F479962

General Info

Members Datasets Scaffolds Average Seq Length
768 250 1536 145

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0007847|Ga0495580_0007847_3521_4045
Length 174
Sequence VEGVSALAAAVGGSVRQRIGGVLLGKDSVTFRKYLVLAGVTLFAAIGDSLLARGMQQVGSISLQRLPDIVLTILNPWIALGILFLLGFFAAYMTALSWADLTYVLPATSLGYVLLALIAKFALHEQVTTTRWLGIAMISAGVGFVTQGPALTQHPHREDDTADVPEAVGSRTEP

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.03
Rhizosphere 92.32
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0007847 3300046472 Bacteria 8543
2 MRS1b_contig_5002604 2162886011 Bacteria 1077
3 MRS1b_contig_7249033 2162886011 Bacteria 1057
4 MBSR1b_contig_3580850 2162886012 Bacteria 835
5 MBSR1b_contig_811457 2162886012 Bacteria 997
6 rootH1_10349805 3300003323 Bacteria 1366
7 Ga0065715_10031876 3300005293 Bacteria 1807
8 Ga0070658_10104711 3300005327 Bacteria 2341
9 Ga0070658_11167003 3300005327 Unclassified 670
10 Ga0070676_10002681 3300005328 Bacteria 9167
11 Ga0070676_10319560 3300005328 Bacteria 1058
12 Ga0070683_100176032 3300005329 Bacteria 2031
13 Ga0070690_100055676 3300005330 Bacteria 2534
14 Ga0070690_100205082 3300005330 Unclassified 1374
15 Ga0070670_100118792 3300005331 Unclassified 2280
16 Ga0068869_100002642 3300005334 Bacteria 10827
17 Ga0068869_100082388 3300005334 Bacteria 2404
18 Ga0070666_10026756 3300005335 Bacteria 3772
19 Ga0070666_10542762 3300005335 Unclassified 845
20 Ga0070666_11296223 3300005335 Bacteria 543
21 Ga0070680_100019417 3300005336 Bacteria 5386
22 Ga0070680_100251410 3300005336 Bacteria 1494
23 Ga0070680_100277587 3300005336 Bacteria 1419
24 Ga0070682_100005343 3300005337 Bacteria 7146
25 Ga0070682_100038113 3300005337 Bacteria 2947
26 Ga0068868_100001093 3300005338 Bacteria 18565
27 Ga0068868_100002662 3300005338 Bacteria 12391
28 Ga0068868_100009989 3300005338 Bacteria 6858
29 Ga0068868_100122207 3300005338 Bacteria 2125
30 Ga0070660_100002495 3300005339 Bacteria 12634
31 Ga0070660_100108688 3300005339 Unclassified 2204
32 Ga0070660_100114516 3300005339 Unclassified 2148
33 Ga0070689_100191493 3300005340 Bacteria 1665
34 Ga0070689_101999086 3300005340 Unclassified 530
35 Ga0070691_10056535 3300005341 Unclassified 1880
36 Ga0070691_10140497 3300005341 Bacteria 1230
37 Ga0070691_10176812 3300005341 Unclassified 1109
38 Ga0070687_100069578 3300005343 Bacteria 1885
39 Ga0070661_100011816 3300005344 Bacteria 6093
40 Ga0070661_100058732 3300005344 Unclassified 2819
41 Ga0070661_100069143 3300005344 Unclassified 2596
42 Ga0070661_101254651 3300005344 Unclassified 621
43 Ga0070692_10918440 3300005345 Unclassified 606
44 Ga0070668_100015251 3300005347 Bacteria 5741
45 Ga0070669_100948378 3300005353 Unclassified 736
46 Ga0070675_100244629 3300005354 Bacteria 1568
47 Ga0070671_100263578 3300005355 Unclassified 1465
48 Ga0070671_100941976 3300005355 Bacteria 755
49 Ga0070674_101528839 3300005356 Unclassified 600
50 Ga0070673_100104851 3300005364 Bacteria 2335
51 Ga0070659_100296448 3300005366 Bacteria 1347
52 Ga0070659_100589686 3300005366 Unclassified 954
53 Ga0070667_100018130 3300005367 Bacteria 5837
54 Ga0070667_100364569 3300005367 Bacteria 1310
55 Ga0070709_10037593 3300005434 Unclassified 2957
56 Ga0070709_10164562 3300005434 Bacteria 1545
57 Ga0070709_10196834 3300005434 Unclassified 1425
58 Ga0070709_10376543 3300005434 Unclassified 1054
59 Ga0070709_10539412 3300005434 Bacteria 891
60 Ga0070714_100004400 3300005435 Bacteria 10605
61 Ga0070714_100081064 3300005435 Bacteria 2825
62 Ga0070714_100101011 3300005435 Unclassified 2541
63 Ga0070714_100181365 3300005435 Bacteria 1916
64 Ga0070714_100210511 3300005435 Bacteria 1782
65 Ga0070714_100545879 3300005435 Unclassified 1109
66 Ga0070714_101502988 3300005435 Bacteria 658
67 Ga0070713_100001793 3300005436 Bacteria 13835
68 Ga0070713_100002728 3300005436 Bacteria 11538
69 Ga0070713_100026803 3300005436 Bacteria 4531
70 Ga0070713_100038787 3300005436 Bacteria 3863
71 Ga0070713_100050473 3300005436 Bacteria 3437
72 Ga0070713_100067903 3300005436 Bacteria 3003
73 Ga0070713_100198284 3300005436 Unclassified 1812
74 Ga0070713_100468777 3300005436 Viruses 1185
75 Ga0070713_100622215 3300005436 Unclassified 1027
76 Ga0070713_101376632 3300005436 Bacteria 684
77 Ga0070710_10004541 3300005437 Bacteria 6562
78 Ga0070710_10029157 3300005437 Bacteria 2958
79 Ga0070710_10288547 3300005437 Unclassified 1067
80 Ga0070710_10297351 3300005437 Unclassified 1053
81 Ga0070710_11143150 3300005437 Bacteria 573
82 Ga0070711_100000134 3300005439 Bacteria 39588
83 Ga0070711_100001421 3300005439 Bacteria 13141
84 Ga0070711_100149713 3300005439 Bacteria 1759
85 Ga0070711_100320102 3300005439 Bacteria 1239
86 Ga0070711_100347162 3300005439 Bacteria 1192
87 Ga0070711_101038246 3300005439 Unclassified 704
88 Ga0070708_100070400 3300005445 Bacteria 3146
89 Ga0070708_101528867 3300005445 Unclassified 622
90 Ga0070678_100348930 3300005456 Bacteria 1272
91 Ga0070678_101481904 3300005456 Unclassified 635
92 Ga0070681_10007515 3300005458 Bacteria 10652
93 Ga0070681_10015864 3300005458 Bacteria 7510
94 Ga0070681_10058261 3300005458 Unclassified 3843
95 Ga0070681_10150080 3300005458 Bacteria 2257
96 Ga0070681_10381847 3300005458 Bacteria 1319
97 Ga0070681_10842545 3300005458 Unclassified 834
98 Ga0070681_11796362 3300005458 Unclassified 540
99 Ga0068867_100001428 3300005459 Bacteria 16539
100 Ga0068867_100063383 3300005459 Bacteria 2747
101 Ga0068867_100996093 3300005459 Unclassified 759
102 Ga0070685_10083500 3300005466 Bacteria 1919
103 Ga0070685_10086676 3300005466 Bacteria 1888
104 Ga0070706_100002012 3300005467 Bacteria 20871
105 Ga0070706_100012010 3300005467 Bacteria 8037
106 Ga0070707_100002271 3300005468 Bacteria 18359
107 Ga0070707_100016149 3300005468 Bacteria 7006
108 Ga0070707_100251075 3300005468 Bacteria 1722
109 Ga0070707_100365111 3300005468 Bacteria 1402
110 Ga0070707_100572360 3300005468 Bacteria 1092
111 Ga0070698_100005374 3300005471 Bacteria 14006
112 Ga0070698_100032051 3300005471 Bacteria 5446
113 Ga0070698_100112382 3300005471 Bacteria 2689
114 Ga0070698_100127120 3300005471 Unclassified 2506
115 Ga0070699_100001773 3300005518 Bacteria 19653
116 Ga0070699_100004897 3300005518 Bacteria 11805
117 Ga0070699_100026812 3300005518 Bacteria 4971
