F482325

General Info

Members Datasets Scaffolds Average Seq Length
823 283 1646 104

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100226538|Ga0070675_1002265381
Length 115
Sequence LPPAPLRVYSGMTERKKKPEAIGNIVANWLGSSGLAARVEQAAVIPEWPGLVGPQIAAVTTPKSITATGTLFVEVTTNAWMNELSLLEPELLKSLNGRDRGVPIRRIRWLLSRGS

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
272 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
273 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100226538 3300005354 Unclassified 1629
2 JGI24752J21851_1019397 3300001976 Bacteria 887
3 Ga0070658_10025550 3300005327 Bacteria 4735
4 Ga0070658_10040353 3300005327 Bacteria 3765
5 Ga0070658_10280191 3300005327 Bacteria 1419
6 Ga0070658_10600575 3300005327 Bacteria 954
7 Ga0070658_11414289 3300005327 Bacteria 604
8 Ga0070676_10092651 3300005328 Bacteria 1854
9 Ga0070676_10153320 3300005328 Bacteria 1477
10 Ga0070683_100002812 3300005329 Bacteria 13920
11 Ga0070683_100012484 3300005329 Bacteria 7383
12 Ga0070683_100031238 3300005329 Bacteria 4841
13 Ga0070683_100036651 3300005329 Bacteria 4488
14 Ga0070683_100041930 3300005329 Bacteria 4213
15 Ga0070683_100118039 3300005329 Bacteria 2505
16 Ga0070683_100363753 3300005329 Bacteria 1378
17 Ga0070683_100671756 3300005329 Bacteria 992
18 Ga0070683_100876774 3300005329 Unclassified 861
19 Ga0070683_101280662 3300005329 Unclassified 704
20 Ga0070683_101570902 3300005329 Bacteria 632
21 Ga0070683_102200293 3300005329 Unclassified 529
22 Ga0070690_100014719 3300005330 Bacteria 4647
23 Ga0070690_100051895 3300005330 Bacteria 2620
24 Ga0070690_100163575 3300005330 Bacteria 1527
25 Ga0070670_100055077 3300005331 Bacteria 3414
26 Ga0070670_100513216 3300005331 Bacteria 1067
27 Ga0070670_100557118 3300005331 Bacteria 1023
28 Ga0070670_100617267 3300005331 Bacteria 971
29 Ga0070677_10084419 3300005333 Unclassified 1367
30 Ga0070677_10147727 3300005333 Bacteria 1091
31 Ga0070677_10170175 3300005333 Bacteria 1029
32 Ga0070677_10384528 3300005333 Bacteria 736
33 Ga0068869_100002927 3300005334 Bacteria 10360
34 Ga0068869_100228780 3300005334 Bacteria 1477
35 Ga0068869_101721057 3300005334 Bacteria 560
36 Ga0070666_10470965 3300005335 Bacteria 909
37 Ga0070680_100002653 3300005336 Bacteria 13263
38 Ga0070680_100018257 3300005336 Bacteria 5539
39 Ga0070680_100029706 3300005336 Bacteria 4388
40 Ga0070680_100140175 3300005336 Bacteria 2027
41 Ga0070680_100392731 3300005336 Bacteria 1182
42 Ga0070680_101204929 3300005336 Unclassified 655
43 Ga0070682_100005821 3300005337 Bacteria 6884
44 Ga0070682_100323558 3300005337 Bacteria 1140
45 Ga0070682_101443092 3300005337 Bacteria 590
46 Ga0068868_100064686 3300005338 Bacteria 2904
47 Ga0068868_100448402 3300005338 Bacteria 1122
48 Ga0070660_100266146 3300005339 Bacteria 1400
49 Ga0070660_100275193 3300005339 Bacteria 1377
50 Ga0070660_100347430 3300005339 Bacteria 1221
51 Ga0070660_101058493 3300005339 Bacteria 686
52 Ga0070660_101293360 3300005339 Bacteria 619
53 Ga0070689_100029479 3300005340 Bacteria 4154
54 Ga0070689_100068164 3300005340 Bacteria 2775
55 Ga0070689_100269668 3300005340 Bacteria 1409
56 Ga0070689_100395892 3300005340 Bacteria 1167
57 Ga0070689_100537528 3300005340 Bacteria 1005
58 Ga0070687_100036463 3300005343 Bacteria 2451
59 Ga0070687_100255176 3300005343 Bacteria 1091
60 Ga0070687_101032093 3300005343 Unclassified 598
61 Ga0070661_100001314 3300005344 Bacteria 17431
62 Ga0070661_100405220 3300005344 Bacteria 1079
63 Ga0070661_100529922 3300005344 Bacteria 946
64 Ga0070661_100784210 3300005344 Bacteria 781
65 Ga0070692_10101606 3300005345 Bacteria 1577
66 Ga0070692_10140772 3300005345 Bacteria 1365
67 Ga0070692_10203944 3300005345 Bacteria 1160
68 Ga0070692_10322828 3300005345 Unclassified 950
69 Ga0070692_10563460 3300005345 Bacteria 748
70 Ga0070692_10726545 3300005345 Unclassified 671
71 Ga0070668_100154316 3300005347 Bacteria 1859
72 Ga0070668_100269062 3300005347 Bacteria 1420
73 Ga0070668_100466063 3300005347 Bacteria 1089
74 Ga0070668_100946117 3300005347 Bacteria 772
75 Ga0070669_100020710 3300005353 Bacteria 4698
76 Ga0070669_100222532 3300005353 Bacteria 1493
77 Ga0070669_100963599 3300005353 Bacteria 731
78 Ga0070669_100996259 3300005353 Bacteria 719
79 Ga0070675_100113046 3300005354 Bacteria 2299
80 Ga0070675_100153689 3300005354 Bacteria 1974
81 Ga0070675_100491719 3300005354 Bacteria 1105
82 Ga0070675_100597997 3300005354 Bacteria 1000
83 Ga0070671_100031011 3300005355 Bacteria 4414
84 Ga0070671_100066254 3300005355 Bacteria 3009
85 Ga0070671_100074423 3300005355 Bacteria 2838
86 Ga0070671_100096591 3300005355 Bacteria 2478
87 Ga0070671_101287130 3300005355 Bacteria 645
88 Ga0070674_101124415 3300005356 Bacteria 694
89 Ga0070674_101501062 3300005356 Bacteria 606
90 Ga0070673_100203035 3300005364 Bacteria 1708
91 Ga0070673_100306089 3300005364 Bacteria 1400
92 Ga0070673_100455812 3300005364 Bacteria 1151
93 Ga0070673_100632175 3300005364 Bacteria 978
94 Ga0070673_100647598 3300005364 Bacteria 967
95 Ga0070673_100747349 3300005364 Bacteria 900
96 Ga0070688_100030072 3300005365 Bacteria 3257
97 Ga0070688_100030637 3300005365 Bacteria 3230
98 Ga0070688_100134342 3300005365 Bacteria 1673
99 Ga0070688_100652269 3300005365 Bacteria 811
100 Ga0070659_100008447 3300005366 Bacteria 7523
101 Ga0070659_100105693 3300005366 Bacteria 2269
102 Ga0070667_100051326 3300005367 Bacteria 3477
103 Ga0070667_100059259 3300005367 Bacteria 3239
104 Ga0070667_100227353 3300005367 Bacteria 1662
105 Ga0070667_100420165 3300005367 Bacteria 1219
106 Ga0070709_10052713 3300005434 Bacteria 2559
107 Ga0070709_10056634 3300005434 Bacteria 2480
108 Ga0070709_10762156 3300005434 Bacteria 757
109 Ga0070714_100001805 3300005435 Bacteria 15550
110 Ga0070714_100104134 3300005435 Bacteria 2504
111 Ga0070714_100184074 3300005435 Bacteria 1902
112 Ga0070714_100978875 3300005435 Bacteria 823
113 Ga0070713_100000236 3300005436 Bacteria 36563
114 Ga0070713_100002451 3300005436 Bacteria 12108
115 Ga0070713_100050384 3300005436 Bacteria 3440
116 Ga0070713_100517478 3300005436 Bacteria 1127
117 Ga0070713_101320263 3300005436 Unclassified 699
118 Ga0070713_101724799 3300005436 Unclassified 608
119 Ga0070701_10052147 3300005438 Bacteria 2124
120 Ga0070711_100663513 3300005439 Bacteria 875
121 Ga0070711_101012339 3300005439 Bacteria 713
122 Ga0070705_100724508 3300005440 Bacteria 784
123 Ga0070705_100979394 3300005440 Bacteria 685
124 Ga0070705_101437497 3300005440 Bacteria 576
125 Ga0070705_101771476 3300005440 Unclassified 523
126 Ga0070700_100311430 3300005441 Bacteria 1153
127 Ga0070694_100138661 3300005444 Bacteria 1764
128 Ga0070694_101081607 3300005444 Bacteria 668
129 Ga0070708_100000077 3300005445 Bacteria 63116
130 Ga0070663_100831425 3300005455 Bacteria 794
131 Ga0070663_101269294 3300005455 Bacteria 649
132 Ga0070678_101309201 3300005456 Unclassified 674
133 Ga0070662_100054252 3300005457 Bacteria 2904
134 Ga0070662_100131455 3300005457 Bacteria 1930
135 Ga0070662_100256677 3300005457 Bacteria 1407
136 Ga0070662_100476356 3300005457 Bacteria 1039
137 Ga0070662_100907891 3300005457 Unclassified 752
138 Ga0070681_10002477 3300005458 Bacteria 16905
139 Ga0070681_10010041 3300005458 Bacteria 9332
140 Ga0070681_10012099 3300005458 Bacteria 8557
141 Ga0070681_10027911 3300005458 Bacteria 5674
142 Ga0070681_10907015 3300005458 Bacteria 800
143 Ga0070681_11018893 3300005458 Bacteria 748
144 Ga0068867_100865878 3300005459 Bacteria 810
145 Ga0068867_100982060 3300005459 Bacteria 765
146 Ga0068867_101145238 3300005459 Bacteria 712
147 Ga0070685_10034293 3300005466 Bacteria 2858
148 Ga0070706_100050461 3300005467 Bacteria 3840
149 Ga0070707_100075692 3300005468 Bacteria 3247
