacteria 1301
823 Ga0495619_0304386 3300053085 Bacteria 1104
824 Ga0070707_100864637
825 JGI25407J50210_10013314
826 JGI25404J52841_10000310
827 Ga0070658_10102376
828 Ga0070683_100267951
829 Ga0070683_100546892
830 Ga0068869_100102426
831 Ga0070666_10047240
832 Ga0070680_100166929
833 Ga0068868_100048233
834 Ga0068868_100913577
835 Ga0070660_100256345
836 Ga0070689_100874902
837 Ga0070691_10186858
838 Ga0070675_100060805
839 Ga0070671_100919814
840 Ga0070673_100195179
841 Ga0070659_100045863
842 Ga0070667_100910092
843 Ga0070709_10039770
844 Ga0070709_10043542
845 Ga0070709_10129451
846 Ga0070709_10138419
847 Ga0070709_10158953
848 Ga0070709_10176687
849 Ga0070709_10324784
850 Ga0070709_10411571
851 Ga0070714_100024977
852 Ga0070714_100044665
853 Ga0070714_100057055
854 Ga0070714_100066933
855 Ga0070714_100173088
856 Ga0070714_100193703
857 Ga0070714_100212514
858 Ga0070714_100269245
859 Ga0070714_100329603
860 Ga0070714_100350549
861 Ga0070714_100555503
862 Ga0070714_100565660
863 Ga0070714_100640505
864 Ga0070714_100952389
865 Ga0070713_100012145
866 Ga0070713_100097618
867 Ga0070713_100097921
868 Ga0070713_100206595
869 Ga0070713_100431075
870 Ga0070713_100447657
871 Ga0070713_100783577
872 Ga0070713_100800574
873 Ga0070713_100830704
874 Ga0070710_10006448
875 Ga0070710_10010218
876 Ga0070710_10019136
877 Ga0070710_10049771
878 Ga0070710_10141176
879 Ga0070710_10153878
880 Ga0070710_10233393
881 Ga0070710_10425878
882 Ga0070710_10436166
883 Ga0070710_10458451
884 Ga0070711_100037014
885 Ga0070711_100164268
886 Ga0070711_100167965
887 Ga0070711_100273184
888 Ga0070711_100345855
889 Ga0070711_100577402
890 Ga0070705_100090754
891 Ga0070705_100094434
892 Ga0070705_100146870
893 Ga0070694_100601502
894 Ga0070708_100001881
895 Ga0070708_100024317
896 Ga0070708_100241243
897 Ga0070708_100316337
898 Ga0070708_100424157
899 Ga0070708_100652393
900 Ga0070708_101114582
901 Ga0070678_100044593
902 Ga0070662_100555028
903 Ga0070681_10081332
904 Ga0070681_10425969
905 Ga0070681_10809881
906 Ga0070685_10363324
907 Ga0070706_100007753
908 Ga0070706_100023920
909 Ga0070706_100037414
910 Ga0070706_100149267
911 Ga0070706_100155037
912 Ga0070706_100502524
913 Ga0070707_100084049
914 Ga0070707_100137185
915 Ga0070707_100210452
916 Ga0070707_100309098
917 Ga0070698_100000840
918 Ga0070698_100011091
919 Ga0070698_100040235
920 Ga0070698_100104505
921 Ga0070698_100126977
922 Ga0070698_100518082
923 Ga0070698_100550993
924 Ga0070698_100686576
925 Ga0070699_100000896
926 Ga0070699_100088126
927 Ga0070699_100285777
928 Ga0070699_100988678
929 Ga0070679_100050333
930 Ga0070679_101324828
931 Ga0070697_100001714
932 Ga0068853_100158691
933 Ga0070686_100313982
934 Ga0070695_100384027
935 Ga0070696_100019246
936 Ga0070696_100050512
937 Ga0070693_100163679
938 Ga0070665_100137708
939 Ga0070665_100299019
940 Ga0070665_101014733
941 Ga0070664_100102935
942 Ga0068854_100095502
943 Ga0068856_100026135
944 Ga0068856_100226287
945 Ga0068856_100306390
946 Ga0068856_100510166