118 Ga0070699_100082677 3300005518 Bacteria 2800
119 Ga0070699_100785620 3300005518 Unclassified 871
120 Ga0070699_100991979 3300005518 Bacteria 770
121 Ga0070679_100030397 3300005530 Bacteria 5333
122 Ga0070679_100074094 3300005530 Bacteria 3395
123 Ga0070679_100145493 3300005530 Bacteria 2348
124 Ga0070679_100213049 3300005530 Bacteria 1895
125 Ga0070679_100319970 3300005530 Bacteria 1501
126 Ga0070679_101490955 3300005530 Bacteria 623
127 Ga0070684_100031783 3300005535 Unclassified 4496
128 Ga0070684_100077535 3300005535 Bacteria 2935
129 Ga0070684_100079441 3300005535 Unclassified 2900
130 Ga0070684_100215472 3300005535 Unclassified 1751
131 Ga0070684_100478620 3300005535 Bacteria 1152
132 Ga0070697_100000787 3300005536 Bacteria 23824
133 Ga0070697_100000848 3300005536 Bacteria 23001
134 Ga0070697_100004394 3300005536 Bacteria 10821
135 Ga0070697_100004644 3300005536 Bacteria 10537
136 Ga0070697_100082011 3300005536 Bacteria 2658
137 Ga0070697_100110058 3300005536 Unclassified 2295
138 Ga0070697_100749687 3300005536 Unclassified 863
139 Ga0068853_100003364 3300005539 Bacteria 12237
140 Ga0068853_100063473 3300005539 Bacteria 3199
141 Ga0068853_100114422 3300005539 Unclassified 2400
142 Ga0068853_100210328 3300005539 Bacteria 1773
143 Ga0070672_101058054 3300005543 Bacteria 720
144 Ga0070695_100330170 3300005545 Unclassified 1137
145 Ga0070696_100060011 3300005546 Bacteria 2659
146 Ga0070696_100146243 3300005546 Bacteria 1731
147 Ga0070696_100608993 3300005546 Unclassified 881
148 Ga0070693_100006629 3300005547 Bacteria 5621
149 Ga0070693_100099493 3300005547 Bacteria 1769
150 Ga0070693_100195091 3300005547 Bacteria 1312
151 Ga0070693_100546357 3300005547 Bacteria 829
152 Ga0070665_100243473 3300005548 Unclassified 1799
153 Ga0070665_100337019 3300005548 Unclassified 1513
154 Ga0068855_100000952 3300005563 Bacteria 36034
155 Ga0068855_100006023 3300005563 Bacteria 14793
156 Ga0068855_100050650 3300005563 Bacteria 4893
157 Ga0068855_100116711 3300005563 Unclassified 3059
158 Ga0068855_100171438 3300005563 Unclassified 2457
159 Ga0068855_100349368 3300005563 Bacteria 1629
160 Ga0068855_100458634 3300005563 Bacteria 1390
161 Ga0070664_100000278 3300005564 Bacteria 36897
162 Ga0070664_100050503 3300005564 Bacteria 3520
163 Ga0070664_100078822 3300005564 Bacteria 2834
164 Ga0070664_100150639 3300005564 Bacteria 2053
165 Ga0068857_100000113 3300005577 Bacteria 48281
166 Ga0068857_100001051 3300005577 Bacteria 21364
167 Ga0068854_100001102 3300005578 Bacteria 16252
168 Ga0068854_100007179 3300005578 Bacteria 7113
169 Ga0068854_100030695 3300005578 Bacteria 3729
170 Ga0068854_100058545 3300005578 Bacteria 2782
171 Ga0068854_100072560 3300005578 Bacteria 2521
172 Ga0068854_100135439 3300005578 Bacteria 1885
173 Ga0068854_100459995 3300005578 Unclassified 1064
174 Ga0068856_100000096 3300005614 Bacteria 83677
175 Ga0068856_100000243 3300005614 Bacteria 59277
176 Ga0068856_100000305 3300005614 Bacteria 53825
177 Ga0068856_100004911 3300005614 Bacteria 13234
178 Ga0068856_100019755 3300005614 Bacteria 6537
179 Ga0068856_100023670 3300005614 Bacteria 5972
180 Ga0068856_100165545 3300005614 Bacteria 2222
181 Ga0068856_100432135 3300005614 Bacteria 1337
182 Ga0068856_100878855 3300005614 Unclassified 915
183 Ga0068856_100976843 3300005614 Bacteria 865
184 Ga0070702_100134750 3300005615 Bacteria 1565
185 Ga0068852_100063207 3300005616 Bacteria 3223
186 Ga0068852_100277769 3300005616 Bacteria 1614
187 Ga0068852_101353467 3300005616 Unclassified 734
188 Ga0068859_100013832 3300005617 Bacteria 8093
189 Ga0068859_100019022 3300005617 Bacteria 6897
190 Ga0068859_100026605 3300005617 Bacteria 5802
191 Ga0068864_100008229 3300005618 Bacteria 8602
192 Ga0068864_100029331 3300005618 Unclassified 4658
193 Ga0068864_100104714 3300005618 Bacteria 2514
194 Ga0068864_100207964 3300005618 Bacteria 1801
195 Ga0068866_10027059 3300005718 Bacteria 2715
196 Ga0068866_10144522 3300005718 Unclassified 1370
197 Ga0068866_10320870 3300005718 Bacteria 974
198 Ga0068866_10326263 3300005718 Unclassified 967
199 Ga0068861_100027884 3300005719 Unclassified 4118
200 Ga0068861_100254498 3300005719 Bacteria 1500
201 Ga0068851_10233504 3300005834 Bacteria 1038
202 Ga0068870_10031720 3300005840 Unclassified 2679
203 Ga0068863_100018791 3300005841 Bacteria 6615
204 Ga0068863_100089090 3300005841 Bacteria 2925
205 Ga0068863_100171500 3300005841 Bacteria 2081
206 Ga0068863_100828020 3300005841 Unclassified 924
207 Ga0068858_100007462 3300005842 Bacteria 10569
208 Ga0068858_100010774 3300005842 Bacteria 8645
209 Ga0068858_100014219 3300005842 Bacteria 7504
210 Ga0068858_100017328 3300005842 Bacteria 6756
211 Ga0068858_100106617 3300005842 Bacteria 2615
212 Ga0068858_100639747 3300005842 Unclassified 1033
213 Ga0068860_100013351 3300005843 Bacteria 8053
214 Ga0068860_100036976 3300005843 Unclassified 4675
215 Ga0068860_100041849 3300005843 Bacteria 4376
216 Ga0068860_100129861 3300005843 Bacteria 2417
217 Ga0068860_100402056 3300005843 Bacteria 1355
218 Ga0068862_100066679 3300005844 Bacteria 3102
219 Ga0068862_100691408 3300005844 Bacteria 987
220 Ga0081540_1066214 3300005983 Bacteria 1694
221 Ga0070717_10000272 3300006028 Bacteria 35378
222 Ga0070717_10019597 3300006028 Bacteria 5309
223 Ga0070717_10047675 3300006028 Bacteria 3511
224 Ga0070717_10081496 3300006028 Bacteria 2717
225 Ga0070717_10089478 3300006028 Bacteria 2596
226 Ga0070717_10172633 3300006028 Bacteria 1881
227 Ga0070717_10191421 3300006028 Bacteria 1787
228 Ga0070717_10196776 3300006028 Bacteria 1763
229 Ga0070717_10215036 3300006028 Unclassified 1688
230 Ga0070717_10424471 3300006028 Unclassified 1196
231 Ga0070717_11091969 3300006028 Unclassified 727
232 Ga0070715_10002078 3300006163 Bacteria 6047
233 Ga0070715_10047854 3300006163 Bacteria 1825
234 Ga0070715_10075645 3300006163 Bacteria 1515
235 Ga0070715_10954706 3300006163 Unclassified 531
236 Ga0070716_100002299 3300006173 Bacteria 8798
237 Ga0070716_100010019 3300006173 Bacteria 4739
238 Ga0070716_100698708 3300006173 Unclassified 775
239 Ga0070716_101028413 3300006173 Unclassified 653
240 Ga0070712_100002354 3300006175 Bacteria 11640
241 Ga0070712_100009039 3300006175 Bacteria 6275