150 Ga0070707_100919468 3300005468 Bacteria 839
151 Ga0070699_100742015 3300005518 Bacteria 898
152 Ga0070679_100003319 3300005530 Bacteria 14743
153 Ga0070679_100004717 3300005530 Bacteria 12574
154 Ga0070679_100007339 3300005530 Bacteria 10300
155 Ga0070679_100014922 3300005530 Bacteria 7462
156 Ga0070679_100031622 3300005530 Bacteria 5230
157 Ga0070679_100067019 3300005530 Bacteria 3580
158 Ga0070679_100179759 3300005530 Bacteria 2088
159 Ga0070679_100325419 3300005530 Bacteria 1486
160 Ga0070679_100400206 3300005530 Bacteria 1319
161 Ga0070679_100591904 3300005530 Bacteria 1052
162 Ga0070679_100806225 3300005530 Bacteria 882
163 Ga0070679_100940511 3300005530 Bacteria 808
164 Ga0070679_100987482 3300005530 Bacteria 786
165 Ga0070679_101806514 3300005530 Unclassified 560
166 Ga0070684_100003632 3300005535 Bacteria 11618
167 Ga0070684_100007968 3300005535 Bacteria 8269
168 Ga0070684_100039115 3300005535 Bacteria 4078
169 Ga0070684_100059858 3300005535 Bacteria 3330
170 Ga0070684_100075443 3300005535 Bacteria 2974
171 Ga0070684_100090333 3300005535 Bacteria 2724
172 Ga0070684_100172760 3300005535 Bacteria 1963
173 Ga0070684_100224116 3300005535 Bacteria 1715
174 Ga0070684_100226409 3300005535 Bacteria 1707
175 Ga0070684_101369033 3300005535 Unclassified 666
176 Ga0070684_101556875 3300005535 Unclassified 623
177 Ga0070697_100150367 3300005536 Bacteria 1962
178 Ga0068853_100211063 3300005539 Bacteria 1770
179 Ga0068853_100223486 3300005539 Bacteria 1720
180 Ga0068853_100783106 3300005539 Bacteria 913
181 Ga0068853_101447811 3300005539 Bacteria 665
182 Ga0068853_102390867 3300005539 Bacteria 512
183 Ga0070672_100162220 3300005543 Bacteria 1855
184 Ga0070672_100255545 3300005543 Bacteria 1477
185 Ga0070672_100290724 3300005543 Bacteria 1383
186 Ga0070672_100293467 3300005543 Bacteria 1377
187 Ga0070672_100327661 3300005543 Bacteria 1303
188 Ga0070672_100416645 3300005543 Bacteria 1153
189 Ga0070672_100454168 3300005543 Unclassified 1104
190 Ga0070672_100944021 3300005543 Bacteria 763
191 Ga0070686_100084906 3300005544 Bacteria 2105
192 Ga0070686_100335295 3300005544 Bacteria 1132
193 Ga0070686_101835485 3300005544 Unclassified 516
194 Ga0070696_101107831 3300005546 Unclassified 666
195 Ga0070693_100001053 3300005547 Bacteria 12318
196 Ga0070693_100003690 3300005547 Bacteria 7158
197 Ga0070693_100202513 3300005547 Bacteria 1290
198 Ga0070693_100280490 3300005547 Bacteria 1116
199 Ga0070693_100577209 3300005547 Bacteria 809
200 Ga0070693_100840425 3300005547 Unclassified 684
201 Ga0070665_100739071 3300005548 Bacteria 997
202 Ga0070665_101886894 3300005548 Unclassified 603
203 Ga0070704_100876411 3300005549 Bacteria 806
204 Ga0068855_100047049 3300005563 Bacteria 5097
205 Ga0068855_100375879 3300005563 Bacteria 1561
206 Ga0068855_100530990 3300005563 Bacteria 1276
207 Ga0068855_100581591 3300005563 Bacteria 1209
208 Ga0068855_101165086 3300005563 Bacteria 803
209 Ga0070664_100035989 3300005564 Bacteria 4157
210 Ga0070664_100068952 3300005564 Bacteria 3024
211 Ga0070664_100097485 3300005564 Bacteria 2552
212 Ga0070664_100105450 3300005564 Bacteria 2455
213 Ga0070664_100130106 3300005564 Bacteria 2210
214 Ga0070664_100372399 3300005564 Bacteria 1302
215 Ga0070664_100507515 3300005564 Bacteria 1112
216 Ga0070664_100518803 3300005564 Bacteria 1100
217 Ga0070664_100623119 3300005564 Bacteria 1001
218 Ga0070664_100882264 3300005564 Bacteria 838
219 Ga0070664_101495628 3300005564 Bacteria 639
220 Ga0068857_100021993 3300005577 Bacteria 5612
221 Ga0068857_100022443 3300005577 Bacteria 5553
222 Ga0068857_100074417 3300005577 Bacteria 3026
223 Ga0068857_100111153 3300005577 Bacteria 2463
224 Ga0068857_100978389 3300005577 Bacteria 814
225 Ga0068854_100319824 3300005578 Bacteria 1261
226 Ga0068854_100638350 3300005578 Bacteria 913
227 Ga0068854_101752577 3300005578 Bacteria 569
228 Ga0068856_100010541 3300005614 Bacteria 8974
229 Ga0068856_100243113 3300005614 Bacteria 1815
230 Ga0068856_100784247 3300005614 Bacteria 973
231 Ga0068856_100870817 3300005614 Bacteria 920
232 Ga0068856_101049936 3300005614 Bacteria 833
233 Ga0068856_101123340 3300005614 Bacteria 803
234 Ga0068856_101892696 3300005614 Bacteria 608
235 Ga0070702_100488252 3300005615 Bacteria 902
236 Ga0068852_100037058 3300005616 Bacteria 4087
237 Ga0068852_100049608 3300005616 Bacteria 3592
238 Ga0068852_100152914 3300005616 Bacteria 2147
239 Ga0068852_100326351 3300005616 Bacteria 1492
240 Ga0068852_100394568 3300005616 Bacteria 1360
241 Ga0068852_101107441 3300005616 Unclassified 812
242 Ga0068852_102229446 3300005616 Unclassified 569
243 Ga0068852_102687630 3300005616 Bacteria 517
244 Ga0068859_100054205 3300005617 Bacteria 4032
245 Ga0068859_100054467 3300005617 Bacteria 4023
246 Ga0068859_101665721 3300005617 Bacteria 704
247 Ga0068864_100012093 3300005618 Bacteria 7130
248 Ga0068864_100154595 3300005618 Bacteria 2081
249 Ga0068864_101214149 3300005618 Bacteria 753
250 Ga0068864_101704865 3300005618 Unclassified 635
251 Ga0068866_10687602 3300005718 Bacteria 700
252 Ga0068851_10054916 3300005834 Bacteria 2029
253 Ga0068851_10146765 3300005834 Bacteria 1287
254 Ga0068870_10024742 3300005840 Bacteria 2973
255 Ga0068870_10027837 3300005840 Bacteria 2832
256 Ga0068870_10049069 3300005840 Bacteria 2225
257 Ga0068870_10066462 3300005840 Bacteria 1953
258 Ga0068870_10564851 3300005840 Bacteria 768
259 Ga0068863_100376440 3300005841 Bacteria 1386
260 Ga0068863_100718430 3300005841 Bacteria 994
261 Ga0068858_100016887 3300005842 Bacteria 6852
262 Ga0068858_100340286 3300005842 Bacteria 1436
263 Ga0068860_100026364 3300005843 Bacteria 5604
264 Ga0068860_100223250 3300005843 Bacteria 1830
265 Ga0068862_100241682 3300005844 Bacteria 1642
266 Ga0068862_101747149 3300005844 Bacteria 631
267 Ga0070717_10001248 3300006028 Bacteria 17343
268 Ga0070717_10790139 3300006028 Unclassified 863
269 Ga0070712_100007404 3300006175 Bacteria 6851
270 Ga0070712_100460174 3300006175 Bacteria 1061
271 Ga0070712_101071317 3300006175 Bacteria 699
272 Ga0097621_100357873 3300006237 Bacteria 1299
273 Ga0097621_100501471 3300006237 Bacteria 1099
274 Ga0068871_100095166 3300006358 Bacteria 2487
275 Ga0068871_100771114 3300006358 Bacteria 885
276 Ga0068871_100981778 3300006358 Bacteria 786
277 Ga0068871_101267313 3300006358 Unclassified 693
278 Ga0068871_101480787 3300006358 Unclassified 641
279 Ga0075434_100056186 3300006871 Bacteria 3912
280 Ga0075434_100471354 3300006871 Bacteria 1277
281 Ga0068865_100059495 3300006881 Bacteria 2672
282 Ga0068865_100458438 3300006881 Bacteria 1055
283 Ga0068865_100890268 3300006881 Bacteria 773
284 Ga0075436_100024394 3300006914 Bacteria 4157
285 Ga0075436_100225242 3300006914 Bacteria 1331
286 Ga0097620_100054207 3300006931 Bacteria 4032
287 Ga0097620_100054468 3300006931 Bacteria 4023
288 Ga0097620_101665751 3300006931 Bacteria 704
289 Ga0105240_10004703 3300009093 Bacteria 20635
290 Ga0105240_10680196 3300009093 Bacteria 1125
291 Ga0105240_12089066 3300009093 Unclassified 588
292 Ga0111539_10181061 3300009094 Bacteria 2461
293 Ga0105245_10020054 3300009098 Bacteria 5860
294 Ga0105245_10335706 3300009098 Bacteria 1493
295 Ga0105245_10424390 3300009098 Bacteria 1333
296 Ga0105245_10540958 3300009098 Bacteria 1186
297 Ga0105245_11251850 3300009098 Bacteria 790
298 Ga0105245_11684363 3300009098 Bacteria 686
299 Ga0105243_11528608 3300009148 Bacteria 692
300 Ga0105243_12515179 3300009148 Bacteria 554
301 Ga0105241_10027028 3300009174 Bacteria 4271
302 Ga0105241_10299148 3300009174 Bacteria 1380
303 Ga0105241_10362862 3300009174 Bacteria 1261
304 Ga0105241_10566508 3300009174 Bacteria 1022
305 Ga0105241_10684874 3300009174 Bacteria 934
306 Ga0105242_10042693 3300009176 Bacteria 3664