947 Ga0068856_101103005
948 Ga0070702_100031508
949 Ga0068852_100249382
950 Ga0068852_100733023
951 Ga0068859_100333723
952 Ga0068859_101821673
953 Ga0068864_100220997
954 Ga0068864_100380179
955 Ga0068866_10184837
956 Ga0068861_100340880
957 Ga0068870_10191530
958 Ga0068863_100040082
959 Ga0068863_100283865
960 Ga0068863_100678809
961 Ga0068858_100145149
962 Ga0068858_100364829
963 Ga0068860_100673450
964 Ga0081455_10096210
965 Ga0081540_1000352
966 Ga0081540_1001842
967 Ga0070717_10002549
968 Ga0070717_10012325
969 Ga0070717_10019617
970 Ga0070717_10027320
971 Ga0070717_10213967
972 Ga0070717_10256788
973 Ga0070717_10320678
974 Ga0070717_10455395
975 Ga0070717_10553771
976 Ga0070717_11261817
977 Ga0070715_10002283
978 Ga0070715_10062450
979 Ga0070715_10138160
980 Ga0070716_100096503
981 Ga0070716_100123514
982 Ga0070716_100186605
983 Ga0070716_100448851
984 Ga0070712_100018294
985 Ga0070712_100032788
986 Ga0070712_100143593
987 Ga0070712_100161552
988 Ga0070712_100279419
989 Ga0070712_100393264
990 Ga0070712_100740756
991 Ga0070712_100751508
992 Ga0097621_100231564
993 Ga0097621_100340096
994 Ga0068871_100123246
995 Ga0068871_100150020
996 Ga0075433_10651067
997 Ga0075434_100027090
998 Ga0075434_100225849
999 Ga0075434_100660462
1000 Ga0068865_100493401
1001 Ga0075436_100149231
1002 Ga0097620_100333714
1003 Ga0097620_101822104
1004 Ga0075435_100117766
1005 Ga0075435_100240500
1006 Ga0075435_100367054
1007 Ga0105240_10214568
1008 Ga0105245_10124345
1009 Ga0105245_11134070
1010 Ga0105247_10022850
1011 Ga0105247_10146479
1012 Ga0114129_11254739
1013 Ga0105241_10067204
1014 Ga0105241_10069659
1015 Ga0105242_10050687
1016 Ga0105248_11866145
1017 Ga0105237_10192750
1018 Ga0105237_10720286
1019 Ga0105238_10234862
1020 Ga0105238_10900028
1021 Ga0105249_10421801
1022 Ga0105239_11487150
1023 Ga0105246_10123769
1024 Ga0105246_10761913
1025 Ga0157338_1001270
1026 Ga0157373_10054631
1027 Ga0157373_10389808
1028 Ga0157370_10126004
1029 Ga0157370_10344989
1030 Ga0157369_10055956
1031 Ga0157369_10652239
1032 Ga0157369_10693217
1033 Ga0157369_11114813
1034 Ga0157374_11440129
1035 Ga0157378_10476288
1036 Ga0163162_10078559
1037 Ga0157375_10193237
1038 Ga0157375_10200151
1039 Ga0163163_10064154
1040 Ga0163163_10109157
1041 Ga0163163_10448519
1042 Ga0163163_10733302
1043 Ga0163163_12047778
1044 Ga0157377_10033699
1045 Ga0157379_10008747
1046 Ga0157379_10809685
1047 Ga0157376_10715502
1048 Ga0157376_10794144
1049 Ga0163161_10139020
1050 Ga0197907_10862668
1051 Ga0206356_11478300
1052 Ga0213875_10001850
1053 Ga0213875_10037330
1054 Ga0213875_10285646
1055 Ga0224712_10018640
1056 Ga0224572_1003002
1057 Ga0207656_10181556
1058 Ga0207653_10007472
1059 Ga0207692_10011283
1060 Ga0207692_10017490
1061 Ga0207692_10020494
1062 Ga0207692_10021207
1063 Ga0207692_10055442
1064 Ga0207692_10084294
1065 Ga0207692_10188985
1066 Ga0207692_10357987
1067 Ga0207642_10062907
1068 Ga0207680_10877279
1069 Ga0207685_10013968
1070 Ga0207685_10020987
1071 Ga0207685_10034664