242 Ga0070712_100037797 3300006175 Bacteria 3293
243 Ga0070712_100714628 3300006175 Bacteria 855
244 Ga0070712_100729719 3300006175 Unclassified 847
245 Ga0070712_100871898 3300006175 Unclassified 775
246 Ga0097621_100000022 3300006237 Bacteria 85005
247 Ga0097621_100000562 3300006237 Bacteria 26047
248 Ga0097621_100000973 3300006237 Bacteria 20072
249 Ga0097621_100023646 3300006237 Unclassified 4787
250 Ga0097621_100028404 3300006237 Bacteria 4408
251 Ga0097621_100036826 3300006237 Bacteria 3915
252 Ga0068871_100000149 3300006358 Bacteria 46054
253 Ga0068871_100001873 3300006358 Bacteria 14228
254 Ga0068871_100004140 3300006358 Bacteria 10033
255 Ga0068871_100016575 3300006358 Bacteria 5554
256 Ga0068871_100017817 3300006358 Bacteria 5384
257 Ga0068871_100044356 3300006358 Unclassified 3576
258 Ga0068871_100095458 3300006358 Bacteria 2483
259 Ga0068871_100418380 3300006358 Unclassified 1196
260 Ga0075434_100572977 3300006871 Unclassified 1148
261 Ga0068865_100037462 3300006881 Bacteria 3275
262 Ga0068865_100056710 3300006881 Bacteria 2730
263 Ga0068865_100348692 3300006881 Bacteria 1199
264 Ga0068865_101118456 3300006881 Unclassified 694
265 Ga0075436_100000675 3300006914 Bacteria 22482
266 Ga0075436_100001370 3300006914 Bacteria 16601
267 Ga0075436_100089685 3300006914 Bacteria 2137
268 Ga0075436_100174060 3300006914 Unclassified 1520
269 Ga0075436_100442831 3300006914 Unclassified 945
270 Ga0097620_100013832 3300006931 Bacteria 8093
271 Ga0097620_100019022 3300006931 Bacteria 6897
272 Ga0097620_100026604 3300006931 Bacteria 5802
273 Ga0075435_100019517 3300007076 Bacteria 5181
274 Ga0075435_100110320 3300007076 Bacteria 2288
275 Ga0099794_10308158 3300007265 Unclassified 820
276 Ga0105250_10088315 3300009092 Bacteria 1259
277 Ga0105240_10008809 3300009093 Bacteria 14372
278 Ga0105240_10012839 3300009093 Bacteria 11538
279 Ga0105240_10017033 3300009093 Bacteria 9816
280 Ga0105240_10049586 3300009093 Bacteria 5298
281 Ga0105240_10131193 3300009093 Bacteria 3006
282 Ga0105240_10137150 3300009093 Bacteria 2929
283 Ga0105240_10275369 3300009093 Bacteria 1936
284 Ga0105240_10395923 3300009093 Bacteria 1557
285 Ga0105240_10734035 3300009093 Bacteria 1075
286 Ga0105245_10176972 3300009098 Bacteria 2035
287 Ga0105245_10216824 3300009098 Unclassified 1844
288 Ga0105245_11586553 3300009098 Unclassified 706
289 Ga0105245_11634609 3300009098 Unclassified 696
290 Ga0105247_10014022 3300009101 Bacteria 4807
291 Ga0105247_10094205 3300009101 Bacteria 1905
292 Ga0105247_10708118 3300009101 Unclassified 759
293 Ga0105243_10037217 3300009148 Bacteria 3780
294 Ga0105241_10014054 3300009174 Bacteria 5867
295 Ga0105241_10037583 3300009174 Bacteria 3648
296 Ga0105241_10042698 3300009174 Bacteria 3432
297 Ga0105241_10067950 3300009174 Unclassified 2760
298 Ga0105241_10204359 3300009174 Bacteria 1652
299 Ga0105241_10818254 3300009174 Bacteria 859
300 Ga0105242_10014307 3300009176 Bacteria 6146
301 Ga0105242_10135356 3300009176 Bacteria 2132
302 Ga0105248_10013856 3300009177 Bacteria 8870
303 Ga0105248_10032942 3300009177 Bacteria 5788
304 Ga0105248_10103581 3300009177 Bacteria 3208
305 Ga0105237_10014873 3300009545 Bacteria 8117
306 Ga0105237_10080775 3300009545 Bacteria 3242
307 Ga0105237_10275221 3300009545 Bacteria 1686
308 Ga0105237_10275444 3300009545 Bacteria 1685
309 Ga0105237_10287891 3300009545 Bacteria 1646
310 Ga0105238_10000644 3300009551 Bacteria 36743
311 Ga0105238_10008225 3300009551 Bacteria 10434
312 Ga0105238_10036914 3300009551 Bacteria 4969
313 Ga0105238_10089046 3300009551 Bacteria 3073
314 Ga0105238_10183301 3300009551 Bacteria 2070
315 Ga0105238_10802078 3300009551 Bacteria 957
316 Ga0105249_10060987 3300009553 Bacteria 3461
317 Ga0105249_10807565 3300009553 Unclassified 1002
318 Ga0105239_10083240 3300010375 Bacteria 3523
319 Ga0105239_10104189 3300010375 Bacteria 3141
320 Ga0105239_10376704 3300010375 Bacteria 1604
321 Ga0105239_11242068 3300010375 Bacteria 859
322 Ga0105239_11807363 3300010375 Unclassified 708
323 Ga0105246_10041577 3300011119 Unclassified 3108
324 Ga0105246_10486714 3300011119 Unclassified 1045
325 Ga0157373_10046387 3300013100 Unclassified 3100
326 Ga0157373_10060981 3300013100 Unclassified 2672
327 Ga0157373_10065247 3300013100 Unclassified 2576
328 Ga0157373_10154860 3300013100 Bacteria 1612
329 Ga0157373_10200977 3300013100 Bacteria 1405
330 Ga0157373_11307798 3300013100 Bacteria 549
331 Ga0157371_10010259 3300013102 Bacteria 7311
332 Ga0157371_10056733 3300013102 Bacteria 2778
333 Ga0157371_10057042 3300013102 Bacteria 2769
334 Ga0157370_10019816 3300013104 Bacteria 6731
335 Ga0157370_10621140 3300013104 Unclassified 989
336 Ga0157370_11290260 3300013104 Unclassified 658
337 Ga0157369_10000034 3300013105 Bacteria 200710
338 Ga0157369_10017221 3300013105 Bacteria 8121
339 Ga0157369_10020372 3300013105 Bacteria 7413
340 Ga0157369_10064889 3300013105 Bacteria 3932
341 Ga0157369_10071544 3300013105 Unclassified 3723
342 Ga0157369_10498783 3300013105 Unclassified 1259
343 Ga0157369_11221901 3300013105 Unclassified 767
344 Ga0157374_10000052 3300013296 Bacteria 125138
345 Ga0157374_10001074 3300013296 Bacteria 23713
346 Ga0157374_10001307 3300013296 Bacteria 21210
347 Ga0157374_10005336 3300013296 Bacteria 10792
348 Ga0157374_10073458 3300013296 Bacteria 3228
349 Ga0157374_10280356 3300013296 Bacteria 1645
350 Ga0157374_10534332 3300013296 Bacteria 1179
351 Ga0157374_10830520 3300013296 Unclassified 940
352 Ga0157378_10000227 3300013297 Bacteria 54885
353 Ga0157378_10001800 3300013297 Bacteria 19248
354 Ga0157378_10046182 3300013297 Bacteria 3872
355 Ga0157378_10091458 3300013297 Bacteria 2766
356 Ga0157378_10243214 3300013297 Bacteria 1720
357 Ga0157378_10274304 3300013297 Bacteria 1623
358 Ga0163162_10001445 3300013306 Bacteria 22101
359 Ga0163162_10003919 3300013306 Bacteria 14291
360 Ga0163162_11032718 3300013306 Bacteria 930
361 Ga0157372_10000585 3300013307 Bacteria 39797
362 Ga0157372_10003253 3300013307 Bacteria 17560
363 Ga0157372_10003378 3300013307 Bacteria 17218
364 Ga0157372_10023442 3300013307 Bacteria 6691
365 Ga0157372_10029829 3300013307 Bacteria 5961
366 Ga0157372_10252931 3300013307 Unclassified 2045
367 Ga0157372_10826023 3300013307 Bacteria 1076
