F481661

General Info

Members Datasets Scaffolds Average Seq Length
806 371 667 104

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0104141|Ga0495626_0104141_427_756
Length 90
Sequence MKKLCCVMAGCAVWAMLPLTAFAYPIDVQKQLNGLSIDYNSYDTDNDIASGPESPRTRTIEVPAGKHKNATAKFTRTIIKMRINLTCTPK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231021 Pseudomonas sp. GM78 Isolate Nodule
12 2511231022 Pseudomonas sp. GM79 Isolate Nodule
13 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
14 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
15 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
16 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
17 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
18 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
19 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
20 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
21 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
22 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
23 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
24 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
25 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
26 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
27 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
28 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
29 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
30 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
31 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
32 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
33 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
34 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
35 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
36 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
37 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
38 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
39 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
40 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
41 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
42 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
43 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
44 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
45 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
46 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
47 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
48 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
49 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
50 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
51 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
52 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
53 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
54 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
55 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
56 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
57 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
58 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
59 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
60 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
61 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
62 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
63 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
64 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
65 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
66 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
67 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
68 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
69 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
70 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
71 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
72 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
73 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
74 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
75 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
76 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
77 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
78 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
79 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
80 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
81 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
82 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
83 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
84 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
85 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
86 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
87 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
88 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
89 2773857670 Pseudomonas sp. 478 Isolate Unclassified
90 2784132072 Pseudomonas sp. 460 Isolate Unclassified
91 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
92 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
93 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
94 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
95 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
96 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
97 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
98 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
99 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
100 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
101 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
102 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
103 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
104 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
105 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
106 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
107 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
108 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
109 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
110 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
111 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
112 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
113 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
114 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
115 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
116 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
117 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
118 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
119 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
120 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
121 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
122 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
123 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
124 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
125 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
126 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
127 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
128 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
129 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
130 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
131 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
132 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
133 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
134 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
135 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
136 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
137 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
138 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
139 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
140 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
141 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
142 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
143 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
144 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
145 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
146 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
147 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
148 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
149 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
150 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
151 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
152 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
153 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
156 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
159 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
160 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
161 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
162 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
163 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
164 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
165 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
166 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
167 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
168 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
172 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
176 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
177 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
181 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
182 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
183 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
184 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
187 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
195 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
197 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
199 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
200 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
229 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
230 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
231 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
232 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
233 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
234 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
235 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
236 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
237 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
241 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
242 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
243 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
244 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
245 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
246 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
247 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
248 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
249 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
252 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
255 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
256 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
257 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
316 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
326 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
327 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
328 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
356 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
359 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
360 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
361 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