1072 Ga0207685_10080607
1073 Ga0207699_10005459
1074 Ga0207699_10006754
1075 Ga0207699_10030995
1076 Ga0207699_10031694
1077 Ga0207699_10055208
1078 Ga0207699_10100271
1079 Ga0207643_10093812
1080 Ga0207705_10033882
1081 Ga0207684_10001543
1082 Ga0207684_10051282
1083 Ga0207684_10051638
1084 Ga0207684_10053845
1085 Ga0207684_11066377
1086 Ga0207654_10052803
1087 Ga0207707_10427185
1088 Ga0207695_10278460
1089 Ga0207671_10153014
1090 Ga0207693_10009156
1091 Ga0207693_10017411
1092 Ga0207693_10020333
1093 Ga0207693_10057579
1094 Ga0207693_10058585
1095 Ga0207693_10173378
1096 Ga0207693_10201153
1097 Ga0207693_10320794
1098 Ga0207693_10397116
1099 Ga0207663_10026354
1100 Ga0207663_10034770
1101 Ga0207663_10066797
1102 Ga0207663_10104929
1103 Ga0207663_10232130
1104 Ga0207663_10358784
1105 Ga0207660_10111488
1106 Ga0207662_10022378
1107 Ga0207657_10006630
1108 Ga0207649_10294701
1109 Ga0207649_10526681
1110 Ga0207652_10045079
1111 Ga0207652_10199759
1112 Ga0207646_10003893
1113 Ga0207646_10049592
1114 Ga0207646_10070637
1115 Ga0207646_10159093
1116 Ga0207646_10509490
1117 Ga0207659_10106127
1118 Ga0207687_10214137
1119 Ga0207700_10003743
1120 Ga0207700_10017050
1121 Ga0207700_10020297
1122 Ga0207700_10035633
1123 Ga0207700_10091899
1124 Ga0207700_10402203
1125 Ga0207700_10437208
1126 Ga0207700_10547245
1127 Ga0207700_10610206
1128 Ga0207700_10648005
1129 Ga0207700_11154036
1130 Ga0207664_10001454
1131 Ga0207664_10008935
1132 Ga0207664_10010443
1133 Ga0207664_10020033
1134 Ga0207664_10024883
1135 Ga0207664_10029411
1136 Ga0207664_10063837
1137 Ga0207664_10087096
1138 Ga0207664_10107699
1139 Ga0207664_10127474
1140 Ga0207664_10128468
1141 Ga0207664_10187106
1142 Ga0207664_10193335
1143 Ga0207664_10266704
1144 Ga0207664_10338458
1145 Ga0207664_10685791
1146 Ga0207664_10689917
1147 Ga0207644_10363379
1148 Ga0207644_10826802
1149 Ga0207690_10073008
1150 Ga0207706_10082353
1151 Ga0207709_10296870
1152 Ga0207704_10235782
1153 Ga0207665_10016654
1154 Ga0207665_10018169
1155 Ga0207665_10023453
1156 Ga0207665_10034441
1157 Ga0207665_10035970
1158 Ga0207665_10077981
1159 Ga0207665_10154828
1160 Ga0207691_10099233
1161 Ga0207711_10069983
1162 Ga0207711_10127261
1163 Ga0207661_10355329
1164 Ga0207661_10741186
1165 Ga0207679_10142124
1166 Ga0207651_10091917
1167 Ga0207712_10809793
1168 Ga0207712_10978549
1169 Ga0207640_10014870
1170 Ga0207677_10448404
1171 Ga0207639_10152675
1172 Ga0207678_10025231
1173 Ga0207708_10122687
1174 Ga0207702_10031853
1175 Ga0207702_10035699
1176 Ga0207702_10288381
1177 Ga0207702_10418018
1178 Ga0207702_10569597
1179 Ga0207702_11037777
1180 Ga0207641_10071925
1181 Ga0207648_10118491
1182 Ga0207676_10152726
1183 Ga0207676_10324529
1184 Ga0207676_10618572
1185 Ga0207674_10015027
1186 Ga0207675_100713717
1187 Ga0207683_10141737
1188 Ga0207698_10625168
1189 Ga0268266_10145267
1190 Ga0268266_10242126
1191 Ga0268266_10473472
1192 Ga0268265_10285094
1193 Ga0268264_10224715
1194 Ga0268264_10274635
1195 Ga0265337_1000014
1196 Ga0265326_10000631