368 Ga0157372_11808418 3300013307 Unclassified 702
369 Ga0157375_10077230 3300013308 Unclassified 3359
370 Ga0157375_10536210 3300013308 Bacteria 1333
371 Ga0163163_10102612 3300014325 Bacteria 2884
372 Ga0163163_10128601 3300014325 Bacteria 2572
373 Ga0163163_12541243 3300014325 Unclassified 570
374 Ga0182008_10072486 3300014497 Bacteria 1694
375 Ga0182008_10299831 3300014497 Unclassified 841
376 Ga0157379_10001079 3300014968 Bacteria 22250
377 Ga0157379_10052368 3300014968 Bacteria 3646
378 Ga0157379_10060792 3300014968 Bacteria 3378
379 Ga0157376_10025944 3300014969 Bacteria 4624
380 Ga0157376_10095723 3300014969 Bacteria 2582
381 Ga0157376_10116275 3300014969 Bacteria 2363
382 Ga0157376_10498926 3300014969 Bacteria 1196
383 Ga0182006_1025513 3300015261 Bacteria 2427
384 Ga0182007_10014155 3300015262 Bacteria 3017
385 Ga0213874_10174851 3300021377 Bacteria 761
386 Ga0224572_1016593 3300024225 Unclassified 1412
387 Ga0228598_1000112 3300024227 Bacteria 13605
388 Ga0207656_10062568 3300025321 Bacteria 1636
389 Ga0207692_10025539 3300025898 Bacteria 2761
390 Ga0207692_10031458 3300025898 Bacteria 2542
391 Ga0207692_10038389 3300025898 Bacteria 2348
392 Ga0207642_10013957 3300025899 Bacteria 2948
393 Ga0207642_10017155 3300025899 Bacteria 2747
394 Ga0207710_10091922 3300025900 Bacteria 1421
395 Ga0207710_10299007 3300025900 Unclassified 813
396 Ga0207647_10002181 3300025904 Bacteria 14929
397 Ga0207685_10017356 3300025905 Bacteria 2324
398 Ga0207685_10288739 3300025905 Unclassified 808
399 Ga0207699_10013995 3300025906 Bacteria 4122
400 Ga0207699_10035499 3300025906 Bacteria 2837
401 Ga0207699_10059957 3300025906 Unclassified 2283
402 Ga0207699_10087220 3300025906 Bacteria 1951
403 Ga0207699_10137860 3300025906 Bacteria 1600
404 Ga0207645_10451762 3300025907 Bacteria 868
405 Ga0207643_10087558 3300025908 Bacteria 1811
406 Ga0207705_10152377 3300025909 Bacteria 1733
407 Ga0207684_10000426 3300025910 Bacteria 56031
408 Ga0207684_10003981 3300025910 Bacteria 14143
409 Ga0207684_10033139 3300025910 Unclassified 4394
410 Ga0207684_10405673 3300025910 Unclassified 1172
411 Ga0207654_10110343 3300025911 Bacteria 1711
412 Ga0207654_10123078 3300025911 Bacteria 1632
413 Ga0207654_10242013 3300025911 Bacteria 1206
414 Ga0207654_10266137 3300025911 Unclassified 1155
415 Ga0207654_10318027 3300025911 Unclassified 1063
416 Ga0207707_10000496 3300025912 Bacteria 40443
417 Ga0207707_10051856 3300025912 Unclassified 3573
418 Ga0207707_10084302 3300025912 Unclassified 2776
419 Ga0207707_10136782 3300025912 Bacteria 2142
420 Ga0207707_10201683 3300025912 Unclassified 1734
421 Ga0207707_10296753 3300025912 Unclassified 1398
422 Ga0207707_10336495 3300025912 Unclassified 1302
423 Ga0207707_10372790 3300025912 Bacteria 1228
424 Ga0207707_10672326 3300025912 Bacteria 871
425 Ga0207695_10010044 3300025913 Bacteria 11623
426 Ga0207695_10012834 3300025913 Bacteria 10032
427 Ga0207695_10042465 3300025913 Bacteria 4856
428 Ga0207695_10076540 3300025913 Bacteria 3401
429 Ga0207695_10121405 3300025913 Bacteria 2580
430 Ga0207695_10122254 3300025913 Unclassified 2570
431 Ga0207695_10560788 3300025913 Bacteria 1024
432 Ga0207695_11166878 3300025913 Unclassified 650
433 Ga0207671_10263879 3300025914 Bacteria 1356
434 Ga0207671_10369414 3300025914 Bacteria 1139
435 Ga0207671_10588828 3300025914 Unclassified 887
436 Ga0207671_10735008 3300025914 Unclassified 784
437 Ga0207693_10000004 3300025915 Bacteria 193261
438 Ga0207693_10000096 3300025915 Bacteria 78447
439 Ga0207693_10016437 3300025915 Bacteria 5912
440 Ga0207693_10017348 3300025915 Bacteria 5742
441 Ga0207693_10098631 3300025915 Bacteria 2291
442 Ga0207663_10000911 3300025916 Bacteria 13508
443 Ga0207663_10015586 3300025916 Bacteria 4197
444 Ga0207663_10020796 3300025916 Bacteria 3724
445 Ga0207663_10262091 3300025916 Bacteria 1277
446 Ga0207663_10331785 3300025916 Bacteria 1146
447 Ga0207663_10895027 3300025916 Unclassified 709
448 Ga0207663_10896908 3300025916 Unclassified 709
449 Ga0207660_10016655 3300025917 Bacteria 4870
450 Ga0207657_10000321 3300025919 Bacteria 51030
451 Ga0207657_10000830 3300025919 Bacteria 32651
452 Ga0207657_10721512 3300025919 Unclassified 773
453 Ga0207649_10039059 3300025920 Unclassified 2876
454 Ga0207649_10175128 3300025920 Bacteria 1497
455 Ga0207652_10003101 3300025921 Bacteria 13852
456 Ga0207652_10114084 3300025921 Bacteria 2399
457 Ga0207652_10189261 3300025921 Bacteria 1851
458 Ga0207652_10250514 3300025921 Bacteria 1597
459 Ga0207646_10000614 3300025922 Bacteria 46404
460 Ga0207646_10004278 3300025922 Bacteria 15583
461 Ga0207646_10018303 3300025922 Bacteria 6537
462 Ga0207646_10107450 3300025922 Bacteria 2503
463 Ga0207646_10304531 3300025922 Unclassified 1440
464 Ga0207646_10361515 3300025922 Bacteria 1311
465 Ga0207646_10414654 3300025922 Bacteria 1216
466 Ga0207681_10203047 3300025923 Bacteria 1523
467 Ga0207694_10000250 3300025924 Bacteria 51411
468 Ga0207694_10062507 3300025924 Unclassified 2899
469 Ga0207694_10297014 3300025924 Unclassified 1329
470 Ga0207694_10598042 3300025924 Bacteria 928
471 Ga0207650_10032393 3300025925 Unclassified 3781
472 Ga0207687_10057265 3300025927 Bacteria 2738
473 Ga0207687_10080892 3300025927 Bacteria 2346
474 Ga0207687_10157084 3300025927 Unclassified 1741
475 Ga0207687_10402114 3300025927 Bacteria 1126
476 Ga0207700_10004509 3300025928 Bacteria 8222
477 Ga0207700_10009460 3300025928 Bacteria 6090
478 Ga0207700_10011753 3300025928 Bacteria 5602
479 Ga0207700_10012917 3300025928 Bacteria 5406
480 Ga0207700_10017506 3300025928 Bacteria 4789
481 Ga0207700_10052188 3300025928 Bacteria 3056
482 Ga0207700_10098543 3300025928 Bacteria 2325
483 Ga0207700_10282797 3300025928 Bacteria 1427
484 Ga0207700_10340908 3300025928 Bacteria 1303
485 Ga0207700_10468606 3300025928 Unclassified 1112
486 Ga0207700_10792206 3300025928 Unclassified 848
487 Ga0207700_11075937 3300025928 Unclassified 719
488 Ga0207700_11289487 3300025928 Unclassified 651
489 Ga0207664_10000636 3300025929 Bacteria 24367
490 Ga0207664_10017803 3300025929 Bacteria 5220
491 Ga0207664_10020398 3300025929 Bacteria 4911
492 Ga0207664_10062293 3300025929 Bacteria 2979
493 Ga0207664_10078674 3300025929 Bacteria 2675