362 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
363 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
364 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
365 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
366 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
367 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
368 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
369 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
370 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
371 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.75
Metatranscriptomes 0
Isolates 17.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 1.36
Rhizoplane 8.44
Rhizosphere 74.57
Stem 0
Stem Tuber 0
Unclassified 8.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_10106 2124908027 Bacteria 1591
2 MRS2a_Contig_1664 2124908027 Bacteria 13132
3 MRS2a_Contig_6915 2124908027 Bacteria 5292
4 SwRhRL2b_contig_2924427 2162886007 Bacteria 4021
5 MRS1b_contig_7707250 2162886011 Bacteria 1189
6 JGI25162J39368_1015835 3300002737 Bacteria 771
7 JGI25154J39366_1005442 3300002738 Bacteria 2028
8 JGI25163J39215_1000366 3300002771 Bacteria 14567
9 JGI25163J39215_1001531 3300002771 Bacteria 3602
10 JGI25164J39214_1000063 3300002772 Bacteria 107722
11 JGI25164J39214_1000079 3300002772 Bacteria 94568
12 JGI25165J46597_1000160 3300003214 Bacteria 107722
13 JGI25165J46597_1000183 3300003214 Bacteria 94568
14 Ga0055538_1000027 3300003751 Bacteria 216576
15 Ga0055539_1000036 3300003752 Bacteria 216576
16 Ga0055533_1000046 3300003756 Bacteria 216576
17 Ga0055532_1000032 3300003758 Bacteria 216568
18 Ga0055525_1000217 3300003759 Bacteria 62978
19 Ga0055535_1014231 3300003761 Bacteria 1150
20 Ga0055536_1006303 3300003781 Bacteria 5579
21 Ga0055530_10000290 3300003791 Bacteria 45698
22 Ga0055530_10004655 3300003791 Bacteria 6963
23 Ga0055540_1000154 3300003792 Bacteria 67934
24 Ga0055540_1000170 3300003792 Bacteria 64696
25 Ga0055540_1003288 3300003792 Bacteria 7899
26 Ga0055531_10002229 3300003794 Bacteria 13141
27 Ga0055541_1000024 3300003841 Bacteria 216576
28 Ga0065714_10000154 3300005288 Bacteria 8636
29 Ga0065714_10020074 3300005288 Bacteria 2236
30 Ga0065714_10023033 3300005288 Bacteria 1551
31 Ga0065714_10065134 3300005288 Bacteria 12629
32 Ga0065714_10068680 3300005288 Bacteria 4594
33 Ga0065704_10040973 3300005289 Bacteria 1042
34 Ga0065704_10070997 3300005289 Bacteria 13885
35 Ga0065704_10167317 3300005289 Bacteria 1314
36 Ga0065704_10207651 3300005289 Bacteria 1121
37 Ga0065704_10396985 3300005289 Bacteria 756
38 Ga0065704_10648698 3300005289 Bacteria 584
39 Ga0065712_10001605 3300005290 Bacteria 8045
40 Ga0065712_10068472 3300005290 Bacteria 10419
41 Ga0065715_10017988 3300005293 Bacteria 2458
42 Ga0070670_100027090 3300005331 Bacteria 4929
43 Ga0070661_100000008 3300005344 Bacteria 183494
44 Ga0070661_100369497 3300005344 Bacteria 1129
45 Ga0070669_100000579 3300005353 Bacteria 27197
46 Ga0070669_100028154 3300005353 Bacteria 4046
47 Ga0070662_100000388 3300005457 Bacteria 26210
48 Ga0068853_100006303 3300005539 Bacteria 9414
49 Ga0070665_100256142 3300005548 Bacteria 1751
50 Ga0070664_100000028 3300005564 Bacteria 90414
51 Ga0068854_100008255 3300005578 Bacteria 6685
52 Ga0068851_10000068 3300005834 Bacteria 58513
53 Ga0075364_10087742 3300006051 Bacteria 2062
54 Ga0075432_10004774 3300006058 Bacteria 4613
55 Ga0075432_10078700 3300006058 Bacteria 1192
56 Ga0075362_10382871 3300006177 Bacteria 708
57 Ga0075370_10569475 3300006353 Bacteria 685
58 Ga0075436_100060400 3300006914 Bacteria 2618
59 Ga0099826_10003010 3300006948 Bacteria 11222
60 Ga0105251_10002022 3300009011 Bacteria 16464
61 Ga0105251_10002641 3300009011 Bacteria 13820
62 Ga0105251_10003114 3300009011 Bacteria 12313
63 Ga0105251_10014246 3300009011 Bacteria 4409
64 Ga0105251_10363526 3300009011 Bacteria 661
65 Ga0105244_10008428 3300009036 Bacteria 6436
66 Ga0105244_10017545 3300009036 Bacteria 4041
67 Ga0105244_10041907 3300009036 Bacteria 2370
68 Ga0105244_10050877 3300009036 Bacteria 2113
69 Ga0105244_10064133 3300009036 Bacteria 1844
70 Ga0105244_10110223 3300009036 Bacteria 1340
71 Ga0105244_10238250 3300009036 Bacteria 850
72 Ga0105250_10000180 3300009092 Bacteria 54634
73 Ga0105250_10006310 3300009092 Bacteria 5194
74 Ga0105250_10012243 3300009092 Bacteria 3544
75 Ga0105250_10045681 3300009092 Bacteria 1756
76 Ga0105250_10345502 3300009092 Bacteria 651
77 Ga0105243_10003185 3300009148 Bacteria 13442
78 Ga0105243_10336255 3300009148 Bacteria 1381
79 Ga0105243_12401103 3300009148 Bacteria 566
80 Ga0105242_10000024 3300009176 Bacteria 111115
81 Ga0105242_10235029 3300009176 Bacteria 1645
82 Ga0105242_11722316 3300009176 Bacteria 663
83 Ga0105248_11594749 3300009177 Bacteria 739
84 Ga0105237_10009518 3300009545 Bacteria 10405
85 Ga0105246_10299617 3300011119 Bacteria 1297
86 Ga0105246_10413736 3300011119 Bacteria 1123
87 Ga0157373_10020946 3300013100 Bacteria 4746
88 Ga0157373_10033013 3300013100 Bacteria 3726
89 Ga0157373_10147983 3300013100 Bacteria 1652
90 Ga0157373_10242726 3300013100 Bacteria 1273
91 Ga0157371_10000583 3300013102 Bacteria 43268
92 Ga0157371_10002025 3300013102 Bacteria 20017
93 Ga0157371_10186156 3300013102 Bacteria 1486
94 Ga0157370_10065957 3300013104 Bacteria 3425
95 Ga0157370_10159130 3300013104 Bacteria 2102
96 Ga0157370_10224510 3300013104 Bacteria 1739
97 Ga0157370_10246199 3300013104 Bacteria 1654
98 Ga0157370_10499983 3300013104 Bacteria 1116
99 Ga0157370_10612309 3300013104 Bacteria 997
100 Ga0157369_10033322 3300013105 Bacteria 5661
101 Ga0157369_10035296 3300013105 Bacteria 5484
102 Ga0157369_10081843 3300013105 Bacteria 3455
103 Ga0157369_10197862 3300013105 Bacteria 2110
104 Ga0157369_11637446 3300013105 Bacteria 654
105 Ga0157369_12052977 3300013105 Bacteria 580
106 Ga0163162_10535938 3300013306 Bacteria 1299
107 Ga0157375_10002948 3300013308 Bacteria 14762
108 Ga0157375_12011657 3300013308 Bacteria 687
109 Ga0182008_10002054 3300014497 Bacteria 12897
110 Ga0182008_10014590 3300014497 Bacteria 4110
111 Ga0182008_10056010 3300014497 Bacteria 1949
112 Ga0182008_10060932 3300014497 Bacteria 1860
113 Ga0182008_10160961 3300014497 Bacteria 1130
114 Ga0182008_10631497 3300014497 Bacteria 604
115 Ga0182006_1000997 3300015261 Bacteria 18524
116 Ga0182006_1002709 3300015261 Bacteria 9498
117 Ga0182006_1026510 3300015261 Bacteria 2371
118 Ga0182006_1080277 3300015261 Bacteria 1191
119 Ga0182006_1139013 3300015261 Bacteria 831
120 Ga0182007_10000143 3300015262 Bacteria 47807
121 Ga0182007_10007681 3300015262 Bacteria 4491
122 Ga0182007_10052755 3300015262 Bacteria 1340
123 Ga0182007_10221388 3300015262 Bacteria 669
124 Ga0182005_1000800 3300015265 Bacteria 14334
125 Ga0182005_1009477 3300015265 Bacteria 2833
126 Ga0182005_1022669 3300015265 Bacteria 1720
127 Ga0163161_10002276 3300017792 Bacteria 13770
128 Ga0163161_10136684 3300017792 Bacteria 1853
129 Ga0163161_10140145 3300017792 Bacteria 1831
130 Ga0163161_10186087 3300017792 Bacteria 1594
131 Ga0163161_11084854 3300017792 Bacteria 687
132 Ga0163161_11141615 3300017792 Bacteria 671
133 Ga0163161_11826786 3300017792 Bacteria 541
134 Ga0209435_101319 3300025206 Bacteria 3233
135 Ga0209760_100039 3300025207 Bacteria 118977
136 Ga0209760_100052 3300025207 Bacteria 103453
137 Ga0209784_100017 3300025224 Bacteria 472003
138 Ga0209566_100014 3300025225 Bacteria 472003
139 Ga0209674_100028 3300025226 Bacteria 472003
140 Ga0209147_100038 3300025229 Bacteria 314497
141 Ga0209563_100032 3300025230 Bacteria 472003
142 Ga0207427_100001 3300025231 Bacteria 1410763
143 Ga0207427_100029 3300025231 Bacteria 376678
144 Ga0209437_100003 3300025233 Bacteria 1517827
145 Ga0209437_100009 3300025233 Bacteria 915954
146 Ga0209437_111489 3300025233 Bacteria 1320
147 Ga0209258_100197 3300025242 Bacteria 124028
148 Ga0209646_1000171 3300025246 Bacteria 84951
149 Ga0209677_100018 3300025253 Bacteria 472003
150 Ga0209759_1004504 3300025256 Bacteria 5171
151 Ga0209759_1016938 3300025256 Bacteria 1816
152 Ga0209233_1000007 3300025261 Bacteria 1411234
153 Ga0209233_1000032 3300025261 Bacteria 623596
154 Ga0209130_1059935 3300025284 Bacteria 663
155 Ga0209675_1006112 3300025291 Bacteria 4902
156 Ga0209676_1000016 3300025292 Bacteria 655561
157 Ga0209676_1000021 3300025292 Bacteria 609534
158 Ga0209676_1002055 3300025292 Bacteria 15733
159 Ga0209050_1000009 3300025298 Bacteria 1047265
160 Ga0209050_1000036 3300025298 Bacteria 423070
161 Ga0209050_1000107 3300025298 Bacteria 223303
162 Ga0209051_1000043 3300025303 Bacteria 305473
163 Ga0209051_1000053 3300025303 Bacteria 281564
164 Ga0209051_1000090 3300025303 Bacteria 173748
165 Ga0209257_1000098 3300025304 Bacteria 256390
166 Ga0209257_1008639 3300025304 Bacteria 5714
167 Ga0207656_10000089 3300025321 Bacteria 33748
168 Ga0207696_1000043 3300025711 Bacteria 307112
169 Ga0207696_1002643 3300025711 Bacteria 8642
170 Ga0207696_1026435 3300025711 Bacteria 1796
171 Ga0207696_1026570 3300025711 Bacteria 1790
172 Ga0207655_1000019 3300025728 Bacteria 536324
173 Ga0207655_1000095 3300025728 Bacteria 195899
174 Ga0207655_1002702 3300025728 Bacteria 13908
175 Ga0207655_1008299 3300025728 Bacteria 6610
176 Ga0207655_1008712 3300025728 Bacteria 6396
177 Ga0207655_1017325 3300025728 Bacteria 3891
178 Ga0207655_1027292 3300025728 Bacteria 2722
179 Ga0207655_1046303 3300025728 Bacteria 1808
180 Ga0207655_1079087 3300025728 Bacteria 1193
181 Ga0207713_1000074 3300025735 Bacteria 181376
182 Ga0207713_1001420 3300025735 Bacteria 19190
183 Ga0207713_1002370 3300025735 Bacteria 13776
184 Ga0207713_1006104 3300025735 Bacteria 7417
185 Ga0207713_1010738 3300025735 Bacteria 5044
186 Ga0207713_1012423 3300025735 Bacteria 4554
187 Ga0207713_1019354 3300025735 Bacteria 3332
188 Ga0207713_1034284 3300025735 Bacteria 2207
189 Ga0207713_1068597 3300025735 Bacteria 1318
190 Ga0207671_10000035 3300025914 Bacteria 237603
191 Ga0207649_10000017 3300025920 Bacteria 225193
192 Ga0207649_11439356 3300025920 Bacteria 545
193 Ga0207681_10000835 3300025923 Bacteria 20332
194 Ga0207681_10013345 3300025923 Bacteria 5083
195 Ga0207650_10000212 3300025925 Bacteria 66326
196 Ga0207650_10000523 3300025925 Bacteria 31492
197 Ga0207706_10000170 3300025933 Bacteria 72208
198 Ga0207686_10007499 3300025934 Bacteria 5872
199 Ga0207709_10000350 3300025935 Bacteria 47371
200 Ga0207709_10006666 3300025935 Bacteria 6476
201 Ga0207709_10229357 3300025935 Bacteria 1344
202 Ga0207709_11093380 3300025935 Bacteria 654
203 Ga0207679_10000005 3300025945 Bacteria 525011
204 Ga0207679_10542313 3300025945 Bacteria 1043
205 Ga0207640_10048783 3300025981 Bacteria 2739
206 Ga0207639_10004921 3300026041 Bacteria 9000
207 Ga0209281_1000172 3300027111 Bacteria 151766
208 Ga0207428_10057479 3300027907 Bacteria 3088
209 Ga0207428_10901267 3300027907 Bacteria 625
210 Ga0268266_10274780 3300028379 Bacteria 1565
211 Ga0307511_10283210 3300030521 Bacteria 764
212 Ga0316183_1163758 3300030742 Bacteria 1300
213 Ga0316181_1279414 3300030744 Bacteria 854
214 Ga0307408_100056205 3300031548 Bacteria 2853
215 Ga0307405_10800603 3300031731 Bacteria 789
216 Ga0439438_009782 3300041405 Bacteria 3081
217 Ga0439438_084008 3300041405 Bacteria 779
218 Ga0439447_001766 3300041407 Bacteria 7931
219 Ga0439447_003235 3300041407 Bacteria 5796
220 Ga0439447_003697 3300041407 Bacteria 5391
221 Ga0439447_090159 3300041407 Bacteria 705
222 Ga0439447_109049 3300041407 Bacteria 635
223 Ga0439447_113842 3300041407 Bacteria 620
224 Ga0439461_0086090 3300041410 Bacteria 748
225 Ga0439466_0002264 3300041411 Bacteria 7546
226 Ga0439466_0006877 3300041411 Bacteria 4310
227 Ga0439466_0010705 3300041411 Bacteria 3406
228 Ga0439466_0020025 3300041411 Bacteria 2389