1197 Ga0265319_1007325
1198 Ga0265334_10001701
1199 Ga0265318_10001324
1200 Ga0265323_10001386
1201 Ga0265322_10046930
1202 Ga0265336_10001146
1203 Ga0265336_10005343
1204 Ga0265338_10000577
1205 Ga0265338_10000785
1206 Ga0265338_10422915
1207 Ga0265332_10001642
1208 Ga0265325_10034251
1209 Ga0265340_10000640
1210 Ga0265339_10006174
1211 Ga0265316_10008119
1212 Ga0307408_100499700
1213 Ga0265313_10012855
1214 Ga0265314_10028515
1215 Ga0265342_10002040
1216 Ga0307405_10499589
1217 Ga0307416_100362911
1218 Ga0307416_100621785
1219 Ga0307415_101270076
1220 Ga0373930_0126237
1221 Ga0373959_0027959
1222 Ga0373959_0137193
1223 Ga0373926_0002908
1224 Ga0373926_0008765
1225 Ga0373926_0255371
1226 Ga0373934_0000054
1227 Ga0373934_0010113
1228 Ga0373934_0012523
1229 Ga0373934_0014314
1230 Ga0373934_0023831
1231 Ga0373944_0000487
1232 Ga0373944_0006476
1233 Ga0373944_0163722
1234 Ga0373949_0015385
1235 Ga0373952_0074784
1236 Ga0373923_0001497
1237 Ga0373923_0005890
1238 Ga0373923_0011836
1239 Ga0373936_0003881
1240 Ga0373936_0006867
1241 Ga0373936_0085333
1242 Ga0373941_0238179
1243 Ga0373945_0000672
1244 Ga0373945_0105882
1245 Ga0373953_0015410
1246 Ga0373953_0022888
1247 Ga0373953_0026177
1248 Ga0373953_0125573
1249 Ga0373954_0033816
1250 Ga0373954_0087165
1251 Ga0373956_0000348
1252 Ga0373956_0005044
1253 Ga0373956_0048329
1254 Ga0373956_0056906
1255 Ga0373956_0133923
1256 Ga0373957_0000329
1257 Ga0373957_0003152
1258 Ga0373957_0040109
1259 Ga0373957_0041086
1260 Ga0373957_0052760
1261 Ga0373957_0338459
1262 Ga0373943_0013028
1263 Ga0373943_0160559
1264 Ga0373943_0254336
1265 Ga0373943_0361343
1266 Ga0373946_0000361
1267 Ga0373946_0001103
1268 Ga0373946_0168086
1269 Ga0373946_0277544
1270 Ga0373955_0000009
1271 Ga0373955_0020641
1272 Ga0373955_0041029
1273 Ga0373955_0044907
1274 Ga0373955_0061283
1275 Ga0373955_0712958
1276 Ga0373924_0000534
1277 Ga0373924_0002485
1278 Ga0373924_0015496
1279 Ga0373924_0029218
1280 Ga0373924_0042367
1281 Ga0373924_0154176
1282 Ga0373935_0001028
1283 Ga0373935_0011605
1284 Ga0373935_0316936
1285 Ga0373935_0352212
1286 Ga0373935_0466632
1287 Ga0373935_0608448
1288 Ga0373927_0002131
1289 Ga0373927_0066743
1290 Ga0373927_0270092
1291 Ga0373927_0330416
1292 Ga0373927_0527419
1293 Ga0373933_0000006
1294 Ga0373933_0008866
1295 Ga0373933_0061159
1296 Ga0373933_0063434
1297 Ga0373933_0087049
1298 Ga0373933_0595024
1299 Ga0373947_0004988
1300 Ga0373947_0009493
1301 Ga0373947_0015119
1302 Ga0373947_0035144
1303 Ga0373947_0097316
1304 Ga0373937_0000137
1305 Ga0373937_0071260
1306 Ga0373937_0193725
1307 Ga0373937_0269592
1308 Ga0373937_0316421
1309 Ga0373937_0615719
1310 Ga0373937_0643766
1311 Ga0373925_0009693
1312 Ga0373925_0075241
1313 Ga0373925_0277113
1314 Ga0373925_0499808
1315 Ga0436364_0115578
1316 Ga0436364_0481785
1317 Ga0436364_0656945
1318 Ga0436364_0683808
1319 Ga0436364_0859559
1320 Ga0436364_1101958
1321 Ga0436364_1408240
1322 Ga0436364_1456399
1323 Ga0436360_0594066
1324 Ga0436363_1229149
1325 Ga0436362_0449328