307 Ga0105242_10268928 3300009176 Unclassified 1543
308 Ga0105242_10292674 3300009176 Bacteria 1483
309 Ga0105242_12926403 3300009176 Unclassified 528
310 Ga0105248_10003576 3300009177 Bacteria 17229
311 Ga0105248_10076753 3300009177 Bacteria 3755
312 Ga0105248_10232205 3300009177 Bacteria 2077
313 Ga0105248_10281720 3300009177 Bacteria 1871
314 Ga0105248_10374097 3300009177 Bacteria 1604
315 Ga0105248_10604859 3300009177 Bacteria 1237
316 Ga0105248_12745506 3300009177 Bacteria 562
317 Ga0105237_10800710 3300009545 Bacteria 949
318 Ga0105237_11173837 3300009545 Bacteria 774
319 Ga0105238_10078106 3300009551 Bacteria 3301
320 Ga0105238_10127431 3300009551 Bacteria 2524
321 Ga0105238_10709807 3300009551 Bacteria 1018
322 Ga0105239_10395697 3300010375 Bacteria 1563
323 Ga0105239_10745708 3300010375 Unclassified 1121
324 Ga0105239_10776652 3300010375 Bacteria 1097
325 Ga0105246_10007161 3300011119 Bacteria 6833
326 Ga0105246_11130927 3300011119 Bacteria 717
327 Ga0105246_11465461 3300011119 Unclassified 640
328 Ga0105246_11580260 3300011119 Bacteria 619
329 Ga0105246_11755955 3300011119 Bacteria 591
330 Ga0157373_10029835 3300013100 Bacteria 3926
331 Ga0157373_10047162 3300013100 Bacteria 3074
332 Ga0157373_10255875 3300013100 Bacteria 1239
333 Ga0157371_10008838 3300013102 Bacteria 7979
334 Ga0157371_10016597 3300013102 Bacteria 5491
335 Ga0157371_10044829 3300013102 Bacteria 3149
336 Ga0157371_10404581 3300013102 Bacteria 999
337 Ga0157371_10416179 3300013102 Bacteria 985
338 Ga0157370_10001913 3300013104 Bacteria 25621
339 Ga0157370_10002900 3300013104 Bacteria 20453
340 Ga0157370_10066229 3300013104 Bacteria 3416
341 Ga0157369_10009822 3300013105 Bacteria 10942
342 Ga0157369_10096297 3300013105 Bacteria 3158
343 Ga0157369_10188548 3300013105 Bacteria 2167
344 Ga0157369_10298509 3300013105 Bacteria 1676
345 Ga0157369_10391050 3300013105 Bacteria 1443
346 Ga0157369_10501318 3300013105 Bacteria 1256
347 Ga0157369_10546164 3300013105 Bacteria 1198
348 Ga0157369_10717531 3300013105 Bacteria 1029
349 Ga0157369_11324177 3300013105 Unclassified 734
350 Ga0157374_10109697 3300013296 Bacteria 2653
351 Ga0157374_10143377 3300013296 Bacteria 2319
352 Ga0157374_10241053 3300013296 Bacteria 1778
353 Ga0157374_11014393 3300013296 Unclassified 849
354 Ga0157378_10285900 3300013297 Bacteria 1591
355 Ga0157378_10554434 3300013297 Bacteria 1155
356 Ga0157378_10824361 3300013297 Unclassified 955
357 Ga0163162_10269862 3300013306 Bacteria 1833
358 Ga0163162_10518744 3300013306 Bacteria 1321
359 Ga0163162_11397781 3300013306 Bacteria 796
360 Ga0157372_10002829 3300013307 Bacteria 18752
361 Ga0157372_10013625 3300013307 Bacteria 8690
362 Ga0157372_10014249 3300013307 Bacteria 8500
363 Ga0157372_10018790 3300013307 Bacteria 7435
364 Ga0157372_10046814 3300013307 Bacteria 4803
365 Ga0157372_10053351 3300013307 Bacteria 4506
366 Ga0157372_10072158 3300013307 Bacteria 3890
367 Ga0157372_10150123 3300013307 Bacteria 2689
368 Ga0157372_10195800 3300013307 Bacteria 2341
369 Ga0157372_10584228 3300013307 Bacteria 1302
370 Ga0157372_10825903 3300013307 Bacteria 1076
371 Ga0157372_10942039 3300013307 Bacteria 1001
372 Ga0157375_10067186 3300013308 Bacteria 3582
373 Ga0157375_10151358 3300013308 Archaea 2456
374 Ga0157375_10273450 3300013308 Bacteria 1852
375 Ga0157375_10609004 3300013308 Bacteria 1251
376 Ga0157375_11088391 3300013308 Bacteria 935
377 Ga0157375_11102659 3300013308 Unclassified 929
378 Ga0163163_10020682 3300014325 Bacteria 6202
379 Ga0157380_10975461 3300014326 Bacteria 879
380 Ga0157380_11050077 3300014326 Bacteria 851
381 Ga0157380_11323711 3300014326 Bacteria 768
382 Ga0182008_10031634 3300014497 Bacteria 2662
383 Ga0182008_10305674 3300014497 Bacteria 833
384 Ga0157377_10000899 3300014745 Bacteria 12411
385 Ga0157377_10104576 3300014745 Bacteria 1693
386 Ga0157377_10554002 3300014745 Bacteria 813
387 Ga0157377_10783496 3300014745 Bacteria 701
388 Ga0157379_10462447 3300014968 Bacteria 1173
389 Ga0157376_10003412 3300014969 Bacteria 10932
390 Ga0157376_10181194 3300014969 Bacteria 1926
391 Ga0157376_10303619 3300014969 Bacteria 1512
392 Ga0182007_10141965 3300015262 Unclassified 813
393 Ga0182007_10271628 3300015262 Unclassified 614
394 Ga0182005_1121966 3300015265 Bacteria 742
395 Ga0163161_10264857 3300017792 Bacteria 1343
396 Ga0163161_10384747 3300017792 Bacteria 1122
397 Ga0206353_11992599 3300020082 Unclassified 700
398 Ga0213876_10014780 3300021384 Bacteria 4138
399 Ga0207697_10009286 3300025315 Bacteria 4255
400 Ga0207697_10027112 3300025315 Bacteria 2343
401 Ga0207656_10039148 3300025321 Bacteria 2004
402 Ga0207682_10013964 3300025893 Bacteria 3128
403 Ga0207692_10291006 3300025898 Bacteria 991
404 Ga0207642_10512441 3300025899 Bacteria 736
405 Ga0207688_10353036 3300025901 Bacteria 906
406 Ga0207688_10374621 3300025901 Bacteria 880
407 Ga0207680_10102045 3300025903 Bacteria 1845
408 Ga0207680_10198914 3300025903 Bacteria 1364
409 Ga0207647_10171786 3300025904 Bacteria 1262
410 Ga0207647_10407568 3300025904 Bacteria 765
411 Ga0207699_10035321 3300025906 Bacteria 2843
412 Ga0207699_10045470 3300025906 Bacteria 2563
413 Ga0207699_10267899 3300025906 Unclassified 1183
414 Ga0207699_10891728 3300025906 Unclassified 656
415 Ga0207645_10056394 3300025907 Bacteria 2508
416 Ga0207645_10094740 3300025907 Bacteria 1922
417 Ga0207645_10144248 3300025907 Bacteria 1552
418 Ga0207645_10230622 3300025907 Bacteria 1222
419 Ga0207643_10009613 3300025908 Bacteria 5192
420 Ga0207643_10014019 3300025908 Bacteria 4349
421 Ga0207643_10086038 3300025908 Bacteria 1826
422 Ga0207705_10005541 3300025909 Bacteria 9436
423 Ga0207705_10008048 3300025909 Bacteria 7727
424 Ga0207705_10011917 3300025909 Bacteria 6283
425 Ga0207705_10088442 3300025909 Bacteria 2266
426 Ga0207705_10156826 3300025909 Bacteria 1708
427 Ga0207705_10259696 3300025909 Bacteria 1326
428 Ga0207705_10466867 3300025909 Bacteria 979
429 Ga0207705_10729943 3300025909 Bacteria 770
430 Ga0207705_11105694 3300025909 Bacteria 610
431 Ga0207705_11139090 3300025909 Bacteria 600
432 Ga0207684_10279706 3300025910 Bacteria 1439
433 Ga0207654_10117525 3300025911 Bacteria 1664
434 Ga0207654_10370913 3300025911 Bacteria 989
435 Ga0207654_10630532 3300025911 Bacteria 766
436 Ga0207707_10003571 3300025912 Bacteria 13788
437 Ga0207707_10011558 3300025912 Bacteria 7687
438 Ga0207707_10015305 3300025912 Bacteria 6677
439 Ga0207707_10102079 3300025912 Bacteria 2507
440 Ga0207695_10022070 3300025913 Bacteria 7242
441 Ga0207695_10046651 3300025913 Bacteria 4592
442 Ga0207671_10742953 3300025914 Bacteria 779
443 Ga0207693_10007418 3300025915 Bacteria 9018
444 Ga0207693_10051634 3300025915 Bacteria 3226
445 Ga0207693_10414189 3300025915 Bacteria 1053
446 Ga0207663_10552560 3300025916 Bacteria 900
447 Ga0207660_10023454 3300025917 Bacteria 4168
448 Ga0207660_10031686 3300025917 Bacteria 3644
449 Ga0207660_10050560 3300025917 Bacteria 2952
450 Ga0207660_10096099 3300025917 Bacteria 2205
451 Ga0207660_10353568 3300025917 Archaea 1178
452 Ga0207662_10004956 3300025918 Bacteria 7042
453 Ga0207662_10026604 3300025918 Bacteria 3337
454 Ga0207662_10342887 3300025918 Bacteria 1002
455 Ga0207662_10601362 3300025918 Unclassified 765
456 Ga0207657_10003181 3300025919 Bacteria 17566
457 Ga0207657_10127135 3300025919 Bacteria 2092
458 Ga0207657_10803827 3300025919 Bacteria 727
459 Ga0207649_10002968 3300025920 Bacteria 9344
460 Ga0207649_10158205 3300025920 Bacteria 1567
461 Ga0207649_10170076 3300025920 Bacteria 1517
462 Ga0207649_10412448 3300025920 Bacteria 1013
463 Ga0207649_10448992 3300025920 Bacteria 973
464 Ga0207649_11450141 3300025920 Unclassified 543
465 Ga0207652_10004529 3300025921 Bacteria 11282