229 Ga0439466_0022888 3300041411 Bacteria 2201
230 Ga0439466_0042697 3300041411 Bacteria 1508
231 Ga0439466_0099089 3300041411 Bacteria 909
232 Ga0439466_0135015 3300041411 Bacteria 758
233 Ga0439465_0074314 3300041413 Bacteria 1143
234 Ga0439465_0158480 3300041413 Bacteria 811
235 Ga0451797_0097127 3300041453 Bacteria 970
236 Ga0439445_0176733 3300042004 Bacteria 626
237 Ga0439432_005074 3300042006 Bacteria 4763
238 Ga0439432_014291 3300042006 Bacteria 2689
239 Ga0439432_025028 3300042006 Bacteria 1959
240 Ga0439432_231131 3300042006 Bacteria 532
241 Ga0439451_002994 3300042009 Bacteria 3433
242 Ga0439451_008359 3300042009 Bacteria 2099
243 Ga0439451_011330 3300042009 Bacteria 1799
244 Ga0439451_084079 3300042009 Bacteria 640
245 Ga0439452_000582 3300042010 Bacteria 18963
246 Ga0439452_011461 3300042010 Bacteria 2545
247 Ga0439452_014076 3300042010 Bacteria 2230
248 Ga0439452_018564 3300042010 Bacteria 1850
249 Ga0439452_024253 3300042010 Bacteria 1552
250 Ga0439452_036058 3300042010 Bacteria 1186
251 Ga0439452_051835 3300042010 Bacteria 937
252 Ga0439456_000990 3300042013 Bacteria 5658
253 Ga0439456_037681 3300042013 Bacteria 1044
254 Ga0439456_048341 3300042013 Bacteria 928
255 Ga0439456_070309 3300042013 Bacteria 775
256 Ga0439456_109499 3300042013 Bacteria 628
257 Ga0439456_131085 3300042013 Bacteria 578
258 Ga0439463_000601 3300042016 Bacteria 9989
259 Ga0439463_011039 3300042016 Bacteria 2219
260 Ga0439463_013760 3300042016 Bacteria 1993
261 Ga0439463_054724 3300042016 Bacteria 1018
262 Ga0450911_002562 3300042115 Bacteria 3515
263 Ga0450911_044788 3300042115 Bacteria 575
264 Ga0450919_004619 3300042121 Bacteria 1679
265 Ga0450922_005014 3300042124 Bacteria 1222
266 Ga0450890_009068 3300042127 Bacteria 1271
267 Ga0450902_002174 3300042137 Bacteria 2758
268 Ga0450902_010414 3300042137 Bacteria 1470
269 Ga0450902_077484 3300042137 Bacteria 583
270 Ga0450903_001202 3300042138 Bacteria 4864
271 Ga0450903_020477 3300042138 Bacteria 1023
272 Ga0450903_027105 3300042138 Bacteria 872
273 Ga0450904_002418 3300042139 Bacteria 2230
274 Ga0450905_024260 3300042142 Bacteria 908
275 Ga0450905_037567 3300042142 Bacteria 762
276 Ga0450906_001016 3300042145 Bacteria 6162
277 Ga0450907_000132 3300042146 Bacteria 28311
278 Ga0450907_002284 3300042146 Bacteria 3713
279 Ga0439446_0048341 3300042156 Bacteria 1266
280 Ga0439446_0095575 3300042156 Bacteria 934
281 Ga0439446_0241075 3300042156 Bacteria 621
282 Ga0450908_010073 3300042184 Bacteria 1748
283 Ga0450909_000513 3300042185 Bacteria 5056
284 Ga0450909_006435 3300042185 Bacteria 1693
285 Ga0439434_0013971 3300042435 Bacteria 2386
286 Ga0439434_0050199 3300042435 Bacteria 1292
287 Ga0439464_0091114 3300042439 Bacteria 919
288 Ga0439460_0010100 3300042461 Bacteria 2407
289 Ga0439460_0027126 3300042461 Bacteria 1606
290 Ga0439460_0080341 3300042461 Bacteria 1022
291 Ga0450918_024898 3300042531 Bacteria 1047
292 Ga0439440_0001741 3300042993 Bacteria 4006
293 Ga0439440_0069006 3300042993 Bacteria 916
294 Ga0495617_000283 3300046452 Bacteria 29261
295 Ga0495617_023079 3300046452 Bacteria 2102
296 Ga0495617_024862 3300046452 Bacteria 2020
297 Ga0495617_078830 3300046452 Bacteria 1079
298 Ga0495617_213311 3300046452 Bacteria 601
299 Ga0495627_000340 3300046453 Bacteria 44106
300 Ga0495627_000446 3300046453 Bacteria 35973
301 Ga0495627_013960 3300046453 Bacteria 2816
302 Ga0495627_186548 3300046453 Bacteria 573
303 Ga0495603_0025607 3300046455 Bacteria 3567
304 Ga0495590_0009335 3300046457 Bacteria 3720
305 Ga0495590_0011489 3300046457 Bacteria 3309
306 Ga0495590_0081300 3300046457 Bacteria 1141
307 Ga0495590_0216688 3300046457 Bacteria 706
308 Ga0495591_000035 3300046458 Bacteria 169656
309 Ga0495591_000232 3300046458 Bacteria 54458
310 Ga0495591_000986 3300046458 Bacteria 19402
311 Ga0495591_001326 3300046458 Bacteria 15570
312 Ga0495591_005652 3300046458 Bacteria 5727
313 Ga0495591_012224 3300046458 Bacteria 3207
314 Ga0495591_074373 3300046458 Bacteria 876
315 Ga0495629_0357187 3300046459 Bacteria 996
316 Ga0495629_1132748 3300046459 Bacteria 505
317 Ga0495638_0001986 3300046460 Bacteria 17445
318 Ga0495638_0010520 3300046460 Bacteria 6414
319 Ga0495638_0129407 3300046460 Bacteria 1484
320 Ga0495638_0185583 3300046460 Bacteria 1183
321 Ga0495638_0356741 3300046460 Bacteria 770
322 Ga0495653_0026039 3300046463 Bacteria 4694
323 Ga0495653_0032917 3300046463 Bacteria 4111
324 Ga0495653_0058819 3300046463 Bacteria 2920
325 Ga0495650_0006115 3300046471 Bacteria 7578
326 Ga0495650_0016401 3300046471 Bacteria 3754
327 Ga0495650_0046129 3300046471 Bacteria 1830
328 Ga0495650_0173027 3300046471 Bacteria 763
329 Ga0495582_0040074 3300046473 Bacteria 2579
330 Ga0495605_0000370 3300046474 Bacteria 42514
331 Ga0495605_0000628 3300046474 Bacteria 27249
332 Ga0495605_0007286 3300046474 Bacteria 6283
333 Ga0495605_0016393 3300046474 Bacteria 4010
334 Ga0495605_0037777 3300046474 Bacteria 2426
335 Ga0495605_0041805 3300046474 Bacteria 2281
336 Ga0495605_0114063 3300046474 Bacteria 1230
337 Ga0495605_0215535 3300046474 Bacteria 831
338 Ga0495605_0469644 3300046474 Bacteria 516
339 Ga0495639_0000084 3300046475 Bacteria 44796
340 Ga0495639_0159695 3300046475 Bacteria 1090
341 Ga0495664_0807262 3300046477 Bacteria 551
342 Ga0495584_0005429 3300046491 Bacteria 6753
343 Ga0495584_0012423 3300046491 Bacteria 4346
344 Ga0495584_0032787 3300046491 Bacteria 2628
345 Ga0495584_0039580 3300046491 Bacteria 2381
346 Ga0495584_0055656 3300046491 Bacteria 1990
347 Ga0495584_0063564 3300046491 Bacteria 1856
348 Ga0495584_0311381 3300046491 Bacteria 799
349 Ga0495585_0000376 3300046492 Bacteria 42971
350 Ga0495585_0018706 3300046492 Bacteria 3995
351 Ga0495585_0021969 3300046492 Bacteria 3662
352 Ga0495585_0077018 3300046492 Bacteria 1811
353 Ga0495585_0408694 3300046492 Bacteria 653
354 Ga0495594_0104837 3300046499 Bacteria 1592
355 Ga0495594_0154599 3300046499 Bacteria 1302
356 Ga0495594_0290023 3300046499 Bacteria 932
357 Ga0495596_0000004 3300046500 Bacteria 163832
358 Ga0495607_0000184 3300046501 Bacteria 66826
359 Ga0495607_0000286 3300046501 Bacteria 53993
360 Ga0495607_0000411 3300046501 Bacteria 43380
361 Ga0495607_0001055 3300046501 Bacteria 25165
362 Ga0495607_0001301 3300046501 Bacteria 22260
363 Ga0495607_0001813 3300046501 Bacteria 18229
364 Ga0495607_0007276 3300046501 Bacteria 7678
365 Ga0495607_0034522 3300046501 Bacteria 3067
366 Ga0495607_0056581 3300046501 Bacteria 2251
367 Ga0495607_0402421 3300046501 Bacteria 622
368 Ga0495607_0560651 3300046501 Bacteria 500
369 Ga0495583_0000400 3300046506 Bacteria 65891
370 Ga0495583_0001166 3300046506 Bacteria 28539
371 Ga0495583_0001375 3300046506 Bacteria 24981
372 Ga0495583_0007196 3300046506 Bacteria 7064
373 Ga0495583_0014402 3300046506 Bacteria 4367
374 Ga0495583_0018442 3300046506 Bacteria 3673
375 Ga0495583_0069769 3300046506 Bacteria 1547
376 Ga0495583_0214417 3300046506 Bacteria 779
377 Ga0495583_0424385 3300046506 Bacteria 521
378 Ga0495606_0000734 3300046507 Bacteria 50680
379 Ga0495606_0001108 3300046507 Bacteria 38521
380 Ga0495606_0006795 3300046507 Bacteria 10455
381 Ga0495606_0039906 3300046507 Bacteria 3158
382 Ga0495606_0044304 3300046507 Bacteria 2960
383 Ga0495606_0054465 3300046507 Bacteria 2590
384 Ga0495610_0005269 3300046512 Bacteria 9252
385 Ga0495610_0017313 3300046512 Bacteria 4113
386 Ga0495616_0004893 3300046513 Bacteria 8373
387 Ga0495616_0010172 3300046513 Bacteria 5458
388 Ga0495616_0031338 3300046513 Bacteria 2784
389 Ga0495616_0044286 3300046513 Bacteria 2257
390 Ga0495616_0082912 3300046513 Bacteria 1530
391 Ga0495616_0227543 3300046513 Bacteria 809
392 Ga0495616_0313887 3300046513 Bacteria 659
393 Ga0495616_0440192 3300046513 Bacteria 529
394 Ga0495620_0001622 3300046515 Bacteria 13321
395 Ga0495620_0006029 3300046515 Bacteria 6709
396 Ga0495620_0044330 3300046515 Bacteria 1933
397 Ga0495628_0266588 3300046516 Bacteria 1275
398 Ga0495628_0436599 3300046516 Bacteria 952
399 Ga0495630_0010657 3300046517 Bacteria 6636
400 Ga0495630_0088621 3300046517 Bacteria 2337
401 Ga0495630_0477805 3300046517 Bacteria 955
402 Ga0495631_0023657 3300046518 Bacteria 2845
403 Ga0495631_0077634 3300046518 Bacteria 1433
404 Ga0495631_0254971 3300046518 Bacteria 748
405 Ga0495631_0258166 3300046518 Bacteria 742
406 Ga0495631_0298282 3300046518 Bacteria 686
407 Ga0495632_0002918 3300046519 Bacteria 12545
408 Ga0495632_0008695 3300046519 Bacteria 6196
409 Ga0495632_0009837 3300046519 Bacteria 5720
410 Ga0495632_0013150 3300046519 Bacteria 4739
411 Ga0495632_0015828 3300046519 Bacteria 4214
412 Ga0495632_0017903 3300046519 Bacteria 3898
413 Ga0495632_0032172 3300046519 Bacteria 2705
414 Ga0495632_0397041 3300046519 Bacteria 602
415 Ga0495637_0000502 3300046520 Bacteria 28367
416 Ga0495637_0002386 3300046520 Bacteria 10398
417 Ga0495637_0010753 3300046520 Bacteria 4414
418 Ga0495637_0030939 3300046520 Bacteria 2370
419 Ga0495637_0050635 3300046520 Bacteria 1741
420 Ga0495637_0061032 3300046520 Bacteria 1546
421 Ga0495637_0320419 3300046520 Bacteria 547
422 Ga0495643_0026814 3300046522 Bacteria 3245
423 Ga0495643_0036467 3300046522 Bacteria 2700
424 Ga0495643_0036825 3300046522 Bacteria 2686
425 Ga0495644_0000068 3300046523 Bacteria 51396
426 Ga0495644_0009554 3300046523 Bacteria 3737
427 Ga0495644_0023019 3300046523 Bacteria 2372
428 Ga0495644_0089653 3300046523 Bacteria 1160
429 Ga0495648_0002092 3300046524 Bacteria 18846
430 Ga0495648_0003351 3300046524 Bacteria 14122
431 Ga0495648_0025416 3300046524 Bacteria 4009
432 Ga0495648_0129249 3300046524 Bacteria 1345
433 Ga0495666_0047281 3300046526 Bacteria 2072
434 Ga0495666_0169097 3300046526 Bacteria 1011
435 Ga0495642_0002345 3300046528 Bacteria 7717
436 Ga0495642_0009699 3300046528 Bacteria 3684
437 Ga0495654_0002674 3300046530 Bacteria 11290
438 Ga0495654_0012299 3300046530 Bacteria 4599
439 Ga0495654_0028757 3300046530 Bacteria 2839
440 Ga0495654_0040445 3300046530 Bacteria 2323
441 Ga0495654_0067556 3300046530 Bacteria 1702
442 Ga0495654_0079310 3300046530 Bacteria 1542
443 Ga0495654_0115183 3300046530 Bacteria 1222
444 Ga0495654_0149656 3300046530 Bacteria 1033
445 Ga0495586_0207473 3300046535 Bacteria 1111
446 Ga0495587_0008713 3300046536 Bacteria 6511
447 Ga0495609_0002689 3300046538 Bacteria 10736
448 Ga0495609_0018340 3300046538 Bacteria 3241
449 Ga0495609_0019791 3300046538 Bacteria 3112
450 Ga0495597_0000085 3300046542 Bacteria 82014
451 Ga0495597_0010895 3300046542 Bacteria 4423
452 Ga0495597_0014602 3300046542 Bacteria 3736
453 Ga0495597_0014906 3300046542 Bacteria 3693
454 Ga0495597_0017284 3300046542 Bacteria 3397
455 Ga0495597_0095649 3300046542 Bacteria 1256
456 Ga0495597_0129245 3300046542 Bacteria 1048
457 Ga0495597_0206676 3300046542 Bacteria 784
458 Ga0495597_0214904 3300046542 Bacteria 765
459 Ga0495645_0845209 3300046543 Bacteria 546
460 Ga0495622_0002066 3300046557 Bacteria 9810
461 Ga0495622_0154187 3300046557 Bacteria 1038
462 Ga0495622_0236312 3300046557 Bacteria 806
463 Ga0495633_0074535 3300046558 Bacteria 1581
464 Ga0495633_0090448 3300046558 Bacteria 1423
465 Ga0495633_0229742 3300046558 Bacteria 848
466 Ga0495656_0000205 3300046615 Bacteria 21121
467 Ga0495668_0000159 3300046616 Bacteria 102319
468 Ga0495668_0057350 3300046616 Bacteria 2149
469 Ga0495668_0180826 3300046616 Bacteria 1155
470 Ga0495634_0153879 3300046642 Bacteria 1452
471 Ga0495634_0821460 3300046642 Bacteria 529
472 Ga0495611_0005498 3300046648 Bacteria 5414
473 Ga0495611_0009491 3300046648 Bacteria 4112
474 Ga0495611_0199603 3300046648 Bacteria 933
475 Ga0495611_0306625 3300046648 Bacteria 731
476 Ga0495611_0395362 3300046648 Bacteria 632