494 Ga0207664_10083866 3300025929 Bacteria 2598
495 Ga0207664_10111361 3300025929 Bacteria 2277
496 Ga0207664_10236894 3300025929 Bacteria 1588
497 Ga0207664_10466956 3300025929 Viruses 1128
498 Ga0207664_11079600 3300025929 Bacteria 718
499 Ga0207644_11214408 3300025931 Bacteria 634
500 Ga0207690_10117999 3300025932 Bacteria 1922
501 Ga0207690_10603387 3300025932 Bacteria 896
502 Ga0207706_10000370 3300025933 Bacteria 48701
503 Ga0207706_10038235 3300025933 Bacteria 4257
504 Ga0207706_10127021 3300025933 Unclassified 2242
505 Ga0207686_10028856 3300025934 Bacteria 3266
506 Ga0207686_10085871 3300025934 Bacteria 2065
507 Ga0207670_10094510 3300025936 Unclassified 2121
508 Ga0207670_11482304 3300025936 Unclassified 577
509 Ga0207704_10127946 3300025938 Bacteria 1753
510 Ga0207704_10918411 3300025938 Unclassified 737
511 Ga0207665_10017156 3300025939 Bacteria 4757
512 Ga0207665_10024061 3300025939 Bacteria 4013
513 Ga0207665_10044657 3300025939 Unclassified 2965
514 Ga0207665_10080122 3300025939 Bacteria 2246
515 Ga0207665_10303292 3300025939 Bacteria 1194
516 Ga0207665_10332842 3300025939 Bacteria 1142
517 Ga0207691_10396879 3300025940 Unclassified 1177
518 Ga0207691_10684651 3300025940 Unclassified 865
519 Ga0207691_10691789 3300025940 Unclassified 860
520 Ga0207711_10023956 3300025941 Bacteria 5109
521 Ga0207711_10183464 3300025941 Bacteria 1904
522 Ga0207711_10201887 3300025941 Bacteria 1814
523 Ga0207711_10399399 3300025941 Bacteria 1277
524 Ga0207711_11670004 3300025941 Bacteria 580
525 Ga0207689_10013884 3300025942 Bacteria 6860
526 Ga0207689_10048522 3300025942 Unclassified 3502
527 Ga0207689_10057406 3300025942 Bacteria 3203
528 Ga0207661_10114833 3300025944 Bacteria 2283
529 Ga0207661_10203540 3300025944 Bacteria 1741
530 Ga0207679_10004663 3300025945 Bacteria 8539
531 Ga0207679_10038194 3300025945 Bacteria 3419
532 Ga0207679_10043033 3300025945 Bacteria 3249
533 Ga0207679_10107008 3300025945 Bacteria 2199
534 Ga0207667_10000996 3300025949 Bacteria 36261
535 Ga0207667_10007025 3300025949 Bacteria 13599
536 Ga0207667_10010971 3300025949 Bacteria 10560
537 Ga0207667_10107611 3300025949 Unclassified 2877
538 Ga0207667_10346903 3300025949 Bacteria 1514
539 Ga0207651_10099496 3300025960 Bacteria 2154
540 Ga0207712_10025235 3300025961 Bacteria 3948
541 Ga0207668_10006101 3300025972 Bacteria 7107
542 Ga0207640_10023771 3300025981 Bacteria 3688
543 Ga0207640_10030456 3300025981 Bacteria 3323
544 Ga0207640_10211112 3300025981 Bacteria 1479
545 Ga0207658_10070764 3300025986 Bacteria 2640
546 Ga0207658_10700680 3300025986 Bacteria 915
547 Ga0207677_10001021 3300026023 Bacteria 15424
548 Ga0207677_10017918 3300026023 Bacteria 4238
549 Ga0207677_10047462 3300026023 Bacteria 2884
550 Ga0207677_10076163 3300026023 Bacteria 2387
551 Ga0207677_10078740 3300026023 Bacteria 2355
552 Ga0207677_10124843 3300026023 Unclassified 1943
553 Ga0207703_10009051 3300026035 Bacteria 7841
554 Ga0207703_10009521 3300026035 Bacteria 7622
555 Ga0207703_10018786 3300026035 Bacteria 5397
556 Ga0207703_10077486 3300026035 Unclassified 2760
557 Ga0207703_10646232 3300026035 Bacteria 1003
558 Ga0207639_10036730 3300026041 Bacteria 3633
559 Ga0207639_10056811 3300026041 Unclassified 3001
560 Ga0207639_10159479 3300026041 Bacteria 1899
561 Ga0207639_10201849 3300026041 Bacteria 1706
562 Ga0207678_10002740 3300026067 Bacteria 15957
563 Ga0207702_10006631 3300026078 Bacteria 9955
564 Ga0207702_10011612 3300026078 Bacteria 7340
565 Ga0207702_10018995 3300026078 Bacteria 5687
566 Ga0207702_10019240 3300026078 Bacteria 5649
567 Ga0207702_10021063 3300026078 Bacteria 5395
568 Ga0207702_10022194 3300026078 Bacteria 5262
569 Ga0207702_10210982 3300026078 Bacteria 1805
570 Ga0207702_11396473 3300026078 Unclassified 694
571 Ga0207641_10018032 3300026088 Bacteria 5785
572 Ga0207641_10140161 3300026088 Unclassified 2181
573 Ga0207641_10154153 3300026088 Bacteria 2083
574 Ga0207641_10237198 3300026088 Bacteria 1698
575 Ga0207648_10024771 3300026089 Bacteria 5353
576 Ga0207648_10027559 3300026089 Bacteria 5044
577 Ga0207648_10381109 3300026089 Bacteria 1275
578 Ga0207676_10011829 3300026095 Bacteria 6243
579 Ga0207676_10060741 3300026095 Bacteria 2991
580 Ga0207676_10082329 3300026095 Bacteria 2617
581 Ga0207676_10343599 3300026095 Bacteria 1378
582 Ga0207674_10001595 3300026116 Bacteria 29202
583 Ga0207674_10002031 3300026116 Bacteria 25688
584 Ga0207674_10084504 3300026116 Bacteria 3172
585 Ga0207675_100006622 3300026118 Bacteria 10957
586 Ga0207683_10081014 3300026121 Bacteria 2881
587 Ga0207683_10906766 3300026121 Bacteria 818
588 Ga0207698_10078223 3300026142 Bacteria 2655
589 Ga0207698_10105094 3300026142 Unclassified 2352
590 Ga0207698_10152600 3300026142 Bacteria 2007
591 Ga0207698_10567492 3300026142 Bacteria 1115
592 Ga0268266_10140520 3300028379 Bacteria 2167
593 Ga0268265_10020026 3300028380 Bacteria 4663
594 Ga0268265_12637694 3300028380 Bacteria 508
595 Ga0268264_10014425 3300028381 Bacteria 6493
596 Ga0268264_10106177 3300028381 Bacteria 2451
597 Ga0268264_10396989 3300028381 Bacteria 1324
598 Ga0268264_10929858 3300028381 Bacteria 874
599 Ga0265770_1048937 3300030878 Unclassified 760
600 Ga0265760_10008744 3300031090 Bacteria 2895
601 Ga0265760_10032742 3300031090 Bacteria 1535
602 Ga0265339_10082609 3300031249 Bacteria 1696
603 Ga0265316_10098075 3300031344 Bacteria 2230
604 Ga0265314_10177216 3300031711 Bacteria 1281
605 Ga0373938_0097991 3300034957 Unclassified 733
606 Ga0373926_0014732 3300035083 Bacteria 2661
607 Ga0373944_0044681 3300035089 Bacteria 1381
608 Ga0373944_0216245 3300035089 Unclassified 698
609 Ga0373936_0002927 3300035113 Bacteria 6377
610 Ga0373936_0008231 3300035113 Bacteria 3919
611 Ga0373939_0166320 3300035114 Unclassified 813
612 Ga0373941_0447273 3300035115 Unclassified 542
613 Ga0373945_0003097 3300035116 Bacteria 5221
614 Ga0373953_0058095 3300035117 Bacteria 1576
615 Ga0373954_0245602 3300035118 Unclassified 881
616 Ga0373960_0028732 3300035121 Bacteria 1537
617 Ga0373960_0201954 3300035121 Unclassified 703
618 Ga0373943_0000165 3300035170 Bacteria 25706
619 Ga0373943_0042687 3300035170 Bacteria 2199
620 Ga0373943_0049025 3300035170 Bacteria 2071
621 Ga0373946_0012023 3300035171 Bacteria 3236