466 Ga0207652_10010657 3300025921 Bacteria 7403
467 Ga0207652_10045101 3300025921 Bacteria 3758
468 Ga0207652_10050024 3300025921 Bacteria 3580
469 Ga0207652_10149885 3300025921 Bacteria 2088
470 Ga0207652_10192479 3300025921 Bacteria 1835
471 Ga0207652_10277968 3300025921 Bacteria 1510
472 Ga0207652_10313646 3300025921 Bacteria 1416
473 Ga0207652_10509519 3300025921 Bacteria 1083
474 Ga0207652_10700559 3300025921 Unclassified 904
475 Ga0207652_11255638 3300025921 Unclassified 643
476 Ga0207652_11825499 3300025921 Unclassified 513
477 Ga0207646_10031385 3300025922 Bacteria 4810
478 Ga0207681_10328073 3300025923 Bacteria 1219
479 Ga0207681_10852948 3300025923 Bacteria 762
480 Ga0207694_10054749 3300025924 Bacteria 3096
481 Ga0207694_10461968 3300025924 Bacteria 1061
482 Ga0207650_10080798 3300025925 Bacteria 2465
483 Ga0207650_10181416 3300025925 Bacteria 1678
484 Ga0207650_10268807 3300025925 Bacteria 1385
485 Ga0207650_10340084 3300025925 Bacteria 1232
486 Ga0207650_11616298 3300025925 Unclassified 550
487 Ga0207659_10027954 3300025926 Bacteria 3826
488 Ga0207659_10090549 3300025926 Bacteria 2283
489 Ga0207659_10239090 3300025926 Bacteria 1468
490 Ga0207659_10793558 3300025926 Bacteria 813
491 Ga0207687_10019924 3300025927 Bacteria 4448
492 Ga0207687_11924102 3300025927 Bacteria 505
493 Ga0207700_10000814 3300025928 Bacteria 18060
494 Ga0207700_10013695 3300025928 Bacteria 5288
495 Ga0207700_10019334 3300025928 Bacteria 4599
496 Ga0207664_10002369 3300025929 Bacteria 12452
497 Ga0207664_10031772 3300025929 Bacteria 4042
498 Ga0207644_10042103 3300025931 Bacteria 3235
499 Ga0207644_10059291 3300025931 Bacteria 2768
500 Ga0207644_10304680 3300025931 Bacteria 1285
501 Ga0207644_10403820 3300025931 Bacteria 1117
502 Ga0207644_10643244 3300025931 Bacteria 882
503 Ga0207690_10022052 3300025932 Bacteria 3957
504 Ga0207690_10065659 3300025932 Bacteria 2482
505 Ga0207690_10344897 3300025932 Bacteria 1176
506 Ga0207690_10543883 3300025932 Unclassified 943
507 Ga0207690_11130600 3300025932 Bacteria 653
508 Ga0207690_11404384 3300025932 Unclassified 584
509 Ga0207690_11666720 3300025932 Bacteria 533
510 Ga0207706_10088293 3300025933 Bacteria 2726
511 Ga0207706_10148099 3300025933 Bacteria 2065
512 Ga0207706_10155842 3300025933 Bacteria 2009
513 Ga0207706_10291995 3300025933 Bacteria 1421
514 Ga0207706_10551041 3300025933 Bacteria 993
515 Ga0207706_10952912 3300025933 Unclassified 723
516 Ga0207706_11532137 3300025933 Bacteria 543
517 Ga0207686_10100903 3300025934 Bacteria 1927
518 Ga0207686_10203107 3300025934 Bacteria 1421
519 Ga0207670_10119362 3300025936 Bacteria 1914
520 Ga0207670_10213561 3300025936 Bacteria 1473
521 Ga0207670_10218277 3300025936 Bacteria 1458
522 Ga0207669_10330513 3300025937 Bacteria 1170
523 Ga0207669_10718881 3300025937 Bacteria 822
524 Ga0207704_10008644 3300025938 Bacteria 4879
525 Ga0207704_10521669 3300025938 Bacteria 961
526 Ga0207665_10556341 3300025939 Bacteria 892
527 Ga0207691_10025908 3300025940 Bacteria 5504
528 Ga0207691_10066568 3300025940 Bacteria 3259
529 Ga0207691_10089594 3300025940 Bacteria 2759
530 Ga0207691_10108012 3300025940 Bacteria 2477
531 Ga0207691_10186083 3300025940 Bacteria 1813
532 Ga0207691_10228257 3300025940 Bacteria 1613
533 Ga0207711_10018756 3300025941 Bacteria 5752
534 Ga0207711_10259345 3300025941 Bacteria 1597
535 Ga0207711_10695658 3300025941 Bacteria 948
536 Ga0207711_10748022 3300025941 Bacteria 911
537 Ga0207689_10000685 3300025942 Bacteria 32339
538 Ga0207689_10035845 3300025942 Bacteria 4119
539 Ga0207661_10002694 3300025944 Bacteria 12215
540 Ga0207661_10004871 3300025944 Bacteria 9405
541 Ga0207661_10015132 3300025944 Bacteria 5670
542 Ga0207661_10021455 3300025944 Bacteria 4839
543 Ga0207661_10044070 3300025944 Bacteria 3523
544 Ga0207661_10147082 3300025944 Bacteria 2034
545 Ga0207661_10159419 3300025944 Bacteria 1956
546 Ga0207661_10232070 3300025944 Bacteria 1634
547 Ga0207661_10253985 3300025944 Bacteria 1564
548 Ga0207661_10373130 3300025944 Bacteria 1290
549 Ga0207661_10442331 3300025944 Bacteria 1183
550 Ga0207661_10467618 3300025944 Unclassified 1150
551 Ga0207661_10997489 3300025944 Unclassified 771
552 Ga0207661_11181951 3300025944 Bacteria 704
553 Ga0207661_11251512 3300025944 Bacteria 682
554 Ga0207679_10001420 3300025945 Bacteria 15063
555 Ga0207679_10025456 3300025945 Bacteria 4070
556 Ga0207679_10054055 3300025945 Bacteria 2954
557 Ga0207679_10085197 3300025945 Bacteria 2427
558 Ga0207679_10187703 3300025945 Bacteria 1716
559 Ga0207679_10313894 3300025945 Unclassified 1355
560 Ga0207679_10439386 3300025945 Bacteria 1155
561 Ga0207679_11146253 3300025945 Bacteria 713
562 Ga0207667_10095853 3300025949 Bacteria 3062
563 Ga0207667_10857339 3300025949 Bacteria 902
564 Ga0207667_11299216 3300025949 Bacteria 704
565 Ga0207651_10712427 3300025960 Bacteria 885
566 Ga0207651_11476484 3300025960 Bacteria 612
567 Ga0207712_10456261 3300025961 Bacteria 1085
568 Ga0207668_10265169 3300025972 Bacteria 1402
569 Ga0207668_10467562 3300025972 Bacteria 1079
570 Ga0207668_10915656 3300025972 Bacteria 781
571 Ga0207640_10732083 3300025981 Unclassified 851
572 Ga0207658_10136455 3300025986 Bacteria 1979
573 Ga0207658_10331693 3300025986 Bacteria 1320
574 Ga0207658_10786555 3300025986 Bacteria 863
575 Ga0207658_10852946 3300025986 Bacteria 828
576 Ga0207658_11774866 3300025986 Unclassified 563
577 Ga0207658_12132231 3300025986 Bacteria 509
578 Ga0207677_10009375 3300026023 Bacteria 5509
579 Ga0207677_10715012 3300026023 Bacteria 890
580 Ga0207703_10011641 3300026035 Bacteria 6841
581 Ga0207703_10200961 3300026035 Bacteria 1771
582 Ga0207703_10760607 3300026035 Unclassified 923
583 Ga0207703_10941426 3300026035 Bacteria 828
584 Ga0207639_10136204 3300026041 Bacteria 2040
585 Ga0207639_10179741 3300026041 Bacteria 1799
586 Ga0207639_10404629 3300026041 Unclassified 1230
587 Ga0207708_10083570 3300026075 Bacteria 2455
588 Ga0207708_10397012 3300026075 Bacteria 1140
589 Ga0207708_11346008 3300026075 Bacteria 626
590 Ga0207702_10010242 3300026078 Bacteria 7852
591 Ga0207702_10220331 3300026078 Bacteria 1768
592 Ga0207702_10305144 3300026078 Bacteria 1512
593 Ga0207702_11159782 3300026078 Bacteria 767
594 Ga0207702_11885090 3300026078 Unclassified 589
595 Ga0207641_11336224 3300026088 Bacteria 717
596 Ga0207648_10015735 3300026089 Bacteria 6939
597 Ga0207648_10247713 3300026089 Unclassified 1588
598 Ga0207648_10674764 3300026089 Bacteria 956
599 Ga0207676_10034535 3300026095 Bacteria 3829
600 Ga0207676_10144665 3300026095 Bacteria 2040
601 Ga0207676_10392980 3300026095 Bacteria 1294
602 Ga0207676_10726554 3300026095 Bacteria 964
603 Ga0207674_10000393 3300026116 Bacteria 56512
604 Ga0207674_10022450 3300026116 Bacteria 6774
605 Ga0207674_10090176 3300026116 Bacteria 3057
606 Ga0207674_10105509 3300026116 Bacteria 2796
607 Ga0207674_10136450 3300026116 Bacteria 2415
608 Ga0207675_100334923 3300026118 Bacteria 1480
609 Ga0207675_100531825 3300026118 Bacteria 1173
610 Ga0207675_101917286 3300026118 Unclassified 611
611 Ga0207683_10636292 3300026121 Bacteria 988
612 Ga0207683_10759890 3300026121 Bacteria 899
613 Ga0207683_11082642 3300026121 Unclassified 744
614 Ga0207698_10061401 3300026142 Bacteria 2929
615 Ga0207698_10085606 3300026142 Bacteria 2560
616 Ga0207698_10125578 3300026142 Bacteria 2181
617 Ga0207698_10370272 3300026142 Bacteria 1360
618 Ga0207698_10584884 3300026142 Unclassified 1099
619 Ga0207698_10663770 3300026142 Bacteria 1034
620 Ga0207698_11902666 3300026142 Bacteria 610
621 Ga0268266_11028568 3300028379 Bacteria 797
622 Ga0268265_10293984 3300028380 Bacteria 1459
623 Ga0268265_10504595 3300028380 Bacteria 1141
624 Ga0268264_10024403 3300028381 Bacteria 4936