477 Ga0495611_0423622 3300046648 Bacteria 607
478 Ga0495625_0084712 3300046660 Bacteria 2201
479 Ga0495625_0312970 3300046660 Bacteria 1001
480 Ga0495625_0492791 3300046660 Bacteria 750
481 Ga0495635_0002278 3300046663 Bacteria 13049
482 Ga0495659_0000670 3300046664 Bacteria 12420
483 Ga0495661_0000773 3300046665 Bacteria 30663
484 Ga0495661_0000847 3300046665 Bacteria 28480
485 Ga0495661_0011480 3300046665 Bacteria 6010
486 Ga0495661_0022298 3300046665 Bacteria 4120
487 Ga0495661_0039231 3300046665 Bacteria 2944
488 Ga0495661_0061114 3300046665 Bacteria 2237
489 Ga0495661_0171842 3300046665 Bacteria 1155
490 Ga0495661_0219281 3300046665 Bacteria 986
491 Ga0495588_0355583 3300046674 Bacteria 769
492 Ga0495657_0165990 3300046675 Bacteria 1363
493 Ga0495623_0006034 3300046679 Bacteria 7881
494 Ga0495623_0170373 3300046679 Bacteria 1272
495 Ga0495646_0157023 3300046680 Bacteria 1261
496 Ga0495669_0002549 3300046684 Bacteria 7438
497 Ga0495613_0033922 3300046689 Bacteria 3791
498 Ga0495613_0449368 3300046689 Bacteria 873
499 Ga0495670_0024087 3300046691 Bacteria 3006
500 Ga0495670_0035687 3300046691 Bacteria 2477
501 Ga0495670_0280794 3300046691 Bacteria 891
502 Ga0495671_0000534 3300046692 Bacteria 28736
503 Ga0495671_0002361 3300046692 Bacteria 11984
504 Ga0495671_0006515 3300046692 Bacteria 6740
505 Ga0495671_0006991 3300046692 Bacteria 6468
506 Ga0495671_0032955 3300046692 Bacteria 2641
507 Ga0495671_0191967 3300046692 Bacteria 991
508 Ga0495671_0394720 3300046692 Bacteria 662
509 Ga0495649_0001799 3300046694 Bacteria 15762
510 Ga0495649_0005813 3300046694 Bacteria 7768
511 Ga0495649_0064239 3300046694 Bacteria 1971
512 Ga0495649_0084275 3300046694 Bacteria 1697
513 Ga0495649_0091656 3300046694 Bacteria 1619
514 Ga0495649_0183698 3300046694 Bacteria 1090
515 Ga0495589_0000316 3300046794 Bacteria 38558
516 Ga0495589_0011018 3300046794 Bacteria 4693
517 Ga0495589_0145021 3300046794 Bacteria 1135
518 Ga0495589_0598561 3300046794 Bacteria 502
519 Ga0495600_0133564 3300046809 Bacteria 1612
520 Ga0495600_0208159 3300046809 Bacteria 1254
521 Ga0495600_0791563 3300046809 Bacteria 565
522 Ga0495660_0001234 3300046810 Bacteria 17819
523 Ga0495660_0007106 3300046810 Bacteria 6593
524 Ga0495660_0023190 3300046810 Bacteria 3541
525 Ga0495660_0029153 3300046810 Bacteria 3115
526 Ga0495660_0032408 3300046810 Bacteria 2934
527 Ga0495660_0041285 3300046810 Bacteria 2555
528 Ga0495660_0061495 3300046810 Bacteria 2015
529 Ga0495660_0184364 3300046810 Bacteria 1007
530 Ga0495660_0350536 3300046810 Bacteria 656
531 Ga0495660_0406577 3300046810 Bacteria 595
532 Ga0495581_0273586 3300047315 Bacteria 987
533 Ga0495604_0047722 3300047317 Bacteria 3334
534 Ga0495604_0163931 3300047317 Bacteria 1568
535 Ga0495604_0198282 3300047317 Bacteria 1394
536 Ga0495636_0000241 3300047318 Bacteria 21659
537 Ga0495674_0340749 3300047319 Bacteria 1218
538 Ga0495672_0000466 3300047320 Bacteria 47885
539 Ga0495672_0007898 3300047320 Bacteria 7936
540 Ga0495672_0012564 3300047320 Bacteria 5904
541 Ga0495672_0017087 3300047320 Bacteria 4860
542 Ga0495672_0018305 3300047320 Bacteria 4655
543 Ga0495672_0024128 3300047320 Bacteria 3924
544 Ga0495672_0031906 3300047320 Bacteria 3284
545 Ga0495672_0043913 3300047320 Bacteria 2684
546 Ga0495672_0176997 3300047320 Bacteria 1083
547 Ga0495672_0253193 3300047320 Bacteria 853
548 Ga0495680_0032220 3300047322 Bacteria 4257
549 Ga0495680_0075217 3300047322 Bacteria 2562
550 Ga0495680_0249460 3300047322 Bacteria 1258
551 Ga0495680_0251093 3300047322 Bacteria 1254
552 Ga0495683_0003180 3300047323 Bacteria 9601
553 Ga0495683_0003297 3300047323 Bacteria 9436
554 Ga0495683_0011917 3300047323 Bacteria 4571
555 Ga0495683_0052708 3300047323 Bacteria 2030
556 Ga0495683_0151608 3300047323 Bacteria 1078
557 Ga0495683_0226425 3300047323 Bacteria 831
558 Ga0495683_0265317 3300047323 Bacteria 748
559 Ga0495687_001366 3300047443 Bacteria 22552
560 Ga0495687_032200 3300047443 Bacteria 2396
561 Ga0495675_0007689 3300047444 Bacteria 6648
562 Ga0495675_0024264 3300047444 Bacteria 3866
563 Ga0495675_0572591 3300047444 Bacteria 642
564 Ga0495677_0008845 3300047445 Bacteria 3730
565 Ga0495677_0313890 3300047445 Bacteria 617
566 Ga0495679_000087 3300047446 Bacteria 85691
567 Ga0495679_000562 3300047446 Bacteria 25925
568 Ga0495679_001101 3300047446 Bacteria 16318
569 Ga0495679_010342 3300047446 Bacteria 3667
570 Ga0495679_136552 3300047446 Bacteria 663
571 Ga0495679_174290 3300047446 Bacteria 571
572 Ga0495685_014811 3300047447 Bacteria 2654
573 Ga0495685_038312 3300047447 Bacteria 1643
574 Ga0495673_0001647 3300047469 Bacteria 17243
575 Ga0495673_0001795 3300047469 Bacteria 16268
576 Ga0495673_0001822 3300047469 Bacteria 16091
577 Ga0495673_0003249 3300047469 Bacteria 10826
578 Ga0495673_0003709 3300047469 Bacteria 9932
579 Ga0495673_0004091 3300047469 Bacteria 9264
580 Ga0495673_0017462 3300047469 Bacteria 3642
581 Ga0495673_0022828 3300047469 Bacteria 3058
582 Ga0495673_0025809 3300047469 Bacteria 2816
583 Ga0495673_0026280 3300047469 Bacteria 2785
584 Ga0495673_0074142 3300047469 Bacteria 1424
585 Ga0495673_0116252 3300047469 Bacteria 1063
586 Ga0495681_0004032 3300047470 Bacteria 10105
587 Ga0495681_0005123 3300047470 Bacteria 8833
588 Ga0495681_0021298 3300047470 Bacteria 3496
589 Ga0495681_0056865 3300047470 Bacteria 1818
590 Ga0495681_0070573 3300047470 Bacteria 1583
591 Ga0495681_0168121 3300047470 Bacteria 909
592 Ga0495681_0299889 3300047470 Bacteria 622
593 Ga0495684_0088754 3300047471 Bacteria 2343
594 Ga0495686_0041186 3300047472 Bacteria 2941
595 Ga0495686_0170947 3300047472 Bacteria 1264
596 Ga0495686_0203910 3300047472 Bacteria 1133
597 Ga0495593_0059133 3300047673 Bacteria 2008
598 Ga0495593_0395997 3300047673 Bacteria 690
599 Ga0495593_0443672 3300047673 Bacteria 649
600 Ga0495626_0000263 3300048091 Bacteria 59779
601 Ga0495626_0003523 3300048091 Bacteria 10021
602 Ga0495626_0037245 3300048091 Bacteria 2312
603 Ga0495626_0071096 3300048091 Bacteria 1564
604 Ga0495626_0104141 3300048091 Bacteria 1234
605 Ga0496102_0004455 3300048905 Bacteria 11829
606 Ga0496102_0911670 3300048905 Bacteria 800
607 Ga0496103_0335555 3300048906 Bacteria 972
608 Ga0496104_1037636 3300048907 Bacteria 724
609 Ga0496105_0770796 3300048908 Bacteria 733
610 Ga0496110_0122602 3300048913 Bacteria 2343
611 Ga0496110_0263998 3300048913 Bacteria 1567
612 Ga0496110_0481092 3300048913 Bacteria 1131
613 Ga0496111_0192805 3300048914 Bacteria 1515
614 Ga0496111_0444134 3300048914 Bacteria 957
615 Ga0496112_0358163 3300048915 Bacteria 1401
616 Ga0496116_0001088 3300048919 Bacteria 32732
617 Ga0496116_0048270 3300048919 Bacteria 2858
618 Ga0496116_0054493 3300048919 Bacteria 2634
619 Ga0496116_0267323 3300048919 Bacteria 838
620 Ga0496117_0001620 3300048920 Bacteria 31800
621 Ga0496117_0039417 3300048920 Bacteria 3487
622 Ga0496117_0107953 3300048920 Bacteria 1742
623 Ga0496117_0211361 3300048920 Bacteria 1087
624 Ga0496118_0031180 3300048921 Bacteria 4427
625 Ga0496118_0040559 3300048921 Bacteria 3700
626 Ga0496118_0105915 3300048921 Bacteria 1883
627 Ga0496118_0168900 3300048921 Bacteria 1339
628 Ga0496118_0230976 3300048921 Bacteria 1067
629 Ga0496118_0236821 3300048921 Bacteria 1048
630 Ga0496119_0248329 3300048922 Bacteria 898
631 Ga0496119_0468801 3300048922 Bacteria 590
632 Ga0496120_0014392 3300048923 Bacteria 5276
633 Ga0496121_0004836 3300048924 Bacteria 17725
634 Ga0496121_0094195 3300048924 Bacteria 2330
635 Ga0496122_0078531 3300048925 Bacteria 2311
636 Ga0496122_0156532 3300048925 Bacteria 1397
637 Ga0496122_0501503 3300048925 Bacteria 589
638 Ga0496123_0023450 3300048926 Bacteria 4722
639 Ga0496123_0062492 3300048926 Bacteria 2386
640 Ga0496123_0087504 3300048926 Bacteria 1863
641 Ga0496123_0236169 3300048926 Bacteria 911
642 Ga0496124_0001693 3300048927 Bacteria 31219
643 Ga0496124_0005776 3300048927 Bacteria 13772
644 Ga0496124_0006748 3300048927 Bacteria 12411
645 Ga0496124_0037209 3300048927 Bacteria 4235
646 Ga0496124_0070022 3300048927 Bacteria 2910
647 Ga0496124_0712410 3300048927 Bacteria 634
648 Ga0496124_0738352 3300048927 Bacteria 619
649 Ga0496125_0001691 3300048928 Bacteria 30828
650 Ga0496125_0005335 3300048928 Bacteria 14361
651 Ga0496125_0067210 3300048928 Bacteria 2826
652 Ga0496126_0756783 3300048929 Bacteria 749
653 Ga0495678_000473 3300049459 Bacteria 40038
654 Ga0495678_007309 3300049459 Bacteria 5743
655 Ga0495678_012504 3300049459 Bacteria 4021
656 Ga0495678_016548 3300049459 Bacteria 3367
657 Ga0495678_027798 3300049459 Bacteria 2394
658 Ga0495678_079350 3300049459 Bacteria 1182
659 Ga0495678_103266 3300049459 Bacteria 984
660 Ga0495678_144512 3300049459 Bacteria 774
661 Ga0495682_0050924 3300049460 Bacteria 1506
662 Ga0495682_0142893 3300049460 Bacteria 854
663 Ga0495682_0323856 3300049460 Bacteria 543
664 nmdc:mga00v17_744413_c1 3300050491 Bacteria 627
665 nmdc:mga08x19_247138_c1 3300050514 Bacteria 1231
666 Ga0500573_0024418 3300053140 Bacteria 3475
667 Ga0500586_212674 3300053145 Bacteria 628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0356741 Ga0495638_0356741_308_637 88
2 3300046491 Ga0495584_0012423 Ga0495584_0012423_294_623 90
3 3300046520 Ga0495637_0030939 Ga0495637_0030939_244_573 90
4 3300046542 Ga0495597_0214904 Ga0495597_0214904_264_593 90
5 3300046665 Ga0495661_0039231 Ga0495661_0039231_1025_1354 90
6 3300046691 Ga0495670_0024087 Ga0495670_0024087_1690_2019 90
7 3300047445 Ga0495677_0313890 Ga0495677_0313890_224_553 90
8 3300048091 Ga0495626_0104141 Ga0495626_0104141_427_756 90
9 3300049459 Ga0495678_027798 Ga0495678_027798_134_463 90
10 3300049460 Ga0495682_0142893 Ga0495682_0142893_154_483 90
11 3300042006 Ga0439432_231131 Ga0439432_231131_188_472 94
12 3300046542 Ga0495597_0206676 Ga0495597_0206676_22_306 94
13 3300046694 Ga0495649_0091656 Ga0495649_0091656_232_516 94
14 3300047320 Ga0495672_0176997 Ga0495672_0176997_618_902 94
15 3300049459 Ga0495678_103266 Ga0495678_103266_258_542 94
16 3300042138 Ga0450903_020477 Ga0450903_020477_486_779 97
17 3300042142 Ga0450905_024260 Ga0450905_024260_367_660 97
18 3300046558 Ga0495633_0229742 Ga0495633_0229742_459_752 97
19 3300013102 Ga0157371_10000583 Ga0157371_100005837 98
20 3300013104 Ga0157370_10065957 Ga0157370_100659575 98
21 3300013105 Ga0157369_10197862 Ga0157369_101978623 98
22 3300041411 Ga0439466_0002264 Ga0439466_0002264_2878_3174 98
23 3300042016 Ga0439463_011039 Ga0439463_011039_1330_1626 98
24 3300046463 Ga0495653_0058819 Ga0495653_0058819_1174_1470 98
25 3300046474 Ga0495605_0114063 Ga0495605_0114063_450_746 98
26 3300046516 Ga0495628_0436599 Ga0495628_0436599_454_750 98
27 3300046517 Ga0495630_0477805 Ga0495630_0477805_628_924 98
28 3300046642 Ga0495634_0153879 Ga0495634_0153879_590_886 98
29 3300046679 Ga0495623_0170373 Ga0495623_0170373_514_810 98
30 3300046680 Ga0495646_0157023 Ga0495646_0157023_749_1045 98
31 3300046689 Ga0495613_0449368 Ga0495613_0449368_41_337 98
32 3300047317 Ga0495604_0047722 Ga0495604_0047722_662_958 98
33 3300047319 Ga0495674_0340749 Ga0495674_0340749_641_937 98
34 3300047322 Ga0495680_0251093 Ga0495680_0251093_446_742 98
35 3300047444 Ga0495675_0572591 Ga0495675_0572591_161_457 98
36 3300047673 Ga0495593_0395997 Ga0495593_0395997_143_439 98
37 3300048905 Ga0496102_0004455 Ga0496102_0004455_10032_10328 98
38 3300048906 Ga0496103_0335555 Ga0496103_0335555_122_418 98
39 3300048919 Ga0496116_0267323 Ga0496116_0267323_457_753 98
40 3300048920 Ga0496117_0211361 Ga0496117_0211361_495_791 98
41 3300048921 Ga0496118_0105915 Ga0496118_0105915_995_1291 98
42 iso_pu_bacteria 2511231006 2511263012 100
43 iso_pu_bacteria 2511231010 2511291054 100
44 iso_pu_bacteria 2511231018 2511341025 100
45 iso_pu_bacteria 2511231019 2511345045 100