622 Ga0373946_0025086 3300035171 Bacteria 2343
623 Ga0373946_0067632 3300035171 Bacteria 1535
624 Ga0373955_0007735 3300035172 Bacteria 4950
625 Ga0373942_0236278 3300035207 Unclassified 617
626 Ga0373924_0007363 3300035410 Bacteria 3971
627 Ga0373924_0365307 3300035410 Unclassified 644
628 Ga0373931_0001355 3300035691 Bacteria 10481
629 Ga0373931_0011944 3300035691 Bacteria 4202
630 Ga0373931_0087481 3300035691 Bacteria 1730
631 Ga0373935_0007363 3300035692 Bacteria 6582
632 Ga0373935_0015420 3300035692 Unclassified 4619
633 Ga0373935_0022164 3300035692 Bacteria 3893
634 Ga0373935_0694656 3300035692 Unclassified 748
635 Ga0373927_0004594 3300035695 Bacteria 9626
636 Ga0373927_0048097 3300035695 Bacteria 2758
637 Ga0373927_0126117 3300035695 Unclassified 1671
638 Ga0373927_0745999 3300035695 Unclassified 647
639 Ga0373927_0985109 3300035695 Unclassified 556
640 Ga0373933_0014048 3300035724 Bacteria 4445
641 Ga0373933_0059432 3300035724 Bacteria 2302
642 Ga0373933_0389914 3300035724 Bacteria 908
643 Ga0373933_0433262 3300035724 Unclassified 859
644 Ga0373933_0709709 3300035724 Unclassified 661
645 Ga0373933_0738479 3300035724 Unclassified 648
646 Ga0373947_0001334 3300035725 Bacteria 15178
647 Ga0373947_0003467 3300035725 Bacteria 9324
648 Ga0373947_0059140 3300035725 Bacteria 2323
649 Ga0373947_0153638 3300035725 Bacteria 1484
650 Ga0373937_0084993 3300036401 Bacteria 2928
651 Ga0373937_0167525 3300036401 Bacteria 2060
652 Ga0373937_0179794 3300036401 Bacteria 1986
653 Ga0373937_0606414 3300036401 Bacteria 1039
654 Ga0373925_0021047 3300037068 Bacteria 4752
655 Ga0373925_0048973 3300037068 Bacteria 3149
656 Ga0373925_0371131 3300037068 Bacteria 1164
657 Ga0373925_0504908 3300037068 Bacteria 993
658 Ga0436365_0039278 3300039437 Bacteria 1551
659 Ga0436363_0417699 3300039450 Bacteria 905
660 Ga0436363_1084670 3300039450 Bacteria 1045
661 Ga0436362_1295402 3300039453 Bacteria 4520
662 Ga0466961_0009128 3300044693 Bacteria 6316
663 Ga0466963_0158764 3300044694 Archaea 1573
664 Ga0466968_0443418 3300044735 Unclassified 641
665 Ga0466957_0091174 3300044842 Bacteria 1910
666 Ga0466959_0305123 3300045049 Unclassified 1090
667 Ga0466958_0034420 3300045836 Bacteria 3022
668 Ga0466958_0305881 3300045836 Unclassified 1021
669 Ga0466967_0126227 3300045976 Bacteria 2370
670 Ga0466967_1023829 3300045976 Unclassified 822
671 Ga0466967_1358290 3300045976 Unclassified 708
672 Ga0495591_110065 3300046458 Bacteria 677
673 Ga0495580_0000055 3300046472 Bacteria 65061
674 Ga0495580_0000751 3300046472 Bacteria 27777
675 Ga0495580_0001473 3300046472 Bacteria 20639
676 Ga0495580_0022308 3300046472 Bacteria 4660
677 Ga0495582_0001114 3300046473 Bacteria 15096
678 Ga0495582_0025299 3300046473 Bacteria 3252
679 Ga0495582_0059526 3300046473 Unclassified 2107
680 Ga0495639_0059439 3300046475 Bacteria 1750
681 Ga0495664_0115516 3300046477 Bacteria 1622
682 Ga0495664_0242530 3300046477 Unclassified 1090
683 Ga0495630_0042188 3300046517 Bacteria 3408
684 Ga0495630_0220445 3300046517 Unclassified 1448
685 Ga0495666_0008202 3300046526 Bacteria 5234
686 Ga0495665_0000559 3300046531 Bacteria 18956
687 Ga0495665_0599239 3300046531 Unclassified 551
688 Ga0495645_0107533 3300046543 Bacteria 1977
689 Ga0495645_0138810 3300046543 Bacteria 1698
690 Ga0495635_0022808 3300046663 Bacteria 4364
691 Ga0495623_0486958 3300046679 Bacteria 653
692 Ga0495658_0593585 3300046683 Bacteria 709
693 Ga0495581_0301414 3300047315 Bacteria 937
694 Ga0495674_0010792 3300047319 Bacteria 8643
695 Ga0495674_0042633 3300047319 Bacteria 4046
696 Ga0495676_0225111 3300047321 Bacteria 1291
697 Ga0495676_0831316 3300047321 Unclassified 594
698 Ga0495675_0048183 3300047444 Bacteria 2711
699 Ga0495684_0435781 3300047471 Unclassified 914
700 Ga0495602_0267744 3300048088 Bacteria 1264
701 Ga0495602_0317098 3300048088 Unclassified 1136
702 Ga0496100_0015291 3300048903 Bacteria 4479
703 Ga0496100_0059453 3300048903 Bacteria 2512
704 Ga0496100_0439096 3300048903 Bacteria 999
705 Ga0496101_0064331 3300048904 Bacteria 2671
706 Ga0496101_0142833 3300048904 Bacteria 1826
707 Ga0496101_0232318 3300048904 Bacteria 1434
708 Ga0496101_1536719 3300048904 Unclassified 518
709 Ga0496102_0001547 3300048905 Bacteria 20310
710 Ga0496102_0023329 3300048905 Bacteria 5494
711 Ga0496102_0037505 3300048905 Bacteria 4373
712 Ga0496102_0053703 3300048905 Unclassified 3672
713 Ga0496102_0072616 3300048905 Bacteria 3162
714 Ga0496102_0310137 3300048905 Bacteria 1487
715 Ga0496102_0481718 3300048905 Unclassified 1162
716 Ga0496102_0836916 3300048905 Bacteria 842
717 Ga0496103_0001819 3300048906 Bacteria 13885
718 Ga0496103_0015349 3300048906 Bacteria 4556
719 Ga0496103_0169703 3300048906 Unclassified 1401
720 Ga0496103_0221509 3300048906 Bacteria 1217
721 Ga0496103_0240293 3300048906 Bacteria 1165
722 Ga0496104_0005039 3300048907 Bacteria 11523
723 Ga0496104_0015610 3300048907 Bacteria 6885
724 Ga0496104_0174532 3300048907 Bacteria 2060
725 Ga0496105_0119772 3300048908 Bacteria 2171
726 Ga0496105_0158423 3300048908 Bacteria 1859
727 Ga0496105_0326986 3300048908 Bacteria 1228
728 Ga0496106_0044131 3300048909 Bacteria 3346
729 Ga0496106_0120651 3300048909 Bacteria 2049
730 Ga0496106_0586736 3300048909 Unclassified 893
731 Ga0496107_0204360 3300048910 Bacteria 1468
732 Ga0496107_0211051 3300048910 Unclassified 1444
733 Ga0496107_0381060 3300048910 Unclassified 1049
734 Ga0496107_0445247 3300048910 Unclassified 962
735 Ga0496108_0126946 3300048911 Unclassified 2190
736 Ga0496109_0097062 3300048912 Bacteria 2731
737 Ga0496109_0266201 3300048912 Bacteria 1615
738 Ga0496109_0334920 3300048912 Unclassified 1429
739 Ga0496110_0197968 3300048913 Bacteria 1825
740 Ga0496110_1208069 3300048913 Unclassified 665
741 Ga0496111_0011615 3300048914 Bacteria 5940
742 Ga0496111_0236345 3300048914 Bacteria 1357
743 Ga0496112_0031122 3300048915 Bacteria 5172
744 Ga0496112_0071591 3300048915 Bacteria 3427
745 Ga0496112_0079062 3300048915 Bacteria 3252
746 Ga0496112_0113905 3300048915 Bacteria 2675
747 Ga0496112_0134792 3300048915 Bacteria 2440
748 Ga0496112_0296630 3300048915 Bacteria 1562
749 Ga0496112_0652914 3300048915 Unclassified 981
750 Ga0496112_0963041 3300048915 Unclassified 774