625 Ga0268264_10333953 3300028381 Bacteria 1437
626 Ga0268264_10497433 3300028381 Bacteria 1188
627 Ga0307408_100293498 3300031548 Bacteria 1359
628 Ga0307405_10624018 3300031731 Bacteria 883
629 Ga0307410_11154464 3300031852 Bacteria 673
630 Ga0307406_10301272 3300031901 Bacteria 1232
631 Ga0307406_10587695 3300031901 Bacteria 916
632 Ga0307406_10842530 3300031901 Unclassified 777
633 Ga0307407_10398187 3300031903 Bacteria 987
634 Ga0307407_10556577 3300031903 Bacteria 848
635 Ga0307412_10221035 3300031911 Bacteria 1452
636 Ga0307409_100281483 3300031995 Bacteria 1537
637 Ga0307409_100444199 3300031995 Bacteria 1250
638 Ga0307416_100352845 3300032002 Bacteria 1489
639 Ga0307416_100564492 3300032002 Bacteria 1213
640 Ga0307416_100899145 3300032002 Bacteria 985
641 Ga0307416_100900154 3300032002 Bacteria 985
642 Ga0307414_10323462 3300032004 Bacteria 1314
643 Ga0307414_11162346 3300032004 Unclassified 714
644 Ga0307411_10883326 3300032005 Unclassified 793
645 Ga0307415_101057300 3300032126 Bacteria 758
646 Ga0307415_102464652 3300032126 Unclassified 512
647 Ga0373926_0133388 3300035083 Bacteria 941
648 Ga0373926_0178938 3300035083 Bacteria 813
649 Ga0373934_0090444 3300035086 Bacteria 1233
650 Ga0373934_0370086 3300035086 Bacteria 597
651 Ga0373936_0020467 3300035113 Bacteria 2571
652 Ga0373945_0466033 3300035116 Unclassified 560
653 Ga0373956_0351996 3300035119 Unclassified 702
654 Ga0373957_0036269 3300035120 Bacteria 1836
655 Ga0373957_0229229 3300035120 Bacteria 779
656 Ga0373943_0301201 3300035170 Bacteria 910
657 Ga0373955_0000350 3300035172 Bacteria 19452
658 Ga0373955_0010873 3300035172 Bacteria 4317
659 Ga0373935_0243568 3300035692 Bacteria 1256
660 Ga0373927_0008067 3300035695 Bacteria 7109
661 Ga0373927_0219333 3300035695 Bacteria 1249
662 Ga0373927_0226885 3300035695 Bacteria 1227
663 Ga0373933_0009373 3300035724 Bacteria 5348
664 Ga0373933_0849465 3300035724 Bacteria 601
665 Ga0373947_0042195 3300035725 Bacteria 2723
666 Ga0373947_0061639 3300035725 Bacteria 2280
667 Ga0373937_0000274 3300036401 Bacteria 49605
668 Ga0373937_0022515 3300036401 Bacteria 5666
669 Ga0373937_0054326 3300036401 Bacteria 3675
670 Ga0373925_0025482 3300037068 Bacteria 4321
671 Ga0373925_0302472 3300037068 Bacteria 1291
672 Ga0395900_0344232 3300037418 Bacteria 1466
673 Ga0395905_0475513 3300037471 Unclassified 1149
674 Ga0436365_0172857 3300039437 Unclassified 518
675 Ga0436365_0575608 3300039437 Bacteria 4455
676 Ga0436365_0989801 3300039437 Bacteria 1022
677 Ga0436365_1873106 3300039437 Unclassified 607
678 Ga0451802_0501170 3300041460 Unclassified 566
679 Ga0451853_1550359 3300041512 Unclassified 538
680 Ga0466963_0414196 3300044694 Bacteria 950
681 Ga0466963_0527209 3300044694 Bacteria 834
682 Ga0466958_0291654 3300045836 Bacteria 1046
683 Ga0466967_0036038 3300045976 Bacteria 4220
684 Ga0466967_0057697 3300045976 Bacteria 3428
685 Ga0466967_0365939 3300045976 Bacteria 1398
686 Ga0466967_1973966 3300045976 Unclassified 580
687 Ga0495592_0132851 3300046454 Bacteria 1739
688 Ga0495592_0141250 3300046454 Bacteria 1675
689 Ga0495603_0474974 3300046455 Bacteria 716
690 Ga0495603_0568914 3300046455 Bacteria 649
691 Ga0495629_0024914 3300046459 Bacteria 4256
692 Ga0495629_0529250 3300046459 Unclassified 793
693 Ga0495651_0237380 3300046462 Bacteria 1252
694 Ga0495651_0395399 3300046462 Bacteria 903
695 Ga0495653_0012086 3300046463 Bacteria 7044
696 Ga0495580_0002602 3300046472 Bacteria 15676
697 Ga0495580_0031181 3300046472 Bacteria 3855
698 Ga0495582_0124646 3300046473 Bacteria 1453
699 Ga0495639_0008682 3300046475 Bacteria 4356
700 Ga0495639_0157068 3300046475 Bacteria 1099
701 Ga0495662_0178645 3300046476 Bacteria 1046
702 Ga0495664_0619209 3300046477 Unclassified 643
703 Ga0495594_0031748 3300046499 Bacteria 2865
704 Ga0495594_0067582 3300046499 Bacteria 1984
705 Ga0495594_0132642 3300046499 Bacteria 1411
706 Ga0495596_0028517 3300046500 Bacteria 2241
707 Ga0495608_0502148 3300046511 Unclassified 734
708 Ga0495618_0164113 3300046514 Bacteria 1415
709 Ga0495618_0421529 3300046514 Unclassified 814
710 Ga0495628_0211707 3300046516 Bacteria 1458
711 Ga0495628_0220825 3300046516 Bacteria 1423
712 Ga0495628_0324655 3300046516 Bacteria 1135
713 Ga0495630_0058719 3300046517 Bacteria 2884
714 Ga0495630_0131207 3300046517 Bacteria 1903
715 Ga0495630_1097027 3300046517 Bacteria 603
716 Ga0495663_0190724 3300046525 Bacteria 712
717 Ga0495666_0097664 3300046526 Bacteria 1385
718 Ga0495666_0419692 3300046526 Unclassified 600
719 Ga0495652_0002098 3300046529 Bacteria 21042
720 Ga0495652_0087720 3300046529 Bacteria 2552
721 Ga0495665_0010196 3300046531 Bacteria 5091
722 Ga0495665_0096551 3300046531 Bacteria 1552
723 Ga0495665_0144981 3300046531 Bacteria 1240
724 Ga0495640_0186268 3300046533 Bacteria 1321
725 Ga0495640_0625333 3300046533 Bacteria 649
726 Ga0495586_0069421 3300046535 Bacteria 1923
727 Ga0495586_0102449 3300046535 Bacteria 1589
728 Ga0495586_0392106 3300046535 Unclassified 799
729 Ga0495587_0000999 3300046536 Bacteria 18595
730 Ga0495587_0016345 3300046536 Bacteria 4617
731 Ga0495598_0086858 3300046537 Bacteria 1013
732 Ga0495645_0000681 3300046543 Bacteria 23341
733 Ga0495645_0000982 3300046543 Bacteria 19437
734 Ga0495645_0039475 3300046543 Bacteria 3443
735 Ga0495645_0094513 3300046543 Bacteria 2132
736 Ga0495667_0006454 3300046559 Bacteria 7962
737 Ga0495667_0058652 3300046559 Bacteria 2528
738 Ga0495635_0156126 3300046663 Bacteria 1553
739 Ga0495588_0584336 3300046674 Bacteria 585
740 Ga0495588_0625013 3300046674 Unclassified 564
741 Ga0495657_0017478 3300046675 Bacteria 5205
742 Ga0495657_0049190 3300046675 Bacteria 2841
743 Ga0495599_0000215 3300046678 Bacteria 36967
744 Ga0495599_0176017 3300046678 Bacteria 1319
745 Ga0495623_0000766 3300046679 Bacteria 21511
746 Ga0495623_0011788 3300046679 Bacteria 5663
747 Ga0495669_0523173 3300046684 Bacteria 577
748 Ga0495613_0156512 3300046689 Bacteria 1623
749 Ga0495613_0258131 3300046689 Bacteria 1215
750 Ga0495600_0041303 3300046809 Bacteria 3005
751 Ga0495581_0009485 3300047315 Bacteria 5633
752 Ga0495581_0250474 3300047315 Bacteria 1036
753 Ga0495604_0192552 3300047317 Bacteria 1420
754 Ga0495604_0362136 3300047317 Bacteria 961
755 Ga0495604_0805339 3300047317 Bacteria 591
756 Ga0495636_0075366 3300047318 Bacteria 1446
757 Ga0495674_0106730 3300047319 Bacteria 2378
758 Ga0495674_0183535 3300047319 Bacteria 1741
759 Ga0495674_0199934 3300047319 Bacteria 1658
760 Ga0495674_0449083 3300047319 Unclassified 1036
761 Ga0495674_0685331 3300047319 Bacteria 805
762 Ga0495672_0027195 3300047320 Bacteria 3638
763 Ga0495675_0188415 3300047444 Bacteria 1260
764 Ga0495677_0275476 3300047445 Unclassified 660
765 Ga0495684_0028573 3300047471 Bacteria 4281
766 Ga0495684_0076205 3300047471 Bacteria 2547
767 Ga0495684_0562778 3300047471 Bacteria 774
768 Ga0495684_0567297 3300047471 Bacteria 770
769 Ga0495593_0071175 3300047673 Bacteria 1806
770 Ga0495602_0196870 3300048088 Bacteria 1540
771 Ga0495602_0360215 3300048088 Bacteria 1047
772 Ga0496104_0027643 3300048907 Bacteria 5252
773 Ga0496106_0278192 3300048909 Bacteria 1341
774 Ga0496106_1518531 3300048909 Unclassified 515
775 Ga0496108_1443978 3300048911 Unclassified 574
776 Ga0496109_1500879 3300048912 Unclassified 609
777 Ga0496110_0106936 3300048913 Bacteria 2511
778 Ga0496112_0013433 3300048915 Bacteria 7559
779 Ga0496112_0647593 3300048915 Bacteria 986
780 Ga0496113_0013981 3300048916 Bacteria 5461
781 Ga0501291_132702 3300049514 Unclassified 550
782 Ga0501032_0626409 3300049569 Unclassified 684
783 Ga0501033_0016742 3300049570 Bacteria 5545
784 Ga0501033_1123280 3300049570 Unclassified 522
785 Ga0501034_0044876 3300049571 Bacteria 4468