46 iso_pu_bacteria 2511231021 2511356953 100
47 iso_pu_bacteria 2511231156 2511823470 100
48 iso_pu_bacteria 2512047018 2512329395 100
49 iso_pu_bacteria 2582580891 2583790926 100
50 iso_pu_bacteria 2597489887 2597856695 100
51 iso_pu_bacteria 2597489888 2597865225 100
52 iso_pu_bacteria 2599185160 2599355524 100
53 iso_pu_bacteria 2599185161 2599360642 100
54 iso_pu_bacteria 2599185162 2599366964 100
55 iso_pu_bacteria 2599185163 2599373754 100
56 iso_pu_bacteria 2599185164 2599380630 100
57 iso_pu_bacteria 2599185165 2599387077 100
58 iso_pu_bacteria 2599185166 2599392612 100
59 iso_pu_bacteria 2599185167 2599400358 100
60 iso_pu_bacteria 2599185168 2599404379 100
61 iso_pu_bacteria 2599185179 2599451311 100
62 iso_pu_bacteria 2599185181 2599462358 100
63 iso_pu_bacteria 2599185182 2599466588 100
64 iso_pu_bacteria 2599185185 2599483718 100
65 iso_pu_bacteria 2599185186 2599490550 100
66 iso_pu_bacteria 2599185189 2599508629 100
67 iso_pu_bacteria 2599185190 2599512485 100
68 iso_pu_bacteria 2599185191 2599519833 100
69 iso_pu_bacteria 2599185212 2599615795 100
70 iso_pu_bacteria 2599185248 2599772712 100
71 iso_pu_bacteria 2599185257 2599801363 100
72 iso_pu_bacteria 2599185288 2599878571 100
73 iso_pu_bacteria 2599185289 2599889207 100
74 iso_pu_bacteria 2599185290 2599891161 100
75 iso_pu_bacteria 2599185291 2599896528 100
76 iso_pu_bacteria 2599185303 2599947774 100
77 iso_pu_bacteria 2599185305 2599962640 100
78 iso_pu_bacteria 2599185306 2599965259 100
79 iso_pu_bacteria 2599185307 2599973785 100
80 iso_pu_bacteria 2599185308 2599978805 100
81 iso_pu_bacteria 2599185311 2599996545 100
82 iso_pu_bacteria 2599185313 2600006901 100
83 iso_pu_bacteria 2599185314 2600010491 100
84 iso_pu_bacteria 2599185315 2600021416 100
85 iso_pu_bacteria 2599185316 2600026366 100
86 iso_pu_bacteria 2599185317 2600032480 100
87 iso_pu_bacteria 2599185318 2600036301 100
88 iso_pu_bacteria 2599185319 2600043599 100
89 iso_pu_bacteria 2599185321 2600053542 100
90 iso_pu_bacteria 2599185322 2600061445 100
91 iso_pu_bacteria 2599185323 2600067369 100
92 iso_pu_bacteria 2599185324 2600070375 100
93 iso_pu_bacteria 2599185325 2600080204 100
94 iso_pu_bacteria 2599185356 2600214980 100
95 iso_pu_bacteria 2600254930 2600362042 100
96 iso_pu_bacteria 2600254931 2600363669 100
97 iso_pu_bacteria 2600255283 2601625610 100
98 iso_pu_bacteria 2600255296 2601689520 100
99 iso_pu_bacteria 2600255313 2601774315 100
100 iso_pu_bacteria 2600255318 2601799982 100
101 iso_pu_bacteria 2603880185 2606074219 100
102 iso_pu_bacteria 2603880199 2606127081 100
103 iso_pu_bacteria 2623620443 2624479272 100
104 iso_pu_bacteria 2643221571 2643869335 100
105 iso_pu_bacteria 2643221650 2644283651 100
106 iso_pu_bacteria 2643221713 2644622058 100
107 iso_pu_bacteria 2651869719 2652547509 100
108 iso_pu_bacteria 2667528170 2671090404 100
109 iso_pu_bacteria 2667528171 2671098139 100
110 iso_pu_bacteria 2667528176 2671130374 100
111 iso_pu_bacteria 2671180172 2671768311 100
112 iso_pu_bacteria 2675903515 2678262399 100
113 iso_pu_bacteria 2713897149 2715759645 100
114 iso_pu_bacteria 2721755607 2723249980 100
115 iso_pu_bacteria 2738541271 2738689290 100
116 iso_pu_bacteria 2738541294 2738808344 100
117 iso_pu_bacteria 2738541309 2738895704 100
118 iso_pu_bacteria 2738543016 2739264678 100
119 iso_pu_bacteria 2740892503 2743736121 100
120 iso_pu_bacteria 2744054620 2745008744 100
121 iso_pu_bacteria 2808606361 2808858212 100
122 iso_pu_bacteria 2808606376 2808924165 100
123 iso_pu_bacteria 2808606377 2808929961 100
124 iso_pu_bacteria 2808606378 2808938399 100
125 iso_pu_bacteria 2808606380 2808946106 100
126 iso_pu_bacteria 2808606381 2808951963 100
127 iso_pu_bacteria 2808606382 2808957529 100
128 iso_pu_bacteria 2808606383 2808966697 100
129 iso_pu_bacteria 2808606385 2808977934 100
130 iso_pu_bacteria 2808606388 2808993414 100
131 iso_pu_bacteria 2808606389 2809001527 100
132 iso_pu_bacteria 2818991464 2819703206 100
133 iso_pu_bacteria 2825651385 2825653243 100
134 iso_pu_bacteria 2834028612 2834031772 100
135 iso_pu_bacteria 2842826826 2842827549 100
136 iso_pu_bacteria 2842837860 2842841341 100
137 iso_pu_bacteria 2842854478 2842859002 100
138 iso_pu_bacteria 2852612431 2852612994 100
139 iso_pu_bacteria 2852667396 2852669271 100
140 iso_pu_bacteria 2878029506 2878031281 100
141 iso_pu_bacteria 2908446538 2908451134 100
142 iso_pu_bacteria 2913036834 2913038371 100
143 iso_pu_bacteria 2917070673 2917072295 100
144 iso_pu_bacteria 2919063839 2919064249 100
145 iso_pu_bacteria 2919481497 2919481637 100
146 iso_pu_bacteria 2923153595 2923155134 100
147 iso_pu_bacteria 2923586266 2923587507 100
148 iso_pu_bacteria 2931369376 2931370846 100
149 iso_pu_bacteria 2931390751 2931395096 100
150 iso_pu_bacteria 2935353572 2935354459 100
151 iso_pu_bacteria 2945928738 2945932217 100
152 iso_pu_bacteria 2945961074 2945961838 100
153 iso_pu_bacteria 2984286254 2984290908 100
154 iso_pu_bacteria 2988728565 2988733347 100
155 iso_pu_bacteria 3007395558 3007400668 100
156 iso_pu_bacteria 3007419365 3007421143 100
157 iso_pu_bacteria 3007511990 3007512854 100
158 iso_pu_bacteria 3007619802 3007620588 100
159 iso_pu_bacteria 637000220 637318885 100
160 iso_pu_bacteria 8015687852 8015689355 100
161 iso_pu_bacteria 8054347763 8054350652 100
162 iso_pu_bacteria 8055770955 8055772479 100
163 iso_pu_bacteria 8055817908 8055822534 100
164 iso_pu_bacteria 8056131705 8056135993 100
165 iso_pu_bacteria 8056143049 8056147463 100
166 iso_pu_bacteria 8056148874 8056150314 100
167 iso_pu_bacteria 8056161164 8056162207 100
168 3300009036 Ga0105244_10017545 Ga0105244_100175452 103
169 3300025728 Ga0207655_1008712 Ga0207655_10087124 103
170 3300046457 Ga0495590_0216688 Ga0495590_0216688_114_428 103
171 3300046474 Ga0495605_0215535 Ga0495605_0215535_156_470 103
172 3300048914 Ga0496111_0444134 Ga0496111_0444134_439_753 103
173 3300048922 Ga0496119_0248329 Ga0496119_0248329_386_700 103
174 3300048927 Ga0496124_0070022 Ga0496124_0070022_2480_2794 103
175 2162886007 SwRhRL2b_contig_2924427 SwRhRL2b_0126.00007020 104
176 2162886011 MRS1b_contig_7707250 MRS1b_0743.00002320 104
177 3300002737 JGI25162J39368_1015835 JGI25162J39368_10158352 104
178 3300002738 JGI25154J39366_1005442 JGI25154J39366_10054422 104
179 3300002771 JGI25163J39215_1000366 JGI25163J39215_100036611 104
180 3300002771 JGI25163J39215_1001531 JGI25163J39215_10015312 104
181 3300002772 JGI25164J39214_1000063 JGI25164J39214_100006393 104
182 3300002772 JGI25164J39214_1000079 JGI25164J39214_100007980 104
183 3300003214 JGI25165J46597_1000160 JGI25165J46597_100016093 104
184 3300003214 JGI25165J46597_1000183 JGI25165J46597_100018380 104
185 3300003751 Ga0055538_1000027 Ga0055538_1000027155 104
186 3300003752 Ga0055539_1000036 Ga0055539_1000036155 104
187 3300003756 Ga0055533_1000046 Ga0055533_1000046155 104
188 3300003758 Ga0055532_1000032 Ga0055532_1000032155 104
189 3300003759 Ga0055525_1000217 Ga0055525_100021722 104
190 3300003761 Ga0055535_1014231 Ga0055535_10142312 104
191 3300003781 Ga0055536_1006303 Ga0055536_10063036 104
192 3300003791 Ga0055530_10000290 Ga0055530_1000029016 104
193 3300003791 Ga0055530_10004655 Ga0055530_100046555 104
194 3300003792 Ga0055540_1000154 Ga0055540_10001546 104
195 3300003792 Ga0055540_1000170 Ga0055540_10001706 104
196 3300003792 Ga0055540_1003288 Ga0055540_10032885 104
197 3300003794 Ga0055531_10002229 Ga0055531_1000222911 104
198 3300003841 Ga0055541_1000024 Ga0055541_1000024155 104
199 3300005288 Ga0065714_10023033 Ga0065714_100230332 104
200 3300005288 Ga0065714_10065134 Ga0065714_1006513411 104
201 3300005288 Ga0065714_10068680 Ga0065714_100686804 104
202 3300005289 Ga0065704_10040973 Ga0065704_100409732 104
203 3300005289 Ga0065704_10070997 Ga0065704_1007099711 104
204 3300005289 Ga0065704_10167317 Ga0065704_101673172 104
205 3300005289 Ga0065704_10207651 Ga0065704_102076511 104
206 3300005290 Ga0065712_10068472 Ga0065712_1006847211 104
207 3300005331 Ga0070670_100027090 Ga0070670_1000270905 104
208 3300005344 Ga0070661_100000008 Ga0070661_100000008135 104
209 3300005344 Ga0070661_100369497 Ga0070661_1003694971 104
210 3300005353 Ga0070669_100000579 Ga0070669_10000057924 104
211 3300005353 Ga0070669_100028154 Ga0070669_1000281543 104
212 3300005457 Ga0070662_100000388 Ga0070662_10000038824 104
213 3300005539 Ga0068853_100006303 Ga0068853_1000063034 104
214 3300005548 Ga0070665_100256142 Ga0070665_1002561422 104
215 3300005564 Ga0070664_100000028 Ga0070664_10000002843 104
216 3300005578 Ga0068854_100008255 Ga0068854_1000082552 104
217 3300005834 Ga0068851_10000068 Ga0068851_1000006834 104
218 3300006051 Ga0075364_10087742 Ga0075364_100877421 104
219 3300006058 Ga0075432_10004774 Ga0075432_100047743 104
220 3300006177 Ga0075362_10382871 Ga0075362_103828711 104
221 3300006353 Ga0075370_10569475 Ga0075370_105694752 104
222 3300006914 Ga0075436_100060400 Ga0075436_1000604002 104
223 3300006948 Ga0099826_10003010 Ga0099826_100030106 104
224 3300009011 Ga0105251_10002022 Ga0105251_1000202211 104
225 3300009011 Ga0105251_10002641 Ga0105251_1000264113 104
226 3300009011 Ga0105251_10003114 Ga0105251_1000311410 104
227 3300009011 Ga0105251_10014246 Ga0105251_100142465 104
228 3300009011 Ga0105251_10363526 Ga0105251_103635262 104
229 3300009036 Ga0105244_10041907 Ga0105244_100419073 104
230 3300009036 Ga0105244_10050877 Ga0105244_100508772 104
231 3300009036 Ga0105244_10064133 Ga0105244_100641333 104
232 3300009036 Ga0105244_10110223 Ga0105244_101102232 104
233 3300009036 Ga0105244_10238250 Ga0105244_102382502 104
234 3300009092 Ga0105250_10000180 Ga0105250_1000018015 104
235 3300009092 Ga0105250_10006310 Ga0105250_100063102 104
236 3300009092 Ga0105250_10012243 Ga0105250_100122434 104
237 3300009092 Ga0105250_10345502 Ga0105250_103455021 104
238 3300009148 Ga0105243_10003185 Ga0105243_100031859 104
239 3300009148 Ga0105243_10336255 Ga0105243_103362551 104
240 3300009148 Ga0105243_12401103 Ga0105243_124011031 104
241 3300009176 Ga0105242_10000024 Ga0105242_1000002449 104
242 3300009176 Ga0105242_10235029 Ga0105242_102350292 104
243 3300009176 Ga0105242_11722316 Ga0105242_117223161 104
244 3300009177 Ga0105248_11594749 Ga0105248_115947492 104
245 3300009545 Ga0105237_10009518 Ga0105237_100095187 104
246 3300011119 Ga0105246_10299617 Ga0105246_102996172 104
247 3300013100 Ga0157373_10020946 Ga0157373_100209464 104
248 3300013100 Ga0157373_10033013 Ga0157373_100330134 104
249 3300013100 Ga0157373_10242726 Ga0157373_102427262 104
250 3300013102 Ga0157371_10002025 Ga0157371_100020254 104
251 3300013102 Ga0157371_10186156 Ga0157371_101861561 104
252 3300013104 Ga0157370_10159130 Ga0157370_101591301 104
253 3300013104 Ga0157370_10224510 Ga0157370_102245102 104
254 3300013104 Ga0157370_10499983 Ga0157370_104999831 104
255 3300013104 Ga0157370_10612309 Ga0157370_106123092 104
256 3300013105 Ga0157369_10033322 Ga0157369_100333222 104
257 3300013105 Ga0157369_10035296 Ga0157369_100352963 104
258 3300013105 Ga0157369_10081843 Ga0157369_100818432 104
259 3300013105 Ga0157369_11637446 Ga0157369_116374461 104
260 3300013105 Ga0157369_12052977 Ga0157369_120529772 104
261 3300013306 Ga0163162_10535938 Ga0163162_105359382 104
262 3300013308 Ga0157375_10002948 Ga0157375_100029485 104
263 3300013308 Ga0157375_12011657 Ga0157375_120116572 104
264 3300014497 Ga0182008_10002054 Ga0182008_100020546 104
265 3300014497 Ga0182008_10056010 Ga0182008_100560102 104
266 3300014497 Ga0182008_10060932 Ga0182008_100609322 104
267 3300014497 Ga0182008_10160961 Ga0182008_101609612 104
268 3300014497 Ga0182008_10631497 Ga0182008_106314971 104
269 3300015261 Ga0182006_1002709 Ga0182006_10027098 104