1326 Ga0436362_1072729
1327 Ga0439463_005007
1328 Ga0450914_054080
1329 Ga0450890_028549
1330 Ga0439459_0012169
1331 Ga0439464_0131536
1332 Ga0439440_0070240
1333 Ga0439440_0117277
1334 Ga0466963_0029505
1335 Ga0466963_0067066
1336 Ga0466963_0198034
1337 Ga0466968_0407066
1338 Ga0466967_0128447
1339 Ga0466967_0234676
1340 Ga0495592_0000189
1341 Ga0495592_0012943
1342 Ga0495592_0017133
1343 Ga0495592_0044544
1344 Ga0495592_0055380
1345 Ga0495592_0228355
1346 Ga0495603_0066453
1347 Ga0495603_0238171
1348 Ga0495629_0007556
1349 Ga0495629_0199074
1350 Ga0495629_0242924
1351 Ga0495641_0008878
1352 Ga0495641_0018883
1353 Ga0495641_0036550
1354 Ga0495641_0073557
1355 Ga0495641_0183996
1356 Ga0495651_0000071
1357 Ga0495651_0008956
1358 Ga0495651_0015837
1359 Ga0495651_0037625
1360 Ga0495651_0057616
1361 Ga0495651_0058914
1362 Ga0495651_0064315
1363 Ga0495651_0064573
1364 Ga0495651_0103327
1365 Ga0495653_0000440
1366 Ga0495653_0001696
1367 Ga0495653_0010123
1368 Ga0495653_0014979
1369 Ga0495653_0025484
1370 Ga0495653_0039666
1371 Ga0495653_0102228
1372 Ga0495653_0114652
1373 Ga0495653_0138791
1374 Ga0495653_0158087
1375 Ga0495580_0037200
1376 Ga0495582_0020982
1377 Ga0495582_0041032
1378 Ga0495582_0244030
1379 Ga0495639_0111802
1380 Ga0495639_0309062
1381 Ga0495662_0027711
1382 Ga0495662_0047807
1383 Ga0495662_0054185
1384 Ga0495664_0015522
1385 Ga0495664_0016996
1386 Ga0495664_0062881
1387 Ga0495664_0207885
1388 Ga0495664_0230720
1389 Ga0495664_0232485
1390 Ga0495664_0237910
1391 Ga0495664_0264077
1392 Ga0495594_0037729
1393 Ga0495608_0000107
1394 Ga0495608_0002066
1395 Ga0495608_0003637
1396 Ga0495608_0021626
1397 Ga0495608_0043776
1398 Ga0495608_0066507
1399 Ga0495618_0016510
1400 Ga0495618_0016870
1401 Ga0495618_0036120
1402 Ga0495618_0041529
1403 Ga0495618_0057611
1404 Ga0495618_0090809
1405 Ga0495628_0000136
1406 Ga0495628_0034116
1407 Ga0495628_0036466
1408 Ga0495628_0183741
1409 Ga0495628_0211363
1410 Ga0495628_0293126
1411 Ga0495630_0013910
1412 Ga0495630_0092218
1413 Ga0495630_0092443
1414 Ga0495630_0117715
1415 Ga0495630_0280634
1416 Ga0495630_0428317
1417 Ga0495666_0010981
1418 Ga0495666_0017237
1419 Ga0495652_0000273
1420 Ga0495652_0009562
1421 Ga0495652_0019154
1422 Ga0495652_0031702
1423 Ga0495652_0049231
1424 Ga0495652_0090035
1425 Ga0495652_0178780
1426 Ga0495652_0266431
1427 Ga0495652_0792161
1428 Ga0495665_0001336
1429 Ga0495665_0019416
1430 Ga0495665_0038008
1431 Ga0495665_0322783
1432 Ga0495665_0512905
1433 Ga0495640_0059935
1434 Ga0495640_0074714
1435 Ga0495640_0148678
1436 Ga0495640_0308251
1437 Ga0495586_0025432
1438 Ga0495586_0025530
1439 Ga0495586_0030782
1440 Ga0495586_0079771
1441 Ga0495586_0220821
1442 Ga0495587_0000070
1443 Ga0495587_0001614
1444 Ga0495587_0021510
1445 Ga0495587_0046214
1446 Ga0495587_0057369
1447 Ga0495587_0097819
1448 Ga0495645_0023119
1449 Ga0495645_0027710
1450 Ga0495645_0060242
1451 Ga0495645_0183190
1452 Ga0495645_0208376
1453 Ga0495645_0886278
1454 Ga0495667_0000048
1455 Ga0495667_0000183