786 Ga0501034_0587330 3300049571 Bacteria 1020
787 Ga0501034_0778215 3300049571 Bacteria 851
788 Ga0501036_0035291 3300049572 Bacteria 4231
789 Ga0501036_0713488 3300049572 Bacteria 828
790 Ga0501038_0169952 3300049574 Bacteria 1765
791 Ga0501038_0210468 3300049574 Bacteria 1556
792 Ga0501039_0300620 3300049575 Bacteria 1262
793 Ga0501043_0040326 3300049579 Bacteria 3670
794 Ga0501043_0066449 3300049579 Bacteria 2832
795 Ga0501047_0000707 3300049581 Bacteria 34754
796 Ga0501047_0007362 3300049581 Bacteria 10351
797 Ga0501070_0147127 3300049586 Bacteria 1944
798 Ga0501070_0342210 3300049586 Bacteria 1215
799 Ga0501073_0125214 3300049589 Bacteria 1781
800 Ga0501217_083585 3300049661 Bacteria 887
801 Ga0501249_014338 3300049679 Bacteria 1689
802 Ga0501283_017583 3300049779 Bacteria 1120
803 Ga0501035_0057656 3300049822 Bacteria 3462
804 Ga0501044_0010042 3300049823 Bacteria 10287
805 Ga0501044_0233490 3300049823 Bacteria 1786
806 Ga0501044_0348812 3300049823 Bacteria 1400
807 nmdc:mga08y16_157080_c1 3300050511 Bacteria 2363
808 nmdc:mga0n895_140177_c1 3300050512 Bacteria 2446
809 nmdc:mga0n895_184878_c1 3300050512 Bacteria 2115
810 nmdc:mga0rr50_593450_c1 3300050513 Bacteria 944
811 nmdc:mga08x19_35757_c1 3300050514 Bacteria 3144
812 nmdc:mga08x19_455373_c1 3300050514 Unclassified 901
813 nmdc:mga08x19_554416_c1 3300050514 Bacteria 813
814 Ga0495601_0063822 3300053077 Bacteria 2341
815 Ga0495601_0319827 3300053077 Bacteria 1010
816 Ga0495601_0699352 3300053077 Bacteria 647
817 Ga0495612_0011585 3300053078 Bacteria 3552
818 Ga0495612_0393790 3300053078 Unclassified 629
819 Ga0495595_0102954 3300053084 Unclassified 1379
820 Ga0495595_0138319 3300053084 Bacteria 1194
821 Ga0495595_0186841 3300053084 Bacteria 1029
822 Ga0495619_0029584 3300053085 Bacteria 3540
823 Ga0495619_0282060 3300053085 Bacteria 1151
824 Ga0070675_100226538
825 JGI24752J21851_1019397
826 Ga0070658_10025550
827 Ga0070658_10040353
828 Ga0070658_10280191
829 Ga0070658_10600575
830 Ga0070658_11414289
831 Ga0070676_10092651
832 Ga0070676_10153320
833 Ga0070683_100002812
834 Ga0070683_100012484
835 Ga0070683_100031238
836 Ga0070683_100036651
837 Ga0070683_100041930
838 Ga0070683_100118039
839 Ga0070683_100363753
840 Ga0070683_100671756
841 Ga0070683_100876774
842 Ga0070683_101280662
843 Ga0070683_101570902
844 Ga0070683_102200293
845 Ga0070690_100014719
846 Ga0070690_100051895
847 Ga0070690_100163575
848 Ga0070670_100055077
849 Ga0070670_100513216
850 Ga0070670_100557118
851 Ga0070670_100617267
852 Ga0070677_10084419
853 Ga0070677_10147727
854 Ga0070677_10170175
855 Ga0070677_10384528
856 Ga0068869_100002927
857 Ga0068869_100228780
858 Ga0068869_101721057
859 Ga0070666_10470965
860 Ga0070680_100002653
861 Ga0070680_100018257
862 Ga0070680_100029706
863 Ga0070680_100140175
864 Ga0070680_100392731
865 Ga0070680_101204929
866 Ga0070682_100005821
867 Ga0070682_100323558
868 Ga0070682_101443092
869 Ga0068868_100064686
870 Ga0068868_100448402
871 Ga0070660_100266146
872 Ga0070660_100275193
873 Ga0070660_100347430
874 Ga0070660_101058493
875 Ga0070660_101293360
876 Ga0070689_100029479
877 Ga0070689_100068164
878 Ga0070689_100269668
879 Ga0070689_100395892
880 Ga0070689_100537528
881 Ga0070687_100036463
882 Ga0070687_100255176
883 Ga0070687_101032093
884 Ga0070661_100001314
885 Ga0070661_100405220
886 Ga0070661_100529922
887 Ga0070661_100784210
888 Ga0070692_10101606
889 Ga0070692_10140772
890 Ga0070692_10203944
891 Ga0070692_10322828
892 Ga0070692_10563460
893 Ga0070692_10726545
894 Ga0070668_100154316
895 Ga0070668_100269062
896 Ga0070668_100466063
897 Ga0070668_100946117
898 Ga0070669_100020710
899 Ga0070669_100222532
900 Ga0070669_100963599
901 Ga0070669_100996259
902 Ga0070675_100113046
903 Ga0070675_100153689
904 Ga0070675_100491719
905 Ga0070675_100597997
906 Ga0070671_100031011
907 Ga0070671_100066254
908 Ga0070671_100074423
909 Ga0070671_100096591
910 Ga0070671_101287130
911 Ga0070674_101124415
912 Ga0070674_101501062
913 Ga0070673_100203035
914 Ga0070673_100306089
915 Ga0070673_100455812
916 Ga0070673_100632175
917 Ga0070673_100647598
918 Ga0070673_100747349
919 Ga0070688_100030072
920 Ga0070688_100030637
921 Ga0070688_100134342
922 Ga0070688_100652269
923 Ga0070659_100008447
924 Ga0070659_100105693
925 Ga0070667_100051326
926 Ga0070667_100059259
927 Ga0070667_100227353
928 Ga0070667_100420165
929 Ga0070709_10052713
930 Ga0070709_10056634
931 Ga0070709_10762156
932 Ga0070714_100001805
933 Ga0070714_100104134
934 Ga0070714_100184074
935 Ga0070714_100978875
936 Ga0070713_100000236
937 Ga0070713_100002451
938 Ga0070713_100050384
939 Ga0070713_100517478
940 Ga0070713_101320263
941 Ga0070713_101724799
942 Ga0070701_10052147
943 Ga0070711_100663513
944 Ga0070711_101012339
945 Ga0070705_100724508
946 Ga0070705_100979394
947 Ga0070705_101437497
948 Ga0070705_101771476
949 Ga0070700_100311430
950 Ga0070694_100138661
951 Ga0070694_101081607
952 Ga0070708_100000077
953 Ga0070663_100831425
954 Ga0070663_101269294
955 Ga0070678_101309201
956 Ga0070662_100054252
957 Ga0070662_100131455
958 Ga0070662_100256677
959 Ga0070662_100476356
960 Ga0070662_100907891
961 Ga0070681_10002477
962 Ga0070681_10010041
963 Ga0070681_10012099
964 Ga0070681_10027911
965 Ga0070681_10907015
966 Ga0070681_11018893
967 Ga0068867_100865878
968 Ga0068867_100982060
969 Ga0068867_101145238
970 Ga0070685_10034293
971 Ga0070706_100050461
972 Ga0070707_100075692
973 Ga0070707_100919468
974 Ga0070699_100742015
975 Ga0070679_100003319
976 Ga0070679_100004717
977 Ga0070679_100007339
978 Ga0070679_100014922
979 Ga0070679_100031622
980 Ga0070679_100067019
981 Ga0070679_100179759
982 Ga0070679_100325419
983 Ga0070679_100400206
984 Ga0070679_100591904
985 Ga0070679_100806225
986 Ga0070679_100940511
987 Ga0070679_100987482
988 Ga0070679_101806514
989 Ga0070684_100003632
990 Ga0070684_100007968
991 Ga0070684_100039115
992 Ga0070684_100059858
993 Ga0070684_100075443
994 Ga0070684_100090333
995 Ga0070684_100172760
996 Ga0070684_100224116
997 Ga0070684_100226409
998 Ga0070684_101369033
999 Ga0070684_101556875
1000 Ga0070697_100150367
1001 Ga0068853_100211063
1002 Ga0068853_100223486
1003 Ga0068853_100783106
1004 Ga0068853_101447811
1005 Ga0068853_102390867
1006 Ga0070672_100162220
1007 Ga0070672_100255545
1008 Ga0070672_100290724
1009 Ga0070672_100293467
1010 Ga0070672_100327661
1011 Ga0070672_100416645
1012 Ga0070672_100454168
1013 Ga0070672_100944021
1014 Ga0070686_100084906
1015 Ga0070686_100335295
1016 Ga0070686_101835485
1017 Ga0070696_101107831
1018 Ga0070693_100001053
1019 Ga0070693_100003690
1020 Ga0070693_100202513
1021 Ga0070693_100280490
1022 Ga0070693_100577209
1023 Ga0070693_100840425
1024 Ga0070665_100739071
1025 Ga0070665_101886894
1026 Ga0070704_100876411
1027 Ga0068855_100047049
1028 Ga0068855_100375879
1029 Ga0068855_100530990
1030 Ga0068855_100581591
1031 Ga0068855_101165086
1032 Ga0070664_100035989
1033 Ga0070664_100068952
1034 Ga0070664_100097485
1035 Ga0070664_100105450
1036 Ga0070664_100130106
1037 Ga0070664_100372399
1038 Ga0070664_100507515
1039 Ga0070664_100518803
1040 Ga0070664_100623119
1041 Ga0070664_100882264
1042 Ga0070664_101495628
1043 Ga0068857_100021993
1044 Ga0068857_100022443
1045 Ga0068857_100074417
1046 Ga0068857_100111153
1047 Ga0068857_100978389
1048 Ga0068854_100319824
1049 Ga0068854_100638350
1050 Ga0068854_101752577
1051 Ga0068856_100010541
1052 Ga0068856_100243113
1053 Ga0068856_100784247
1054 Ga0068856_100870817
1055 Ga0068856_101049936
1056 Ga0068856_101123340
1057 Ga0068856_101892696
1058 Ga0070702_100488252
1059 Ga0068852_100037058
1060 Ga0068852_100049608
1061 Ga0068852_100152914
1062 Ga0068852_100326351
1063 Ga0068852_100394568
1064 Ga0068852_101107441