270 3300015261 Ga0182006_1026510 Ga0182006_10265103 104
271 3300015261 Ga0182006_1080277 Ga0182006_10802772 104
272 3300015262 Ga0182007_10007681 Ga0182007_100076815 104
273 3300015262 Ga0182007_10052755 Ga0182007_100527552 104
274 3300015265 Ga0182005_1009477 Ga0182005_10094774 104
275 3300015265 Ga0182005_1022669 Ga0182005_10226691 104
276 3300017792 Ga0163161_10002276 Ga0163161_100022765 104
277 3300017792 Ga0163161_10140145 Ga0163161_101401452 104
278 3300017792 Ga0163161_10186087 Ga0163161_101860873 104
279 3300017792 Ga0163161_11084854 Ga0163161_110848542 104
280 3300017792 Ga0163161_11826786 Ga0163161_118267862 104
281 3300025206 Ga0209435_101319 Ga0209435_1013194 104
282 3300025207 Ga0209760_100039 Ga0209760_100039105 104
283 3300025207 Ga0209760_100052 Ga0209760_10005279 104
284 3300025224 Ga0209784_100017 Ga0209784_100017294 104
285 3300025225 Ga0209566_100014 Ga0209566_100014294 104
286 3300025226 Ga0209674_100028 Ga0209674_100028294 104
287 3300025229 Ga0209147_100038 Ga0209147_100038149 104
288 3300025230 Ga0209563_100032 Ga0209563_100032294 104
289 3300025231 Ga0207427_100001 Ga0207427_100001779 104
290 3300025231 Ga0207427_100029 Ga0207427_10002915 104
291 3300025233 Ga0209437_100003 Ga0209437_100003593 104
292 3300025233 Ga0209437_100009 Ga0209437_100009270 104
293 3300025233 Ga0209437_111489 Ga0209437_1114892 104
294 3300025242 Ga0209258_100197 Ga0209258_10019774 104
295 3300025246 Ga0209646_1000171 Ga0209646_100017185 104
296 3300025253 Ga0209677_100018 Ga0209677_100018294 104
297 3300025256 Ga0209759_1004504 Ga0209759_10045041 104
298 3300025256 Ga0209759_1016938 Ga0209759_10169383 104
299 3300025261 Ga0209233_1000007 Ga0209233_1000007779 104
300 3300025261 Ga0209233_1000032 Ga0209233_1000032270 104
301 3300025284 Ga0209130_1059935 Ga0209130_10599352 104
302 3300025291 Ga0209675_1006112 Ga0209675_10061124 104
303 3300025292 Ga0209676_1000016 Ga0209676_1000016378 104
304 3300025292 Ga0209676_1000021 Ga0209676_100002175 104
305 3300025292 Ga0209676_1002055 Ga0209676_10020551 104
306 3300025298 Ga0209050_1000009 Ga0209050_1000009145 104
307 3300025298 Ga0209050_1000036 Ga0209050_1000036180 104
308 3300025298 Ga0209050_1000107 Ga0209050_100010774 104
309 3300025303 Ga0209051_1000043 Ga0209051_1000043252 104
310 3300025303 Ga0209051_1000053 Ga0209051_1000053145 104
311 3300025303 Ga0209051_1000090 Ga0209051_100009082 104
312 3300025304 Ga0209257_1000098 Ga0209257_100009861 104
313 3300025304 Ga0209257_1008639 Ga0209257_10086393 104
314 3300025321 Ga0207656_10000089 Ga0207656_100000898 104
315 3300025711 Ga0207696_1000043 Ga0207696_1000043235 104
316 3300025711 Ga0207696_1002643 Ga0207696_10026432 104
317 3300025711 Ga0207696_1026570 Ga0207696_10265702 104
318 3300025728 Ga0207655_1000019 Ga0207655_1000019427 104
319 3300025728 Ga0207655_1000095 Ga0207655_1000095151 104
320 3300025728 Ga0207655_1008299 Ga0207655_10082992 104
321 3300025728 Ga0207655_1017325 Ga0207655_10173255 104
322 3300025728 Ga0207655_1046303 Ga0207655_10463033 104
323 3300025728 Ga0207655_1079087 Ga0207655_10790871 104
324 3300025735 Ga0207713_1000074 Ga0207713_1000074162 104
325 3300025735 Ga0207713_1001420 Ga0207713_100142015 104
326 3300025735 Ga0207713_1002370 Ga0207713_100237011 104
327 3300025735 Ga0207713_1006104 Ga0207713_10061045 104
328 3300025735 Ga0207713_1010738 Ga0207713_10107383 104
329 3300025735 Ga0207713_1012423 Ga0207713_10124234 104
330 3300025735 Ga0207713_1019354 Ga0207713_10193542 104
331 3300025735 Ga0207713_1068597 Ga0207713_10685972 104
332 3300025914 Ga0207671_10000035 Ga0207671_10000035139 104
333 3300025920 Ga0207649_10000017 Ga0207649_1000001726 104
334 3300025920 Ga0207649_11439356 Ga0207649_114393561 104
335 3300025923 Ga0207681_10000835 Ga0207681_1000083516 104
336 3300025923 Ga0207681_10013345 Ga0207681_100133455 104
337 3300025925 Ga0207650_10000212 Ga0207650_1000021221 104
338 3300025925 Ga0207650_10000523 Ga0207650_100005237 104
339 3300025933 Ga0207706_10000170 Ga0207706_1000017040 104
340 3300025934 Ga0207686_10007499 Ga0207686_100074993 104
341 3300025935 Ga0207709_10000350 Ga0207709_1000035034 104
342 3300025935 Ga0207709_10006666 Ga0207709_100066667 104
343 3300025935 Ga0207709_10229357 Ga0207709_102293572 104
344 3300025935 Ga0207709_11093380 Ga0207709_110933802 104
345 3300025945 Ga0207679_10000005 Ga0207679_10000005229 104
346 3300025945 Ga0207679_10542313 Ga0207679_105423132 104
347 3300025981 Ga0207640_10048783 Ga0207640_100487832 104
348 3300026041 Ga0207639_10004921 Ga0207639_100049219 104
349 3300027111 Ga0209281_1000172 Ga0209281_1000172128 104
350 3300027907 Ga0207428_10057479 Ga0207428_100574793 104
351 3300028379 Ga0268266_10274780 Ga0268266_102747802 104
352 3300030521 Ga0307511_10283210 Ga0307511_102832102 104
353 3300030742 Ga0316183_1163758 Ga0316183_11637582 104
354 3300030744 Ga0316181_1279414 Ga0316181_12794142 104
355 3300031548 Ga0307408_100056205 Ga0307408_1000562051 104
356 3300041405 Ga0439438_009782 Ga0439438_009782_303_617 104
357 3300041407 Ga0439447_003235 Ga0439447_003235_4534_4848 104
358 3300041407 Ga0439447_109049 Ga0439447_109049_88_402 104
359 3300041407 Ga0439447_113842 Ga0439447_113842_137_466 104
360 3300041411 Ga0439466_0006877 Ga0439466_0006877_633_947 104
361 3300041411 Ga0439466_0010705 Ga0439466_0010705_3045_3374 104
362 3300041411 Ga0439466_0022888 Ga0439466_0022888_969_1283 104
363 3300041411 Ga0439466_0135015 Ga0439466_0135015_67_381 104
364 3300041453 Ga0451797_0097127 Ga0451797_0097127_83_397 104
365 3300042006 Ga0439432_005074 Ga0439432_005074_4360_4674 104
366 3300042009 Ga0439451_008359 Ga0439451_008359_1090_1404 104
367 3300042009 Ga0439451_084079 Ga0439451_084079_244_558 104
368 3300042010 Ga0439452_000582 Ga0439452_000582_14591_14905 104
369 3300042010 Ga0439452_011461 Ga0439452_011461_81_395 104
370 3300042010 Ga0439452_014076 Ga0439452_014076_1797_2111 104
371 3300042013 Ga0439456_037681 Ga0439456_037681_380_694 104
372 3300042013 Ga0439456_070309 Ga0439456_070309_316_630 104
373 3300042013 Ga0439456_131085 Ga0439456_131085_50_364 104
374 3300042016 Ga0439463_000601 Ga0439463_000601_3367_3681 104
375 3300042115 Ga0450911_044788 Ga0450911_044788_229_558 104
376 3300042137 Ga0450902_002174 Ga0450902_002174_2136_2450 104
377 3300042137 Ga0450902_010414 Ga0450902_010414_1058_1372 104
378 3300042137 Ga0450902_077484 Ga0450902_077484_160_474 104
379 3300042142 Ga0450905_037567 Ga0450905_037567_113_427 104
380 3300042156 Ga0439446_0241075 Ga0439446_0241075_127_441 104
381 3300046452 Ga0495617_023079 Ga0495617_023079_755_1069 104
382 3300046452 Ga0495617_024862 Ga0495617_024862_1419_1733 104
383 3300046453 Ga0495627_000340 Ga0495627_000340_283_597 104
384 3300046453 Ga0495627_000446 Ga0495627_000446_3924_4238 104
385 3300046453 Ga0495627_013960 Ga0495627_013960_1277_1591 104
386 3300046453 Ga0495627_186548 Ga0495627_186548_158_472 104
387 3300046457 Ga0495590_0009335 Ga0495590_0009335_1599_1913 104
388 3300046457 Ga0495590_0081300 Ga0495590_0081300_56_370 104
389 3300046458 Ga0495591_000035 Ga0495591_000035_90245_90559 104
390 3300046458 Ga0495591_000232 Ga0495591_000232_47537_47851 104
391 3300046458 Ga0495591_000986 Ga0495591_000986_12290_12604 104
392 3300046458 Ga0495591_001326 Ga0495591_001326_2068_2382 104
393 3300046458 Ga0495591_005652 Ga0495591_005652_5010_5324 104
394 3300046458 Ga0495591_012224 Ga0495591_012224_2620_2934 104
395 3300046458 Ga0495591_074373 Ga0495591_074373_488_802 104
396 3300046459 Ga0495629_0357187 Ga0495629_0357187_638_952 104
397 3300046460 Ga0495638_0001986 Ga0495638_0001986_13943_14257 104
398 3300046460 Ga0495638_0010520 Ga0495638_0010520_5232_5546 104
399 3300046463 Ga0495653_0026039 Ga0495653_0026039_2043_2357 104
400 3300046463 Ga0495653_0032917 Ga0495653_0032917_2772_3086 104
401 3300046471 Ga0495650_0006115 Ga0495650_0006115_4727_5041 104
402 3300046471 Ga0495650_0173027 Ga0495650_0173027_277_591 104
403 3300046473 Ga0495582_0040074 Ga0495582_0040074_702_1016 104
404 3300046474 Ga0495605_0000370 Ga0495605_0000370_23278_23592 104
405 3300046474 Ga0495605_0000628 Ga0495605_0000628_22707_23021 104
406 3300046474 Ga0495605_0007286 Ga0495605_0007286_5346_5660 104
407 3300046474 Ga0495605_0016393 Ga0495605_0016393_3644_3958 104
408 3300046474 Ga0495605_0469644 Ga0495605_0469644_66_380 104
409 3300046475 Ga0495639_0159695 Ga0495639_0159695_753_1067 104
410 3300046477 Ga0495664_0807262 Ga0495664_0807262_92_406 104
411 3300046491 Ga0495584_0005429 Ga0495584_0005429_5289_5603 104
412 3300046491 Ga0495584_0032787 Ga0495584_0032787_1467_1784 104
413 3300046491 Ga0495584_0055656 Ga0495584_0055656_672_986 104
414 3300046492 Ga0495585_0077018 Ga0495585_0077018_197_511 104
415 3300046499 Ga0495594_0104837 Ga0495594_0104837_196_510 104
416 3300046500 Ga0495596_0000004 Ga0495596_0000004_12284_12598 104
417 3300046501 Ga0495607_0000184 Ga0495607_0000184_14565_14879 104
418 3300046501 Ga0495607_0000286 Ga0495607_0000286_22724_23038 104
419 3300046501 Ga0495607_0001055 Ga0495607_0001055_22741_23055 104
420 3300046501 Ga0495607_0001301 Ga0495607_0001301_742_1056 104
421 3300046501 Ga0495607_0001813 Ga0495607_0001813_205_519 104
422 3300046501 Ga0495607_0007276 Ga0495607_0007276_5106_5420 104
423 3300046501 Ga0495607_0034522 Ga0495607_0034522_2366_2683 104
424 3300046501 Ga0495607_0056581 Ga0495607_0056581_520_834 104
425 3300046501 Ga0495607_0402421 Ga0495607_0402421_69_383 104
426 3300046501 Ga0495607_0560651 Ga0495607_0560651_103_417 104
427 3300046506 Ga0495583_0001166 Ga0495583_0001166_4636_4950 104
428 3300046506 Ga0495583_0001375 Ga0495583_0001375_3370_3684 104
429 3300046506 Ga0495583_0007196 Ga0495583_0007196_2404_2718 104
430 3300046506 Ga0495583_0014402 Ga0495583_0014402_3936_4250 104
431 3300046506 Ga0495583_0018442 Ga0495583_0018442_3317_3631 104
432 3300046506 Ga0495583_0214417 Ga0495583_0214417_125_442 104
433 3300046507 Ga0495606_0000734 Ga0495606_0000734_19162_19476 104
434 3300046507 Ga0495606_0001108 Ga0495606_0001108_19460_19774 104
435 3300046507 Ga0495606_0006795 Ga0495606_0006795_10083_10397 104
436 3300046507 Ga0495606_0039906 Ga0495606_0039906_1277_1591 104
437 3300046507 Ga0495606_0044304 Ga0495606_0044304_30_344 104
438 3300046507 Ga0495606_0054465 Ga0495606_0054465_289_603 104
439 3300046512 Ga0495610_0005269 Ga0495610_0005269_8882_9196 104
440 3300046512 Ga0495610_0017313 Ga0495610_0017313_2752_3066 104
441 3300046513 Ga0495616_0010172 Ga0495616_0010172_4335_4649 104
442 3300046513 Ga0495616_0031338 Ga0495616_0031338_1241_1555 104
443 3300046513 Ga0495616_0082912 Ga0495616_0082912_926_1240 104
444 3300046513 Ga0495616_0440192 Ga0495616_0440192_75_389 104
445 3300046515 Ga0495620_0001622 Ga0495620_0001622_3476_3790 104
446 3300046515 Ga0495620_0006029 Ga0495620_0006029_2871_3185 104
447 3300046515 Ga0495620_0044330 Ga0495620_0044330_251_565 104
448 3300046516 Ga0495628_0266588 Ga0495628_0266588_233_547 104
449 3300046517 Ga0495630_0010657 Ga0495630_0010657_1577_1891 104
450 3300046517 Ga0495630_0088621 Ga0495630_0088621_1631_1945 104
451 3300046518 Ga0495631_0023657 Ga0495631_0023657_1406_1720 104
452 3300046518 Ga0495631_0077634 Ga0495631_0077634_449_763 104
453 3300046519 Ga0495632_0009837 Ga0495632_0009837_5232_5546 104
454 3300046519 Ga0495632_0013150 Ga0495632_0013150_257_571 104
455 3300046519 Ga0495632_0015828 Ga0495632_0015828_140_454 104
456 3300046519 Ga0495632_0017903 Ga0495632_0017903_2573_2887 104
457 3300046519 Ga0495632_0032172 Ga0495632_0032172_544_858 104
458 3300046520 Ga0495637_0000502 Ga0495637_0000502_8990_9304 104
459 3300046520 Ga0495637_0002386 Ga0495637_0002386_3511_3825 104
460 3300046520 Ga0495637_0010753 Ga0495637_0010753_3533_3847 104