1456 Ga0495667_0005886
1457 Ga0495667_0023204
1458 Ga0495667_0028695
1459 Ga0495667_0044109
1460 Ga0495667_0049352
1461 Ga0495667_0052864
1462 Ga0495667_0104600
1463 Ga0495667_0141945
1464 Ga0495667_0455517
1465 Ga0495656_0286980
1466 Ga0495634_0005086
1467 Ga0495634_0053735
1468 Ga0495634_0073569
1469 Ga0495634_0084406
1470 Ga0495634_0087862
1471 Ga0495634_0148706
1472 Ga0495635_0009154
1473 Ga0495635_0018487
1474 Ga0495635_0021653
1475 Ga0495635_0041203
1476 Ga0495635_0114747
1477 Ga0495635_0246269
1478 Ga0495635_0246871
1479 Ga0495635_0297620
1480 Ga0495588_0039429
1481 Ga0495588_0208879
1482 Ga0495657_0000046
1483 Ga0495657_0015776
1484 Ga0495657_0017777
1485 Ga0495657_0022180
1486 Ga0495657_0092487
1487 Ga0495657_0264920
1488 Ga0495657_0299554
1489 Ga0495657_0326491
1490 Ga0495657_0468318
1491 Ga0495599_0000023
1492 Ga0495599_0001737
1493 Ga0495599_0008495
1494 Ga0495599_0016522
1495 Ga0495599_0017052
1496 Ga0495599_0026084
1497 Ga0495599_0082477
1498 Ga0495599_0083357
1499 Ga0495623_0000157
1500 Ga0495623_0013680
1501 Ga0495623_0035232
1502 Ga0495646_0000304
1503 Ga0495646_0018360
1504 Ga0495646_0019197
1505 Ga0495646_0173103
1506 Ga0495646_0495856
1507 Ga0495647_0039238
1508 Ga0495613_0064728
1509 Ga0495613_0096210
1510 Ga0495613_0288918
1511 Ga0495624_0011807
1512 Ga0495624_0015893
1513 Ga0495624_0483078
1514 Ga0495624_0860394
1515 Ga0495600_0011538
1516 Ga0495600_0013146
1517 Ga0495600_0124236
1518 Ga0495600_0169535
1519 Ga0495600_0202716
1520 Ga0495581_0003943
1521 Ga0495581_0011146
1522 Ga0495581_0041040
1523 Ga0495581_0060369
1524 Ga0495604_0000037
1525 Ga0495604_0000831
1526 Ga0495604_0017074
1527 Ga0495604_0018550
1528 Ga0495604_0032937
1529 Ga0495604_0035364
1530 Ga0495604_0037551
1531 Ga0495604_0098632
1532 Ga0495604_0261910
1533 Ga0495674_0002352
1534 Ga0495674_0009843
1535 Ga0495674_0012129
1536 Ga0495674_0041784
1537 Ga0495674_0054130
1538 Ga0495674_0080967
1539 Ga0495674_0393565
1540 Ga0495674_0419358
1541 Ga0495674_0824739
1542 Ga0495676_0039938
1543 Ga0495676_0092300
1544 Ga0495676_0110564
1545 Ga0495676_0118503
1546 Ga0495676_0185373
1547 Ga0495680_0000260
1548 Ga0495680_0006883
1549 Ga0495680_0008303
1550 Ga0495680_0014059
1551 Ga0495680_0031036
1552 Ga0495680_0035625
1553 Ga0495680_0065532
1554 Ga0495680_0402548
1555 Ga0495675_0000359
1556 Ga0495675_0013383
1557 Ga0495675_0020902
1558 Ga0495675_0071856
1559 Ga0495675_0294839
1560 Ga0495684_0005428
1561 Ga0495684_0013919
1562 Ga0495684_0025499
1563 Ga0495684_0029362
1564 Ga0495684_0051796
1565 Ga0495684_0059458
1566 Ga0495593_0007056
1567 Ga0495593_0028366
1568 Ga0495593_0065071
1569 Ga0495593_0080065
1570 Ga0495602_0000118
1571 Ga0495602_0015865
1572 Ga0495602_0045394
1573 Ga0495602_0062668
1574 Ga0495602_0066761
1575 Ga0495602_0069028
1576 Ga0495602_0099042
1577 Ga0495602_0103296
1578 Ga0495602_0116430
1579 Ga0495602_0383385
1580 Ga0495614_0156041
1581 Ga0496100_0498829
1582 Ga0496100_0578620
1583 Ga0496100_0842321
1584 Ga0496101_0056885
1585 Ga0496101_0155317