1065 Ga0068852_102229446
1066 Ga0068852_102687630
1067 Ga0068859_100054205
1068 Ga0068859_100054467
1069 Ga0068859_101665721
1070 Ga0068864_100012093
1071 Ga0068864_100154595
1072 Ga0068864_101214149
1073 Ga0068864_101704865
1074 Ga0068866_10687602
1075 Ga0068851_10054916
1076 Ga0068851_10146765
1077 Ga0068870_10024742
1078 Ga0068870_10027837
1079 Ga0068870_10049069
1080 Ga0068870_10066462
1081 Ga0068870_10564851
1082 Ga0068863_100376440
1083 Ga0068863_100718430
1084 Ga0068858_100016887
1085 Ga0068858_100340286
1086 Ga0068860_100026364
1087 Ga0068860_100223250
1088 Ga0068862_100241682
1089 Ga0068862_101747149
1090 Ga0070717_10001248
1091 Ga0070717_10790139
1092 Ga0070712_100007404
1093 Ga0070712_100460174
1094 Ga0070712_101071317
1095 Ga0097621_100357873
1096 Ga0097621_100501471
1097 Ga0068871_100095166
1098 Ga0068871_100771114
1099 Ga0068871_100981778
1100 Ga0068871_101267313
1101 Ga0068871_101480787
1102 Ga0075434_100056186
1103 Ga0075434_100471354
1104 Ga0068865_100059495
1105 Ga0068865_100458438
1106 Ga0068865_100890268
1107 Ga0075436_100024394
1108 Ga0075436_100225242
1109 Ga0097620_100054207
1110 Ga0097620_100054468
1111 Ga0097620_101665751
1112 Ga0105240_10004703
1113 Ga0105240_10680196
1114 Ga0105240_12089066
1115 Ga0111539_10181061
1116 Ga0105245_10020054
1117 Ga0105245_10335706
1118 Ga0105245_10424390
1119 Ga0105245_10540958
1120 Ga0105245_11251850
1121 Ga0105245_11684363
1122 Ga0105243_11528608
1123 Ga0105243_12515179
1124 Ga0105241_10027028
1125 Ga0105241_10299148
1126 Ga0105241_10362862
1127 Ga0105241_10566508
1128 Ga0105241_10684874
1129 Ga0105242_10042693
1130 Ga0105242_10268928
1131 Ga0105242_10292674
1132 Ga0105242_12926403
1133 Ga0105248_10003576
1134 Ga0105248_10076753
1135 Ga0105248_10232205
1136 Ga0105248_10281720
1137 Ga0105248_10374097
1138 Ga0105248_10604859
1139 Ga0105248_12745506
1140 Ga0105237_10800710
1141 Ga0105237_11173837
1142 Ga0105238_10078106
1143 Ga0105238_10127431
1144 Ga0105238_10709807
1145 Ga0105239_10395697
1146 Ga0105239_10745708
1147 Ga0105239_10776652
1148 Ga0105246_10007161
1149 Ga0105246_11130927
1150 Ga0105246_11465461
1151 Ga0105246_11580260
1152 Ga0105246_11755955
1153 Ga0157373_10029835
1154 Ga0157373_10047162
1155 Ga0157373_10255875
1156 Ga0157371_10008838
1157 Ga0157371_10016597
1158 Ga0157371_10044829
1159 Ga0157371_10404581
1160 Ga0157371_10416179
1161 Ga0157370_10001913
1162 Ga0157370_10002900
1163 Ga0157370_10066229
1164 Ga0157369_10009822
1165 Ga0157369_10096297
1166 Ga0157369_10188548
1167 Ga0157369_10298509
1168 Ga0157369_10391050
1169 Ga0157369_10501318
1170 Ga0157369_10546164
1171 Ga0157369_10717531
1172 Ga0157369_11324177
1173 Ga0157374_10109697
1174 Ga0157374_10143377
1175 Ga0157374_10241053
1176 Ga0157374_11014393
1177 Ga0157378_10285900
1178 Ga0157378_10554434
1179 Ga0157378_10824361
1180 Ga0163162_10269862
1181 Ga0163162_10518744
1182 Ga0163162_11397781
1183 Ga0157372_10002829
1184 Ga0157372_10013625
1185 Ga0157372_10014249
1186 Ga0157372_10018790
1187 Ga0157372_10046814
1188 Ga0157372_10053351
1189 Ga0157372_10072158
1190 Ga0157372_10150123
1191 Ga0157372_10195800
1192 Ga0157372_10584228
1193 Ga0157372_10825903
1194 Ga0157372_10942039
1195 Ga0157375_10067186
1196 Ga0157375_10151358
1197 Ga0157375_10273450
1198 Ga0157375_10609004
1199 Ga0157375_11088391
1200 Ga0157375_11102659
1201 Ga0163163_10020682
1202 Ga0157380_10975461
1203 Ga0157380_11050077
1204 Ga0157380_11323711
1205 Ga0182008_10031634
1206 Ga0182008_10305674
1207 Ga0157377_10000899
1208 Ga0157377_10104576
1209 Ga0157377_10554002
1210 Ga0157377_10783496
1211 Ga0157379_10462447
1212 Ga0157376_10003412
1213 Ga0157376_10181194
1214 Ga0157376_10303619
1215 Ga0182007_10141965
1216 Ga0182007_10271628
1217 Ga0182005_1121966
1218 Ga0163161_10264857
1219 Ga0163161_10384747
1220 Ga0206353_11992599
1221 Ga0213876_10014780
1222 Ga0207697_10009286
1223 Ga0207697_10027112
1224 Ga0207656_10039148
1225 Ga0207682_10013964
1226 Ga0207692_10291006
1227 Ga0207642_10512441
1228 Ga0207688_10353036
1229 Ga0207688_10374621
1230 Ga0207680_10102045
1231 Ga0207680_10198914
1232 Ga0207647_10171786
1233 Ga0207647_10407568
1234 Ga0207699_10035321
1235 Ga0207699_10045470
1236 Ga0207699_10267899
1237 Ga0207699_10891728
1238 Ga0207645_10056394
1239 Ga0207645_10094740
1240 Ga0207645_10144248
1241 Ga0207645_10230622
1242 Ga0207643_10009613
1243 Ga0207643_10014019
1244 Ga0207643_10086038
1245 Ga0207705_10005541
1246 Ga0207705_10008048
1247 Ga0207705_10011917
1248 Ga0207705_10088442
1249 Ga0207705_10156826
1250 Ga0207705_10259696
1251 Ga0207705_10466867
1252 Ga0207705_10729943
1253 Ga0207705_11105694
1254 Ga0207705_11139090
1255 Ga0207684_10279706
1256 Ga0207654_10117525
1257 Ga0207654_10370913
1258 Ga0207654_10630532
1259 Ga0207707_10003571
1260 Ga0207707_10011558
1261 Ga0207707_10015305
1262 Ga0207707_10102079
1263 Ga0207695_10022070
1264 Ga0207695_10046651
1265 Ga0207671_10742953
1266 Ga0207693_10007418
1267 Ga0207693_10051634
1268 Ga0207693_10414189
1269 Ga0207663_10552560
1270 Ga0207660_10023454
1271 Ga0207660_10031686
1272 Ga0207660_10050560
1273 Ga0207660_10096099
1274 Ga0207660_10353568
1275 Ga0207662_10004956
1276 Ga0207662_10026604
1277 Ga0207662_10342887
1278 Ga0207662_10601362
1279 Ga0207657_10003181
1280 Ga0207657_10127135
1281 Ga0207657_10803827
1282 Ga0207649_10002968
1283 Ga0207649_10158205
1284 Ga0207649_10170076
1285 Ga0207649_10412448
1286 Ga0207649_10448992
1287 Ga0207649_11450141
1288 Ga0207652_10004529
1289 Ga0207652_10010657
1290 Ga0207652_10045101
1291 Ga0207652_10050024
1292 Ga0207652_10149885
1293 Ga0207652_10192479
1294 Ga0207652_10277968
1295 Ga0207652_10313646
1296 Ga0207652_10509519
1297 Ga0207652_10700559
1298 Ga0207652_11255638
1299 Ga0207652_11825499
1300 Ga0207646_10031385
1301 Ga0207681_10328073
1302 Ga0207681_10852948
1303 Ga0207694_10054749
1304 Ga0207694_10461968
1305 Ga0207650_10080798
1306 Ga0207650_10181416
1307 Ga0207650_10268807
1308 Ga0207650_10340084
1309 Ga0207650_11616298
1310 Ga0207659_10027954
1311 Ga0207659_10090549
1312 Ga0207659_10239090
1313 Ga0207659_10793558
1314 Ga0207687_10019924
1315 Ga0207687_11924102
1316 Ga0207700_10000814
1317 Ga0207700_10013695
1318 Ga0207700_10019334
1319 Ga0207664_10002369
1320 Ga0207664_10031772
1321 Ga0207644_10042103
1322 Ga0207644_10059291
1323 Ga0207644_10304680
1324 Ga0207644_10403820
1325 Ga0207644_10643244
1326 Ga0207690_10022052
1327 Ga0207690_10065659
1328 Ga0207690_10344897
1329 Ga0207690_10543883
1330 Ga0207690_11130600
1331 Ga0207690_11404384
1332 Ga0207690_11666720
1333 Ga0207706_10088293
1334 Ga0207706_10148099
1335 Ga0207706_10155842
1336 Ga0207706_10291995
1337 Ga0207706_10551041
1338 Ga0207706_10952912
1339 Ga0207706_11532137
1340 Ga0207686_10100903
1341 Ga0207686_10203107
1342 Ga0207670_10119362
1343 Ga0207670_10213561
1344 Ga0207670_10218277
1345 Ga0207669_10330513
1346 Ga0207669_10718881
1347 Ga0207704_10008644
1348 Ga0207704_10521669
1349 Ga0207665_10556341
1350 Ga0207691_10025908
1351 Ga0207691_10066568
1352 Ga0207691_10089594
1353 Ga0207691_10108012
1354 Ga0207691_10186083
1355 Ga0207691_10228257
1356 Ga0207711_10018756
1357 Ga0207711_10259345
1358 Ga0207711_10695658
1359 Ga0207711_10748022
1360 Ga0207689_10000685
1361 Ga0207689_10035845
1362 Ga0207661_10002694
1363 Ga0207661_10004871
1364 Ga0207661_10015132
1365 Ga0207661_10021455
1366 Ga0207661_10044070
1367 Ga0207661_10147082
1368 Ga0207661_10159419
1369 Ga0207661_10232070
1370 Ga0207661_10253985
1371 Ga0207661_10373130
1372 Ga0207661_10442331
1373 Ga0207661_10467618
1374 Ga0207661_10997489
1375 Ga0207661_11181951
1376 Ga0207661_11251512
1377 Ga0207679_10001420
1378 Ga0207679_10025456
1379 Ga0207679_10054055
1380 Ga0207679_10085197
1381 Ga0207679_10187703