461 3300046520 Ga0495637_0061032 Ga0495637_0061032_134_448 104
462 3300046520 Ga0495637_0320419 Ga0495637_0320419_218_532 104
463 3300046522 Ga0495643_0026814 Ga0495643_0026814_1390_1704 104
464 3300046522 Ga0495643_0036825 Ga0495643_0036825_177_491 104
465 3300046523 Ga0495644_0000068 Ga0495644_0000068_47892_48206 104
466 3300046523 Ga0495644_0009554 Ga0495644_0009554_1569_1883 104
467 3300046523 Ga0495644_0023019 Ga0495644_0023019_1011_1325 104
468 3300046524 Ga0495648_0002092 Ga0495648_0002092_13065_13379 104
469 3300046524 Ga0495648_0003351 Ga0495648_0003351_4209_4523 104
470 3300046524 Ga0495648_0025416 Ga0495648_0025416_2758_3072 104
471 3300046526 Ga0495666_0047281 Ga0495666_0047281_377_691 104
472 3300046526 Ga0495666_0169097 Ga0495666_0169097_625_939 104
473 3300046530 Ga0495654_0002674 Ga0495654_0002674_9157_9471 104
474 3300046530 Ga0495654_0012299 Ga0495654_0012299_1945_2259 104
475 3300046530 Ga0495654_0028757 Ga0495654_0028757_899_1213 104
476 3300046530 Ga0495654_0067556 Ga0495654_0067556_670_984 104
477 3300046530 Ga0495654_0149656 Ga0495654_0149656_286_600 104
478 3300046535 Ga0495586_0207473 Ga0495586_0207473_69_383 104
479 3300046536 Ga0495587_0008713 Ga0495587_0008713_5212_5526 104
480 3300046538 Ga0495609_0019791 Ga0495609_0019791_335_649 104
481 3300046542 Ga0495597_0000085 Ga0495597_0000085_22852_23166 104
482 3300046542 Ga0495597_0010895 Ga0495597_0010895_2290_2604 104
483 3300046542 Ga0495597_0014602 Ga0495597_0014602_811_1125 104
484 3300046542 Ga0495597_0014906 Ga0495597_0014906_2544_2858 104
485 3300046543 Ga0495645_0845209 Ga0495645_0845209_126_440 104
486 3300046557 Ga0495622_0154187 Ga0495622_0154187_450_764 104
487 3300046558 Ga0495633_0074535 Ga0495633_0074535_603_917 104
488 3300046616 Ga0495668_0000159 Ga0495668_0000159_4819_5133 104
489 3300046616 Ga0495668_0057350 Ga0495668_0057350_444_758 104
490 3300046616 Ga0495668_0180826 Ga0495668_0180826_451_765 104
491 3300046642 Ga0495634_0821460 Ga0495634_0821460_51_365 104
492 3300046648 Ga0495611_0005498 Ga0495611_0005498_1104_1418 104
493 3300046648 Ga0495611_0009491 Ga0495611_0009491_1647_1961 104
494 3300046648 Ga0495611_0199603 Ga0495611_0199603_188_502 104
495 3300046648 Ga0495611_0395362 Ga0495611_0395362_39_353 104
496 3300046660 Ga0495625_0084712 Ga0495625_0084712_337_651 104
497 3300046660 Ga0495625_0492791 Ga0495625_0492791_297_611 104
498 3300046663 Ga0495635_0002278 Ga0495635_0002278_9067_9381 104
499 3300046665 Ga0495661_0000773 Ga0495661_0000773_25263_25577 104
500 3300046665 Ga0495661_0000847 Ga0495661_0000847_23345_23659 104
501 3300046665 Ga0495661_0011480 Ga0495661_0011480_5653_5967 104
502 3300046665 Ga0495661_0022298 Ga0495661_0022298_2997_3311 104
503 3300046665 Ga0495661_0171842 Ga0495661_0171842_790_1104 104
504 3300046665 Ga0495661_0219281 Ga0495661_0219281_646_960 104
505 3300046675 Ga0495657_0165990 Ga0495657_0165990_547_861 104
506 3300046679 Ga0495623_0006034 Ga0495623_0006034_2265_2579 104
507 3300046689 Ga0495613_0033922 Ga0495613_0033922_801_1115 104
508 3300046691 Ga0495670_0035687 Ga0495670_0035687_1836_2150 104
509 3300046692 Ga0495671_0000534 Ga0495671_0000534_7350_7664 104
510 3300046692 Ga0495671_0006515 Ga0495671_0006515_2698_3012 104
511 3300046692 Ga0495671_0006991 Ga0495671_0006991_4335_4649 104
512 3300046692 Ga0495671_0191967 Ga0495671_0191967_20_334 104
513 3300046694 Ga0495649_0005813 Ga0495649_0005813_938_1252 104
514 3300046694 Ga0495649_0084275 Ga0495649_0084275_976_1290 104
515 3300046694 Ga0495649_0183698 Ga0495649_0183698_732_1046 104
516 3300046794 Ga0495589_0011018 Ga0495589_0011018_4324_4638 104
517 3300046794 Ga0495589_0598561 Ga0495589_0598561_14_328 104
518 3300046809 Ga0495600_0133564 Ga0495600_0133564_526_840 104
519 3300046809 Ga0495600_0208159 Ga0495600_0208159_471_785 104
520 3300046809 Ga0495600_0791563 Ga0495600_0791563_163_477 104
521 3300046810 Ga0495660_0001234 Ga0495660_0001234_13251_13565 104
522 3300046810 Ga0495660_0023190 Ga0495660_0023190_938_1252 104
523 3300046810 Ga0495660_0029153 Ga0495660_0029153_1085_1399 104
524 3300046810 Ga0495660_0032408 Ga0495660_0032408_1113_1427 104
525 3300046810 Ga0495660_0184364 Ga0495660_0184364_486_800 104
526 3300047317 Ga0495604_0163931 Ga0495604_0163931_1163_1477 104
527 3300047317 Ga0495604_0198282 Ga0495604_0198282_797_1111 104
528 3300047320 Ga0495672_0007898 Ga0495672_0007898_1060_1374 104
529 3300047320 Ga0495672_0012564 Ga0495672_0012564_2712_3026 104
530 3300047320 Ga0495672_0017087 Ga0495672_0017087_2006_2320 104
531 3300047320 Ga0495672_0024128 Ga0495672_0024128_3115_3429 104
532 3300047320 Ga0495672_0031906 Ga0495672_0031906_1070_1387 104
533 3300047320 Ga0495672_0253193 Ga0495672_0253193_403_717 104
534 3300047322 Ga0495680_0032220 Ga0495680_0032220_876_1190 104
535 3300047322 Ga0495680_0075217 Ga0495680_0075217_1266_1580 104
536 3300047322 Ga0495680_0249460 Ga0495680_0249460_843_1157 104
537 3300047323 Ga0495683_0003297 Ga0495683_0003297_6627_6941 104
538 3300047323 Ga0495683_0011917 Ga0495683_0011917_1220_1534 104
539 3300047323 Ga0495683_0052708 Ga0495683_0052708_1157_1471 104
540 3300047444 Ga0495675_0007689 Ga0495675_0007689_1547_1861 104
541 3300047444 Ga0495675_0024264 Ga0495675_0024264_1703_2017 104
542 3300047446 Ga0495679_000087 Ga0495679_000087_41039_41353 104
543 3300047446 Ga0495679_000562 Ga0495679_000562_1602_1916 104
544 3300047446 Ga0495679_001101 Ga0495679_001101_856_1170 104
545 3300047446 Ga0495679_010342 Ga0495679_010342_3249_3563 104
546 3300047446 Ga0495679_136552 Ga0495679_136552_304_618 104
547 3300047469 Ga0495673_0001647 Ga0495673_0001647_13522_13836 104
548 3300047469 Ga0495673_0001795 Ga0495673_0001795_3697_4011 104
549 3300047469 Ga0495673_0001822 Ga0495673_0001822_9196_9510 104
550 3300047469 Ga0495673_0003709 Ga0495673_0003709_2478_2792 104
551 3300047469 Ga0495673_0004091 Ga0495673_0004091_4334_4648 104
552 3300047469 Ga0495673_0022828 Ga0495673_0022828_1855_2169 104
553 3300047469 Ga0495673_0025809 Ga0495673_0025809_1439_1753 104
554 3300047469 Ga0495673_0026280 Ga0495673_0026280_1292_1606 104
555 3300047469 Ga0495673_0074142 Ga0495673_0074142_938_1252 104
556 3300047470 Ga0495681_0004032 Ga0495681_0004032_8472_8786 104
557 3300047470 Ga0495681_0005123 Ga0495681_0005123_5640_5954 104
558 3300047470 Ga0495681_0021298 Ga0495681_0021298_1954_2268 104
559 3300047470 Ga0495681_0056865 Ga0495681_0056865_263_577 104
560 3300047470 Ga0495681_0070573 Ga0495681_0070573_288_602 104
561 3300047470 Ga0495681_0168121 Ga0495681_0168121_398_712 104
562 3300047471 Ga0495684_0088754 Ga0495684_0088754_1828_2142 104
563 3300047472 Ga0495686_0041186 Ga0495686_0041186_938_1252 104
564 3300047472 Ga0495686_0170947 Ga0495686_0170947_202_516 104
565 3300047673 Ga0495593_0059133 Ga0495593_0059133_487_801 104
566 3300048091 Ga0495626_0000263 Ga0495626_0000263_24522_24836 104
567 3300048905 Ga0496102_0911670 Ga0496102_0911670_380_694 104
568 3300048913 Ga0496110_0122602 Ga0496110_0122602_998_1312 104
569 3300048913 Ga0496110_0481092 Ga0496110_0481092_800_1114 104
570 3300048915 Ga0496112_0358163 Ga0496112_0358163_1004_1318 104
571 3300048919 Ga0496116_0048270 Ga0496116_0048270_998_1312 104
572 3300048919 Ga0496116_0054493 Ga0496116_0054493_2280_2594 104
573 3300048920 Ga0496117_0001620 Ga0496117_0001620_6228_6542 104
574 3300048920 Ga0496117_0039417 Ga0496117_0039417_2274_2588 104
575 3300048920 Ga0496117_0107953 Ga0496117_0107953_445_759 104
576 3300048921 Ga0496118_0031180 Ga0496118_0031180_3080_3394 104
577 3300048921 Ga0496118_0040559 Ga0496118_0040559_921_1235 104
578 3300048921 Ga0496118_0168900 Ga0496118_0168900_981_1295 104
579 3300048921 Ga0496118_0230976 Ga0496118_0230976_70_384 104
580 3300048922 Ga0496119_0468801 Ga0496119_0468801_227_541 104
581 3300048923 Ga0496120_0014392 Ga0496120_0014392_3596_3910 104
582 3300048924 Ga0496121_0004836 Ga0496121_0004836_5429_5743 104
583 3300048925 Ga0496122_0156532 Ga0496122_0156532_134_448 104
584 3300048925 Ga0496122_0501503 Ga0496122_0501503_190_504 104
585 3300048926 Ga0496123_0023450 Ga0496123_0023450_2603_2917 104
586 3300048926 Ga0496123_0062492 Ga0496123_0062492_1063_1377 104
587 3300048926 Ga0496123_0087504 Ga0496123_0087504_1068_1382 104
588 3300048927 Ga0496124_0001693 Ga0496124_0001693_25869_26183 104
589 3300048927 Ga0496124_0005776 Ga0496124_0005776_12500_12814 104
590 3300048927 Ga0496124_0006748 Ga0496124_0006748_11379_11693 104
591 3300048927 Ga0496124_0037209 Ga0496124_0037209_706_1020 104
592 3300048927 Ga0496124_0712410 Ga0496124_0712410_274_588 104
593 3300048927 Ga0496124_0738352 Ga0496124_0738352_274_588 104
594 3300048928 Ga0496125_0001691 Ga0496125_0001691_25267_25581 104
595 3300048928 Ga0496125_0005335 Ga0496125_0005335_8688_9002 104
596 3300048929 Ga0496126_0756783 Ga0496126_0756783_70_384 104
597 3300049459 Ga0495678_000473 Ga0495678_000473_30721_31035 104
598 3300049459 Ga0495678_012504 Ga0495678_012504_1418_1732 104
599 3300049459 Ga0495678_016548 Ga0495678_016548_874_1188 104
600 3300049459 Ga0495678_079350 Ga0495678_079350_580_894 104
601 3300049459 Ga0495678_144512 Ga0495678_144512_376_693 104
602 3300049460 Ga0495682_0323856 Ga0495682_0323856_89_403 104
603 3300050491 nmdc:mga00v17_744413_c1 nmdc:mga00v17_744413_c1_122_436 104
604 3300050514 nmdc:mga08x19_247138_c1 nmdc:mga08x19_247138_c1_173_487 104
605 3300053140 Ga0500573_0024418 Ga0500573_0024418_1978_2292 104
606 3300053145 Ga0500586_212674 Ga0500586_212674_304_618 104
607 iso_pu_bacteria 2511231004 2511256077 105
608 iso_pu_bacteria 2511231007 2511269683 105
609 iso_pu_bacteria 2511231016 2511328600 105
610 iso_pu_bacteria 2511231022 2511361596 105
611 iso_pu_bacteria 2623620446 2624493736 105
612 iso_pu_bacteria 2643221633 2644187599 105
613 iso_pu_bacteria 2773857670 2774121335 105
614 iso_pu_bacteria 2784132072 2784317322 105
615 iso_pu_bacteria 2808606445 2809216225 105
616 iso_pu_bacteria 2860339153 2860340195 105
617 iso_pu_bacteria 2919697872 2919700355 105
618 iso_pu_bacteria 8019775933 8019777010 105
619 iso_pu_bacteria 8056155041 8056155275 105
620 3300046513 Ga0495616_0227543 Ga0495616_0227543_390_710 106
621 2124908027 MRS2a_Contig_10106 MRS2a_00008660 109
622 2124908027 MRS2a_Contig_1664 MRS2a_00525210 109
623 2124908027 MRS2a_Contig_6915 MRS2a_00761430 109
624 3300005288 Ga0065714_10000154 Ga0065714_100001542 109
625 3300005288 Ga0065714_10020074 Ga0065714_100200741 109
626 3300005289 Ga0065704_10396985 Ga0065704_103969851 109
627 3300005289 Ga0065704_10648698 Ga0065704_106486981 109
628 3300005290 Ga0065712_10001605 Ga0065712_100016051 109
629 3300005293 Ga0065715_10017988 Ga0065715_100179882 109
630 3300006058 Ga0075432_10078700 Ga0075432_100787002 109
631 3300009036 Ga0105244_10008428 Ga0105244_100084282 109
632 3300009092 Ga0105250_10045681 Ga0105250_100456813 109
633 3300011119 Ga0105246_10413736 Ga0105246_104137362 109
634 3300013100 Ga0157373_10147983 Ga0157373_101479833 109
635 3300013104 Ga0157370_10246199 Ga0157370_102461993 109
636 3300014497 Ga0182008_10014590 Ga0182008_100145902 109
637 3300015261 Ga0182006_1000997 Ga0182006_100099712 109
638 3300015261 Ga0182006_1139013 Ga0182006_11390131 109
639 3300015262 Ga0182007_10000143 Ga0182007_100001437 109
640 3300015262 Ga0182007_10221388 Ga0182007_102213881 109
641 3300015265 Ga0182005_1000800 Ga0182005_100080010 109
642 3300017792 Ga0163161_10136684 Ga0163161_101366841 109
643 3300017792 Ga0163161_11141615 Ga0163161_111416151 109
644 3300025711 Ga0207696_1026435 Ga0207696_10264353 109
645 3300025728 Ga0207655_1002702 Ga0207655_10027022 109
646 3300025728 Ga0207655_1027292 Ga0207655_10272922 109
647 3300025735 Ga0207713_1034284 Ga0207713_10342843 109