1586 Ga0496102_0025053
1587 Ga0496103_0044328
1588 Ga0496103_0547784
1589 Ga0496104_0000760
1590 Ga0496104_0003780
1591 Ga0496104_0275459
1592 Ga0496105_0024389
1593 Ga0496105_0032602
1594 Ga0496105_0036121
1595 Ga0496105_0272426
1596 Ga0496106_0112262
1597 Ga0496106_0385382
1598 Ga0496107_0149964
1599 Ga0496107_0360127
1600 Ga0496108_0085567
1601 Ga0496108_0733344
1602 Ga0496109_0053625
1603 Ga0496109_0129918
1604 Ga0496109_0215597
1605 Ga0496110_0015154
1606 Ga0496110_0058547
1607 Ga0496111_0139778
1608 Ga0496112_0000984
1609 Ga0496112_0274813
1610 Ga0496112_0426159
1611 Ga0496112_0751277
1612 Ga0496113_0751646
1613 Ga0496114_0120894
1614 Ga0496115_0043190
1615 Ga0496115_0286506
1616 Ga0496115_0843324
1617 Ga0501225_0310984
1618 nmdc:mga0n895_160943_c1
1619 nmdc:mga0n895_2225_c1
1620 nmdc:mga0n895_347986_c1
1621 nmdc:mga0n895_730466_c1
1622 nmdc:mga0rr50_122743_c1
1623 nmdc:mga0rr50_296316_c1
1624 nmdc:mga0rr50_732986_c1
1625 nmdc:mga08x19_119545_c1
1626 nmdc:mga08x19_291818_c1
1627 nmdc:mga08x19_532654_c1
1628 nmdc:mga0a205_488752_c1
1629 Ga0495601_0053967
1630 Ga0495601_0080308
1631 Ga0495601_0136261
1632 Ga0495601_0201196
1633 Ga0495601_0325203
1634 Ga0495612_0004967
1635 Ga0495612_0144591
1636 Ga0495612_0181928
1637 Ga0495612_0361170
1638 Ga0495595_0002310
1639 Ga0495595_0003631
1640 Ga0495595_0023110
1641 Ga0495595_0170061
1642 Ga0495619_0085583
1643 Ga0495619_0092705
1644 Ga0495619_0110355
1645 Ga0495619_0224412
1646 Ga0495619_0304386

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04417

DUF501

Protein of unknown function (DUF501)

26

153

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r8y-assembly1.cif.gz_B ancestral protein ancthen of phosphomethylpyrimidine kinases family 0.458 127 157
1wpn-assembly1.cif.gz_B crystal structure of the n-terminal core of bacillus subtilis inorganic pyrophosphatase 0.4087 127 160
8hhm-assembly1.cif.gz_A cryo-em structure of the cas12m2-crrna-target dna ternary complex intermediate state 0.3453 74 157
8czg-assembly4.cif.gz_D human bak in complex with the df3 peptide 0.3343 86 157
5hgl-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.2948 61 156
ID Description Score Start End Superfamily
2hawA01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.4139 127 160 3.90.1640.10
af_I1KBF6_325_392_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.4137 85 158 1.10.10.60
af_I1KBF6_325_392_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.4033 85 158 1.10.10.60
af_A0A0R0LBR5_269_432_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3797 59 105 1.20.1250.20
1volA02 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3516 73 160 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A2S8LMX5-F1-model_v4 deleted 0.9885 5 64
AF-A0A3S3LH18-F1-model_v4 DUF501 domain-containing protein 0.975 2 58
AF-A0A2S8MK75-F1-model_v4 deleted 0.9739 5 77
AF-A0A7V9ZHG7-F1-model_v4 DUF501 domain-containing protein 0.9711 4 112
AF-A0A127T3I5-F1-model_v4 DUF501 domain-containing protein 0.9656 6 69

Map