751 Ga0496113_0063990 3300048916 Unclassified 2780
752 Ga0496113_0189352 3300048916 Bacteria 1633
753 Ga0496114_0021588 3300048917 Bacteria 5239
754 Ga0496115_0014369 3300048918 Bacteria 5993
755 Ga0496115_0133308 3300048918 Bacteria 2048
756 nmdc:mga0n895_267256_c1 3300050512 Bacteria 1735
757 nmdc:mga0rr50_18121_c1 3300050513 Unclassified 4721
758 nmdc:mga0rr50_330632_c1 3300050513 Bacteria 1279
759 nmdc:mga0rr50_805979_c1 3300050513 Unclassified 801
760 nmdc:mga08x19_1246474_c1 3300050514 Unclassified 527
761 nmdc:mga08x19_24594_c1 3300050514 Unclassified 3746
762 nmdc:mga08x19_6245_c1 3300050514 Bacteria 7054
763 nmdc:mga08x19_64043_c1 3300050514 Unclassified 2386
764 nmdc:mga08x19_83569_c1 3300050514 Bacteria 2099
765 nmdc:mga08x19_903460_c1 3300050514 Bacteria 627
766 Ga0495601_0217192 3300053077 Bacteria 1249
767 Ga0495612_0361952 3300053078 Unclassified 656
768 Ga0466962_0156668 3300061719 Bacteria 1106
769 Ga0495580_0007847
770 MRS1b_contig_5002604
771 MRS1b_contig_7249033
772 MBSR1b_contig_3580850
773 MBSR1b_contig_811457
774 rootH1_10349805
775 Ga0065715_10031876
776 Ga0070658_10104711
777 Ga0070658_11167003
778 Ga0070676_10002681
779 Ga0070676_10319560
780 Ga0070683_100176032
781 Ga0070690_100055676
782 Ga0070690_100205082
783 Ga0070670_100118792
784 Ga0068869_100002642
785 Ga0068869_100082388
786 Ga0070666_10026756
787 Ga0070666_10542762
788 Ga0070666_11296223
789 Ga0070680_100019417
790 Ga0070680_100251410
791 Ga0070680_100277587
792 Ga0070682_100005343
793 Ga0070682_100038113
794 Ga0068868_100001093
795 Ga0068868_100002662
796 Ga0068868_100009989
797 Ga0068868_100122207
798 Ga0070660_100002495
799 Ga0070660_100108688
800 Ga0070660_100114516
801 Ga0070689_100191493
802 Ga0070689_101999086
803 Ga0070691_10056535
804 Ga0070691_10140497
805 Ga0070691_10176812
806 Ga0070687_100069578
807 Ga0070661_100011816
808 Ga0070661_100058732
809 Ga0070661_100069143
810 Ga0070661_101254651
811 Ga0070692_10918440
812 Ga0070668_100015251
813 Ga0070669_100948378
814 Ga0070675_100244629
815 Ga0070671_100263578
816 Ga0070671_100941976
817 Ga0070674_101528839
818 Ga0070673_100104851
819 Ga0070659_100296448
820 Ga0070659_100589686
821 Ga0070667_100018130
822 Ga0070667_100364569
823 Ga0070709_10037593
824 Ga0070709_10164562
825 Ga0070709_10196834
826 Ga0070709_10376543
827 Ga0070709_10539412
828 Ga0070714_100004400
829 Ga0070714_100081064
830 Ga0070714_100101011
831 Ga0070714_100181365
832 Ga0070714_100210511
833 Ga0070714_100545879
834 Ga0070714_101502988
835 Ga0070713_100001793
836 Ga0070713_100002728
837 Ga0070713_100026803
838 Ga0070713_100038787
839 Ga0070713_100050473
840 Ga0070713_100067903
841 Ga0070713_100198284
842 Ga0070713_100468777
843 Ga0070713_100622215
844 Ga0070713_101376632
845 Ga0070710_10004541
846 Ga0070710_10029157
847 Ga0070710_10288547
848 Ga0070710_10297351
849 Ga0070710_11143150
850 Ga0070711_100000134
851 Ga0070711_100001421
852 Ga0070711_100149713
853 Ga0070711_100320102
854 Ga0070711_100347162
855 Ga0070711_101038246
856 Ga0070708_100070400
857 Ga0070708_101528867
858 Ga0070678_100348930
859 Ga0070678_101481904
860 Ga0070681_10007515
861 Ga0070681_10015864
862 Ga0070681_10058261
863 Ga0070681_10150080
864 Ga0070681_10381847
865 Ga0070681_10842545
866 Ga0070681_11796362
867 Ga0068867_100001428
868 Ga0068867_100063383
869 Ga0068867_100996093
870 Ga0070685_10083500
871 Ga0070685_10086676
872 Ga0070706_100002012
873 Ga0070706_100012010
874 Ga0070707_100002271
875 Ga0070707_100016149
876 Ga0070707_100251075
877 Ga0070707_100365111
878 Ga0070707_100572360
879 Ga0070698_100005374
880 Ga0070698_100032051
881 Ga0070698_100112382
882 Ga0070698_100127120
883 Ga0070699_100001773
884 Ga0070699_100004897
885 Ga0070699_100026812
886 Ga0070699_100082677
887 Ga0070699_100785620
888 Ga0070699_100991979
889 Ga0070679_100030397
890 Ga0070679_100074094
891 Ga0070679_100145493
892 Ga0070679_100213049
893 Ga0070679_100319970
894 Ga0070679_101490955
895 Ga0070684_100031783
896 Ga0070684_100077535
897 Ga0070684_100079441
898 Ga0070684_100215472
899 Ga0070684_100478620
900 Ga0070697_100000787
901 Ga0070697_100000848
902 Ga0070697_100004394
903 Ga0070697_100004644
904 Ga0070697_100082011
905 Ga0070697_100110058
906 Ga0070697_100749687
907 Ga0068853_100003364
908 Ga0068853_100063473
909 Ga0068853_100114422
910 Ga0068853_100210328
911 Ga0070672_101058054
912 Ga0070695_100330170
913 Ga0070696_100060011
914 Ga0070696_100146243
915 Ga0070696_100608993
916 Ga0070693_100006629
917 Ga0070693_100099493
918 Ga0070693_100195091
919 Ga0070693_100546357
920 Ga0070665_100243473
921 Ga0070665_100337019
922 Ga0068855_100000952
923 Ga0068855_100006023
924 Ga0068855_100050650
925 Ga0068855_100116711
926 Ga0068855_100171438
927 Ga0068855_100349368
928 Ga0068855_100458634
929 Ga0070664_100000278
930 Ga0070664_100050503
931 Ga0070664_100078822
932 Ga0070664_100150639
933 Ga0068857_100000113
934 Ga0068857_100001051
935 Ga0068854_100001102
936 Ga0068854_100007179
937 Ga0068854_100030695
938 Ga0068854_100058545
939 Ga0068854_100072560
940 Ga0068854_100135439
941 Ga0068854_100459995
942 Ga0068856_100000096
943 Ga0068856_100000243
944 Ga0068856_100000305
945 Ga0068856_100004911
946 Ga0068856_100019755
947 Ga0068856_100023670
948 Ga0068856_100165545
949 Ga0068856_100432135
950 Ga0068856_100878855
951 Ga0068856_100976843
952 Ga0070702_100134750
953 Ga0068852_100063207
954 Ga0068852_100277769
955 Ga0068852_101353467
956 Ga0068859_100013832
957 Ga0068859_100019022
958 Ga0068859_100026605
959 Ga0068864_100008229
960 Ga0068864_100029331
961 Ga0068864_100104714
962 Ga0068864_100207964
963 Ga0068866_10027059
964 Ga0068866_10144522
965 Ga0068866_10320870
966 Ga0068866_10326263
967 Ga0068861_100027884
968 Ga0068861_100254498
969 Ga0068851_10233504
970 Ga0068870_10031720
971 Ga0068863_100018791
972 Ga0068863_100089090
973 Ga0068863_100171500
974 Ga0068863_100828020
975 Ga0068858_100007462
976 Ga0068858_100010774
977 Ga0068858_100014219
978 Ga0068858_100017328
979 Ga0068858_100106617
980 Ga0068858_100639747
981 Ga0068860_100013351
982 Ga0068860_100036976
983 Ga0068860_100041849
984 Ga0068860_100129861
985 Ga0068860_100402056
986 Ga0068862_100066679
987 Ga0068862_100691408
988 Ga0081540_1066214
989 Ga0070717_10000272
990 Ga0070717_10019597