648 3300027907 Ga0207428_10901267 Ga0207428_109012671 109
649 3300031731 Ga0307405_10800603 Ga0307405_108006031 109
650 3300041405 Ga0439438_084008 Ga0439438_084008_112_441 109
651 3300041407 Ga0439447_001766 Ga0439447_001766_3297_3626 109
652 3300041407 Ga0439447_003697 Ga0439447_003697_789_1118 109
653 3300041407 Ga0439447_090159 Ga0439447_090159_192_521 109
654 3300041410 Ga0439461_0086090 Ga0439461_0086090_226_555 109
655 3300041411 Ga0439466_0020025 Ga0439466_0020025_733_1062 109
656 3300041411 Ga0439466_0042697 Ga0439466_0042697_899_1228 109
657 3300041411 Ga0439466_0099089 Ga0439466_0099089_83_412 109
658 3300041413 Ga0439465_0074314 Ga0439465_0074314_440_769 109
659 3300041413 Ga0439465_0158480 Ga0439465_0158480_151_480 109
660 3300042004 Ga0439445_0176733 Ga0439445_0176733_46_375 109
661 3300042006 Ga0439432_014291 Ga0439432_014291_1339_1668 109
662 3300042006 Ga0439432_025028 Ga0439432_025028_733_1062 109
663 3300042009 Ga0439451_002994 Ga0439451_002994_2712_3041 109
664 3300042009 Ga0439451_011330 Ga0439451_011330_1052_1381 109
665 3300042010 Ga0439452_018564 Ga0439452_018564_789_1118 109
666 3300042010 Ga0439452_024253 Ga0439452_024253_310_639 109
667 3300042010 Ga0439452_036058 Ga0439452_036058_521_850 109
668 3300042010 Ga0439452_051835 Ga0439452_051835_151_480 109
669 3300042013 Ga0439456_000990 Ga0439456_000990_4629_4958 109
670 3300042013 Ga0439456_048341 Ga0439456_048341_216_545 109
671 3300042013 Ga0439456_109499 Ga0439456_109499_82_411 109
672 3300042016 Ga0439463_013760 Ga0439463_013760_932_1261 109
673 3300042016 Ga0439463_054724 Ga0439463_054724_370_699 109
674 3300042115 Ga0450911_002562 Ga0450911_002562_1553_1882 109
675 3300042121 Ga0450919_004619 Ga0450919_004619_1090_1419 109
676 3300042124 Ga0450922_005014 Ga0450922_005014_766_1095 109
677 3300042127 Ga0450890_009068 Ga0450890_009068_423_752 109
678 3300042138 Ga0450903_001202 Ga0450903_001202_3517_3846 109
679 3300042138 Ga0450903_027105 Ga0450903_027105_112_441 109
680 3300042139 Ga0450904_002418 Ga0450904_002418_157_486 109
681 3300042145 Ga0450906_001016 Ga0450906_001016_2135_2464 109
682 3300042146 Ga0450907_000132 Ga0450907_000132_4253_4582 109
683 3300042146 Ga0450907_002284 Ga0450907_002284_886_1215 109
684 3300042156 Ga0439446_0048341 Ga0439446_0048341_900_1229 109
685 3300042156 Ga0439446_0095575 Ga0439446_0095575_229_558 109
686 3300042184 Ga0450908_010073 Ga0450908_010073_758_1087 109
687 3300042185 Ga0450909_000513 Ga0450909_000513_1433_1762 109
688 3300042185 Ga0450909_006435 Ga0450909_006435_338_667 109
689 3300042435 Ga0439434_0013971 Ga0439434_0013971_1643_1972 109
690 3300042435 Ga0439434_0050199 Ga0439434_0050199_96_425 109
691 3300042439 Ga0439464_0091114 Ga0439464_0091114_296_625 109
692 3300042461 Ga0439460_0010100 Ga0439460_0010100_1177_1506 109
693 3300042461 Ga0439460_0027126 Ga0439460_0027126_201_530 109
694 3300042461 Ga0439460_0080341 Ga0439460_0080341_306_635 109
695 3300042531 Ga0450918_024898 Ga0450918_024898_481_810 109
696 3300042993 Ga0439440_0001741 Ga0439440_0001741_3181_3510 109
697 3300042993 Ga0439440_0069006 Ga0439440_0069006_272_601 109
698 3300046452 Ga0495617_000283 Ga0495617_000283_7008_7337 109
699 3300046452 Ga0495617_078830 Ga0495617_078830_412_741 109
700 3300046452 Ga0495617_213311 Ga0495617_213311_71_400 109
701 3300046455 Ga0495603_0025607 Ga0495603_0025607_1112_1441 109
702 3300046457 Ga0495590_0011489 Ga0495590_0011489_858_1187 109
703 3300046459 Ga0495629_1132748 Ga0495629_1132748_152_481 109
704 3300046460 Ga0495638_0129407 Ga0495638_0129407_1108_1437 109
705 3300046460 Ga0495638_0185583 Ga0495638_0185583_540_869 109
706 3300046471 Ga0495650_0016401 Ga0495650_0016401_783_1112 109
707 3300046471 Ga0495650_0046129 Ga0495650_0046129_441_770 109
708 3300046474 Ga0495605_0037777 Ga0495605_0037777_1966_2295 109
709 3300046474 Ga0495605_0041805 Ga0495605_0041805_732_1061 109
710 3300046475 Ga0495639_0000084 Ga0495639_0000084_7504_7833 109
711 3300046491 Ga0495584_0039580 Ga0495584_0039580_315_644 109
712 3300046491 Ga0495584_0063564 Ga0495584_0063564_1387_1716 109
713 3300046491 Ga0495584_0311381 Ga0495584_0311381_53_382 109
714 3300046492 Ga0495585_0000376 Ga0495585_0000376_38257_38586 109
715 3300046492 Ga0495585_0018706 Ga0495585_0018706_378_707 109
716 3300046492 Ga0495585_0021969 Ga0495585_0021969_1357_1686 109
717 3300046492 Ga0495585_0408694 Ga0495585_0408694_305_634 109
718 3300046499 Ga0495594_0154599 Ga0495594_0154599_491_820 109
719 3300046499 Ga0495594_0290023 Ga0495594_0290023_593_922 109
720 3300046501 Ga0495607_0000411 Ga0495607_0000411_19417_19746 109
721 3300046506 Ga0495583_0000400 Ga0495583_0000400_57620_57949 109
722 3300046506 Ga0495583_0069769 Ga0495583_0069769_263_592 109
723 3300046506 Ga0495583_0424385 Ga0495583_0424385_141_470 109
724 3300046513 Ga0495616_0004893 Ga0495616_0004893_6576_6905 109
725 3300046513 Ga0495616_0044286 Ga0495616_0044286_903_1232 109
726 3300046513 Ga0495616_0313887 Ga0495616_0313887_85_414 109
727 3300046518 Ga0495631_0254971 Ga0495631_0254971_113_442 109
728 3300046518 Ga0495631_0258166 Ga0495631_0258166_92_421 109
729 3300046518 Ga0495631_0298282 Ga0495631_0298282_233_562 109
730 3300046519 Ga0495632_0002918 Ga0495632_0002918_3849_4178 109
731 3300046519 Ga0495632_0008695 Ga0495632_0008695_4614_4943 109
732 3300046519 Ga0495632_0397041 Ga0495632_0397041_127_456 109
733 3300046520 Ga0495637_0050635 Ga0495637_0050635_1217_1546 109
734 3300046522 Ga0495643_0036467 Ga0495643_0036467_2015_2344 109
735 3300046523 Ga0495644_0089653 Ga0495644_0089653_183_512 109
736 3300046524 Ga0495648_0129249 Ga0495648_0129249_251_580 109
737 3300046528 Ga0495642_0002345 Ga0495642_0002345_2925_3254 109
738 3300046528 Ga0495642_0009699 Ga0495642_0009699_212_541 109
739 3300046530 Ga0495654_0040445 Ga0495654_0040445_186_515 109
740 3300046530 Ga0495654_0079310 Ga0495654_0079310_908_1237 109
741 3300046530 Ga0495654_0115183 Ga0495654_0115183_245_574 109
742 3300046538 Ga0495609_0002689 Ga0495609_0002689_2007_2336 109
743 3300046538 Ga0495609_0018340 Ga0495609_0018340_1290_1619 109
744 3300046542 Ga0495597_0017284 Ga0495597_0017284_2026_2355 109
745 3300046542 Ga0495597_0095649 Ga0495597_0095649_136_465 109
746 3300046542 Ga0495597_0129245 Ga0495597_0129245_234_563 109
747 3300046557 Ga0495622_0002066 Ga0495622_0002066_405_734 109
748 3300046557 Ga0495622_0236312 Ga0495622_0236312_392_721 109
749 3300046558 Ga0495633_0090448 Ga0495633_0090448_609_938 109
750 3300046615 Ga0495656_0000205 Ga0495656_0000205_5557_5886 109
751 3300046648 Ga0495611_0306625 Ga0495611_0306625_275_604 109
752 3300046648 Ga0495611_0423622 Ga0495611_0423622_111_440 109
753 3300046660 Ga0495625_0312970 Ga0495625_0312970_425_754 109
754 3300046664 Ga0495659_0000670 Ga0495659_0000670_6912_7241 109
755 3300046665 Ga0495661_0061114 Ga0495661_0061114_542_871 109
756 3300046674 Ga0495588_0355583 Ga0495588_0355583_170_499 109
757 3300046684 Ga0495669_0002549 Ga0495669_0002549_5105_5434 109
758 3300046691 Ga0495670_0280794 Ga0495670_0280794_273_602 109
759 3300046692 Ga0495671_0002361 Ga0495671_0002361_7941_8270 109
760 3300046692 Ga0495671_0032955 Ga0495671_0032955_454_783 109
761 3300046692 Ga0495671_0394720 Ga0495671_0394720_195_524 109
762 3300046694 Ga0495649_0001799 Ga0495649_0001799_4680_5009 109
763 3300046694 Ga0495649_0064239 Ga0495649_0064239_1498_1827 109
764 3300046794 Ga0495589_0000316 Ga0495589_0000316_21994_22323 109
765 3300046794 Ga0495589_0145021 Ga0495589_0145021_133_462 109
766 3300046810 Ga0495660_0007106 Ga0495660_0007106_417_746 109
767 3300046810 Ga0495660_0041285 Ga0495660_0041285_933_1262 109
768 3300046810 Ga0495660_0061495 Ga0495660_0061495_96_425 109
769 3300046810 Ga0495660_0350536 Ga0495660_0350536_244_573 109
770 3300046810 Ga0495660_0406577 Ga0495660_0406577_134_463 109
771 3300047315 Ga0495581_0273586 Ga0495581_0273586_359_688 109
772 3300047318 Ga0495636_0000241 Ga0495636_0000241_14776_15105 109
773 3300047320 Ga0495672_0000466 Ga0495672_0000466_36487_36816 109
774 3300047320 Ga0495672_0018305 Ga0495672_0018305_736_1065 109
775 3300047320 Ga0495672_0043913 Ga0495672_0043913_1859_2188 109
776 3300047323 Ga0495683_0003180 Ga0495683_0003180_4308_4637 109
777 3300047323 Ga0495683_0151608 Ga0495683_0151608_216_545 109
778 3300047323 Ga0495683_0226425 Ga0495683_0226425_410_739 109
779 3300047323 Ga0495683_0265317 Ga0495683_0265317_112_441 109
780 3300047443 Ga0495687_001366 Ga0495687_001366_230_559 109
781 3300047443 Ga0495687_032200 Ga0495687_032200_385_714 109
782 3300047445 Ga0495677_0008845 Ga0495677_0008845_1120_1449 109
783 3300047446 Ga0495679_174290 Ga0495679_174290_180_509 109
784 3300047447 Ga0495685_014811 Ga0495685_014811_1078_1407 109
785 3300047447 Ga0495685_038312 Ga0495685_038312_272_601 109
786 3300047469 Ga0495673_0003249 Ga0495673_0003249_4254_4583 109
787 3300047469 Ga0495673_0017462 Ga0495673_0017462_2864_3193 109
788 3300047469 Ga0495673_0116252 Ga0495673_0116252_491_820 109
789 3300047470 Ga0495681_0299889 Ga0495681_0299889_239_568 109
790 3300047472 Ga0495686_0203910 Ga0495686_0203910_706_1035 109
791 3300047673 Ga0495593_0443672 Ga0495593_0443672_117_446 109
792 3300048091 Ga0495626_0003523 Ga0495626_0003523_161_490 109
793 3300048091 Ga0495626_0037245 Ga0495626_0037245_1820_2149 109
794 3300048091 Ga0495626_0071096 Ga0495626_0071096_952_1281 109
795 3300048907 Ga0496104_1037636 Ga0496104_1037636_94_423 109
796 3300048908 Ga0496105_0770796 Ga0496105_0770796_353_682 109
797 3300048913 Ga0496110_0263998 Ga0496110_0263998_750_1079 109
798 3300048914 Ga0496111_0192805 Ga0496111_0192805_787_1116 109
799 3300048919 Ga0496116_0001088 Ga0496116_0001088_22568_22897 109
800 3300048921 Ga0496118_0236821 Ga0496118_0236821_91_420 109
801 3300048924 Ga0496121_0094195 Ga0496121_0094195_1592_1921 109
802 3300048925 Ga0496122_0078531 Ga0496122_0078531_1578_1907 109
803 3300048926 Ga0496123_0236169 Ga0496123_0236169_247_576 109
804 3300048928 Ga0496125_0067210 Ga0496125_0067210_803_1132 109
805 3300049459 Ga0495678_007309 Ga0495678_007309_1823_2152 109
806 3300049460 Ga0495682_0050924 Ga0495682_0050924_1121_1450 109

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bl3-assembly1.cif.gz_A de novo single-chain immunoglobulin dimer scig12 0.8179 37 95
7skp-assembly1.cif.gz_A de novo synthetic protein dig14 (tetragonal space group) 0.7799 35 109
7skp-assembly1.cif.gz_A de novo synthetic protein dig14 (tetragonal space group) 0.7606 35 109
2r39-assembly1.cif.gz_A crystal structure of fixg-related protein from vibrio parahaemolyticus 0.7343 36 90
6ej8-assembly1.cif.gz_A human xylosyltransferase 1 in complex with peptide qeeegsgggqgg 0.7256 47 91
ID Description Score Start End Superfamily
af_Q9JLF6_577_688_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7396 37 98 2.60.40.10
af_A0A0R4IGK8_587_684_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7227 37 109 2.60.40.10
af_P75946_22_124_2.60.40.3230 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7097 27 104 2.60.40.3230
af_A0A0P0WQ76_23_133_2.60.110.10 Mainly Beta;Sandwich;Thaumatin;Thaumatin 0.7053 50 88 2.60.110.10
af_Q54C11_302_426_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.7032 37 109 2.60.210.10
ID Description Score Start End GO Terms
AF-A0A7Y8CNG1-F1-model_v4 3-phosphoglycerate kinase 0.9901 25 109 GO:0016301
AF-A0A7Y8CNG1-F1-model_v4 3-phosphoglycerate kinase 0.9787 25 109 GO:0016301
AF-Q48LN0-F1-model_v4 3-phosphoglycerate kinase 0.9734 16 109
AF-Q48LN0-F1-model_v4 3-phosphoglycerate kinase 0.9634 16 109
AF-A0A5J6Q7N5-F1-model_v4 3-phosphoglycerate kinase 0.9504 16 109 GO:0016301

Feature Viewer

pLDDT pTM Quality
86.83 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map