1382 Ga0207679_10313894
1383 Ga0207679_10439386
1384 Ga0207679_11146253
1385 Ga0207667_10095853
1386 Ga0207667_10857339
1387 Ga0207667_11299216
1388 Ga0207651_10712427
1389 Ga0207651_11476484
1390 Ga0207712_10456261
1391 Ga0207668_10265169
1392 Ga0207668_10467562
1393 Ga0207668_10915656
1394 Ga0207640_10732083
1395 Ga0207658_10136455
1396 Ga0207658_10331693
1397 Ga0207658_10786555
1398 Ga0207658_10852946
1399 Ga0207658_11774866
1400 Ga0207658_12132231
1401 Ga0207677_10009375
1402 Ga0207677_10715012
1403 Ga0207703_10011641
1404 Ga0207703_10200961
1405 Ga0207703_10760607
1406 Ga0207703_10941426
1407 Ga0207639_10136204
1408 Ga0207639_10179741
1409 Ga0207639_10404629
1410 Ga0207708_10083570
1411 Ga0207708_10397012
1412 Ga0207708_11346008
1413 Ga0207702_10010242
1414 Ga0207702_10220331
1415 Ga0207702_10305144
1416 Ga0207702_11159782
1417 Ga0207702_11885090
1418 Ga0207641_11336224
1419 Ga0207648_10015735
1420 Ga0207648_10247713
1421 Ga0207648_10674764
1422 Ga0207676_10034535
1423 Ga0207676_10144665
1424 Ga0207676_10392980
1425 Ga0207676_10726554
1426 Ga0207674_10000393
1427 Ga0207674_10022450
1428 Ga0207674_10090176
1429 Ga0207674_10105509
1430 Ga0207674_10136450
1431 Ga0207675_100334923
1432 Ga0207675_100531825
1433 Ga0207675_101917286
1434 Ga0207683_10636292
1435 Ga0207683_10759890
1436 Ga0207683_11082642
1437 Ga0207698_10061401
1438 Ga0207698_10085606
1439 Ga0207698_10125578
1440 Ga0207698_10370272
1441 Ga0207698_10584884
1442 Ga0207698_10663770
1443 Ga0207698_11902666
1444 Ga0268266_11028568
1445 Ga0268265_10293984
1446 Ga0268265_10504595
1447 Ga0268264_10024403
1448 Ga0268264_10333953
1449 Ga0268264_10497433
1450 Ga0307408_100293498
1451 Ga0307405_10624018
1452 Ga0307410_11154464
1453 Ga0307406_10301272
1454 Ga0307406_10587695
1455 Ga0307406_10842530
1456 Ga0307407_10398187
1457 Ga0307407_10556577
1458 Ga0307412_10221035
1459 Ga0307409_100281483
1460 Ga0307409_100444199
1461 Ga0307416_100352845
1462 Ga0307416_100564492
1463 Ga0307416_100899145
1464 Ga0307416_100900154
1465 Ga0307414_10323462
1466 Ga0307414_11162346
1467 Ga0307411_10883326
1468 Ga0307415_101057300
1469 Ga0307415_102464652
1470 Ga0373926_0133388
1471 Ga0373926_0178938
1472 Ga0373934_0090444
1473 Ga0373934_0370086
1474 Ga0373936_0020467
1475 Ga0373945_0466033
1476 Ga0373956_0351996
1477 Ga0373957_0036269
1478 Ga0373957_0229229
1479 Ga0373943_0301201
1480 Ga0373955_0000350
1481 Ga0373955_0010873
1482 Ga0373935_0243568
1483 Ga0373927_0008067
1484 Ga0373927_0219333
1485 Ga0373927_0226885
1486 Ga0373933_0009373
1487 Ga0373933_0849465
1488 Ga0373947_0042195
1489 Ga0373947_0061639
1490 Ga0373937_0000274
1491 Ga0373937_0022515
1492 Ga0373937_0054326
1493 Ga0373925_0025482
1494 Ga0373925_0302472
1495 Ga0395900_0344232
1496 Ga0395905_0475513
1497 Ga0436365_0172857
1498 Ga0436365_0575608
1499 Ga0436365_0989801
1500 Ga0436365_1873106
1501 Ga0451802_0501170
1502 Ga0451853_1550359
1503 Ga0466963_0414196
1504 Ga0466963_0527209
1505 Ga0466958_0291654
1506 Ga0466967_0036038
1507 Ga0466967_0057697
1508 Ga0466967_0365939
1509 Ga0466967_1973966
1510 Ga0495592_0132851
1511 Ga0495592_0141250
1512 Ga0495603_0474974
1513 Ga0495603_0568914
1514 Ga0495629_0024914
1515 Ga0495629_0529250
1516 Ga0495651_0237380
1517 Ga0495651_0395399
1518 Ga0495653_0012086
1519 Ga0495580_0002602
1520 Ga0495580_0031181
1521 Ga0495582_0124646
1522 Ga0495639_0008682
1523 Ga0495639_0157068
1524 Ga0495662_0178645
1525 Ga0495664_0619209
1526 Ga0495594_0031748
1527 Ga0495594_0067582
1528 Ga0495594_0132642
1529 Ga0495596_0028517
1530 Ga0495608_0502148
1531 Ga0495618_0164113
1532 Ga0495618_0421529
1533 Ga0495628_0211707
1534 Ga0495628_0220825
1535 Ga0495628_0324655
1536 Ga0495630_0058719
1537 Ga0495630_0131207
1538 Ga0495630_1097027
1539 Ga0495663_0190724
1540 Ga0495666_0097664
1541 Ga0495666_0419692
1542 Ga0495652_0002098
1543 Ga0495652_0087720
1544 Ga0495665_0010196
1545 Ga0495665_0096551
1546 Ga0495665_0144981
1547 Ga0495640_0186268
1548 Ga0495640_0625333
1549 Ga0495586_0069421
1550 Ga0495586_0102449
1551 Ga0495586_0392106
1552 Ga0495587_0000999
1553 Ga0495587_0016345
1554 Ga0495598_0086858
1555 Ga0495645_0000681
1556 Ga0495645_0000982
1557 Ga0495645_0039475
1558 Ga0495645_0094513
1559 Ga0495667_0006454
1560 Ga0495667_0058652
1561 Ga0495635_0156126
1562 Ga0495588_0584336
1563 Ga0495588_0625013
1564 Ga0495657_0017478
1565 Ga0495657_0049190
1566 Ga0495599_0000215
1567 Ga0495599_0176017
1568 Ga0495623_0000766
1569 Ga0495623_0011788
1570 Ga0495669_0523173
1571 Ga0495613_0156512
1572 Ga0495613_0258131
1573 Ga0495600_0041303
1574 Ga0495581_0009485
1575 Ga0495581_0250474
1576 Ga0495604_0192552
1577 Ga0495604_0362136
1578 Ga0495604_0805339
1579 Ga0495636_0075366
1580 Ga0495674_0106730
1581 Ga0495674_0183535
1582 Ga0495674_0199934
1583 Ga0495674_0449083
1584 Ga0495674_0685331
1585 Ga0495672_0027195
1586 Ga0495675_0188415
1587 Ga0495677_0275476
1588 Ga0495684_0028573
1589 Ga0495684_0076205
1590 Ga0495684_0562778
1591 Ga0495684_0567297
1592 Ga0495593_0071175
1593 Ga0495602_0196870
1594 Ga0495602_0360215
1595 Ga0496104_0027643
1596 Ga0496106_0278192
1597 Ga0496106_1518531
1598 Ga0496108_1443978
1599 Ga0496109_1500879
1600 Ga0496110_0106936
1601 Ga0496112_0013433
1602 Ga0496112_0647593
1603 Ga0496113_0013981
1604 Ga0501291_132702
1605 Ga0501032_0626409
1606 Ga0501033_0016742
1607 Ga0501033_1123280
1608 Ga0501034_0044876
1609 Ga0501034_0587330
1610 Ga0501034_0778215
1611 Ga0501036_0035291
1612 Ga0501036_0713488
1613 Ga0501038_0169952
1614 Ga0501038_0210468
1615 Ga0501039_0300620
1616 Ga0501043_0040326
1617 Ga0501043_0066449
1618 Ga0501047_0000707
1619 Ga0501047_0007362
1620 Ga0501070_0147127
1621 Ga0501070_0342210
1622 Ga0501073_0125214
1623 Ga0501217_083585
1624 Ga0501249_014338
1625 Ga0501283_017583
1626 Ga0501035_0057656
1627 Ga0501044_0010042
1628 Ga0501044_0233490
1629 Ga0501044_0348812
1630 nmdc:mga08y16_157080_c1
1631 nmdc:mga0n895_140177_c1
1632 nmdc:mga0n895_184878_c1
1633 nmdc:mga0rr50_593450_c1
1634 nmdc:mga08x19_35757_c1
1635 nmdc:mga08x19_455373_c1
1636 nmdc:mga08x19_554416_c1
1637 Ga0495601_0063822
1638 Ga0495601_0319827
1639 Ga0495601_0699352
1640 Ga0495612_0011585
1641 Ga0495612_0393790
1642 Ga0495595_0102954
1643 Ga0495595_0138319
1644 Ga0495595_0186841
1645 Ga0495619_0029584
1646 Ga0495619_0282060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

21

109

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8675 33 101
8a3v-assembly1.cif.gz_C crystal structure of the vibrio cholerae replicative helicase (vcdnab) in complex with its loader protein (vcdcia) 0.8387 35 101
5bw9-assembly2.cif.gz_k crystal structure of yeast v1-atpase in the autoinhibited form 0.7543 58 99
5bw9-assembly2.cif.gz_m crystal structure of yeast v1-atpase in the autoinhibited form 0.7528 58 102
5d80-assembly1.cif.gz_K crystal structure of yeast v1-atpase in the autoinhibited form 0.7453 58 99
ID Description Score Start End Superfamily
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.9086 33 97 3.30.300.180
4dl0J02 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8025 58 99 3.30.2320.30
4tpsB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7314 33 101 3.30.300.180
2wp0C00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7304 35 102 3.30.300.180
2jmpA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7238 54 100 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2G4IFK7-F1-model_v4 DUF721 domain-containing protein 0.9539 33 102
AF-K1ZU76-F1-model_v4 DUF721 domain-containing protein 0.9495 35 103
AF-A0A644SVS9-F1-model_v4 DUF721 domain-containing protein 0.9489 34 101
AF-A0A7V3SSG9-F1-model_v4 DUF721 domain-containing protein 0.9486 33 102
AF-A0A357ZKX5-F1-model_v4 DUF721 domain-containing protein 0.9483 35 100

Map