991 Ga0070717_10047675
992 Ga0070717_10081496
993 Ga0070717_10089478
994 Ga0070717_10172633
995 Ga0070717_10191421
996 Ga0070717_10196776
997 Ga0070717_10215036
998 Ga0070717_10424471
999 Ga0070717_11091969
1000 Ga0070715_10002078
1001 Ga0070715_10047854
1002 Ga0070715_10075645
1003 Ga0070715_10954706
1004 Ga0070716_100002299
1005 Ga0070716_100010019
1006 Ga0070716_100698708
1007 Ga0070716_101028413
1008 Ga0070712_100002354
1009 Ga0070712_100009039
1010 Ga0070712_100037797
1011 Ga0070712_100714628
1012 Ga0070712_100729719
1013 Ga0070712_100871898
1014 Ga0097621_100000022
1015 Ga0097621_100000562
1016 Ga0097621_100000973
1017 Ga0097621_100023646
1018 Ga0097621_100028404
1019 Ga0097621_100036826
1020 Ga0068871_100000149
1021 Ga0068871_100001873
1022 Ga0068871_100004140
1023 Ga0068871_100016575
1024 Ga0068871_100017817
1025 Ga0068871_100044356
1026 Ga0068871_100095458
1027 Ga0068871_100418380
1028 Ga0075434_100572977
1029 Ga0068865_100037462
1030 Ga0068865_100056710
1031 Ga0068865_100348692
1032 Ga0068865_101118456
1033 Ga0075436_100000675
1034 Ga0075436_100001370
1035 Ga0075436_100089685
1036 Ga0075436_100174060
1037 Ga0075436_100442831
1038 Ga0097620_100013832
1039 Ga0097620_100019022
1040 Ga0097620_100026604
1041 Ga0075435_100019517
1042 Ga0075435_100110320
1043 Ga0099794_10308158
1044 Ga0105250_10088315
1045 Ga0105240_10008809
1046 Ga0105240_10012839
1047 Ga0105240_10017033
1048 Ga0105240_10049586
1049 Ga0105240_10131193
1050 Ga0105240_10137150
1051 Ga0105240_10275369
1052 Ga0105240_10395923
1053 Ga0105240_10734035
1054 Ga0105245_10176972
1055 Ga0105245_10216824
1056 Ga0105245_11586553
1057 Ga0105245_11634609
1058 Ga0105247_10014022
1059 Ga0105247_10094205
1060 Ga0105247_10708118
1061 Ga0105243_10037217
1062 Ga0105241_10014054
1063 Ga0105241_10037583
1064 Ga0105241_10042698
1065 Ga0105241_10067950
1066 Ga0105241_10204359
1067 Ga0105241_10818254
1068 Ga0105242_10014307
1069 Ga0105242_10135356
1070 Ga0105248_10013856
1071 Ga0105248_10032942
1072 Ga0105248_10103581
1073 Ga0105237_10014873
1074 Ga0105237_10080775
1075 Ga0105237_10275221
1076 Ga0105237_10275444
1077 Ga0105237_10287891
1078 Ga0105238_10000644
1079 Ga0105238_10008225
1080 Ga0105238_10036914
1081 Ga0105238_10089046
1082 Ga0105238_10183301
1083 Ga0105238_10802078
1084 Ga0105249_10060987
1085 Ga0105249_10807565
1086 Ga0105239_10083240
1087 Ga0105239_10104189
1088 Ga0105239_10376704
1089 Ga0105239_11242068
1090 Ga0105239_11807363
1091 Ga0105246_10041577
1092 Ga0105246_10486714
1093 Ga0157373_10046387
1094 Ga0157373_10060981
1095 Ga0157373_10065247
1096 Ga0157373_10154860
1097 Ga0157373_10200977
1098 Ga0157373_11307798
1099 Ga0157371_10010259
1100 Ga0157371_10056733
1101 Ga0157371_10057042
1102 Ga0157370_10019816
1103 Ga0157370_10621140
1104 Ga0157370_11290260
1105 Ga0157369_10000034
1106 Ga0157369_10017221
1107 Ga0157369_10020372
1108 Ga0157369_10064889
1109 Ga0157369_10071544
1110 Ga0157369_10498783
1111 Ga0157369_11221901
1112 Ga0157374_10000052
1113 Ga0157374_10001074
1114 Ga0157374_10001307
1115 Ga0157374_10005336
1116 Ga0157374_10073458
1117 Ga0157374_10280356
1118 Ga0157374_10534332
1119 Ga0157374_10830520
1120 Ga0157378_10000227
1121 Ga0157378_10001800
1122 Ga0157378_10046182
1123 Ga0157378_10091458
1124 Ga0157378_10243214
1125 Ga0157378_10274304
1126 Ga0163162_10001445
1127 Ga0163162_10003919
1128 Ga0163162_11032718
1129 Ga0157372_10000585
1130 Ga0157372_10003253
1131 Ga0157372_10003378
1132 Ga0157372_10023442
1133 Ga0157372_10029829
1134 Ga0157372_10252931
1135 Ga0157372_10826023
1136 Ga0157372_11808418
1137 Ga0157375_10077230
1138 Ga0157375_10536210
1139 Ga0163163_10102612
1140 Ga0163163_10128601
1141 Ga0163163_12541243
1142 Ga0182008_10072486
1143 Ga0182008_10299831
1144 Ga0157379_10001079
1145 Ga0157379_10052368
1146 Ga0157379_10060792
1147 Ga0157376_10025944
1148 Ga0157376_10095723
1149 Ga0157376_10116275
1150 Ga0157376_10498926
1151 Ga0182006_1025513
1152 Ga0182007_10014155
1153 Ga0213874_10174851
1154 Ga0224572_1016593
1155 Ga0228598_1000112
1156 Ga0207656_10062568
1157 Ga0207692_10025539
1158 Ga0207692_10031458
1159 Ga0207692_10038389
1160 Ga0207642_10013957
1161 Ga0207642_10017155
1162 Ga0207710_10091922
1163 Ga0207710_10299007
1164 Ga0207647_10002181
1165 Ga0207685_10017356
1166 Ga0207685_10288739
1167 Ga0207699_10013995
1168 Ga0207699_10035499
1169 Ga0207699_10059957
1170 Ga0207699_10087220
1171 Ga0207699_10137860
1172 Ga0207645_10451762
1173 Ga0207643_10087558
1174 Ga0207705_10152377
1175 Ga0207684_10000426
1176 Ga0207684_10003981
1177 Ga0207684_10033139
1178 Ga0207684_10405673
1179 Ga0207654_10110343
1180 Ga0207654_10123078
1181 Ga0207654_10242013
1182 Ga0207654_10266137
1183 Ga0207654_10318027
1184 Ga0207707_10000496
1185 Ga0207707_10051856
1186 Ga0207707_10084302
1187 Ga0207707_10136782
1188 Ga0207707_10201683
1189 Ga0207707_10296753
1190 Ga0207707_10336495
1191 Ga0207707_10372790
1192 Ga0207707_10672326
1193 Ga0207695_10010044
1194 Ga0207695_10012834
1195 Ga0207695_10042465
1196 Ga0207695_10076540
1197 Ga0207695_10121405
1198 Ga0207695_10122254
1199 Ga0207695_10560788
1200 Ga0207695_11166878
1201 Ga0207671_10263879
1202 Ga0207671_10369414
1203 Ga0207671_10588828
1204 Ga0207671_10735008
1205 Ga0207693_10000004
1206 Ga0207693_10000096
1207 Ga0207693_10016437
1208 Ga0207693_10017348
1209 Ga0207693_10098631
1210 Ga0207663_10000911
1211 Ga0207663_10015586
1212 Ga0207663_10020796
1213 Ga0207663_10262091
1214 Ga0207663_10331785
1215 Ga0207663_10895027
1216 Ga0207663_10896908
1217 Ga0207660_10016655
1218 Ga0207657_10000321
1219 Ga0207657_10000830
1220 Ga0207657_10721512
1221 Ga0207649_10039059
1222 Ga0207649_10175128
1223 Ga0207652_10003101
1224 Ga0207652_10114084
1225 Ga0207652_10189261
1226 Ga0207652_10250514
1227 Ga0207646_10000614
1228 Ga0207646_10004278
1229 Ga0207646_10018303
1230 Ga0207646_10107450
1231 Ga0207646_10304531
1232 Ga0207646_10361515
1233 Ga0207646_10414654
1234 Ga0207681_10203047
1235 Ga0207694_10000250
1236 Ga0207694_10062507
1237 Ga0207694_10297014
1238 Ga0207694_10598042
1239 Ga0207650_10032393
1240 Ga0207687_10057265
1241 Ga0207687_10080892
1242 Ga0207687_10157084
1243 Ga0207687_10402114
1244 Ga0207700_10004509
1245 Ga0207700_10009460
1246 Ga0207700_10011753
1247 Ga0207700_10012917
1248 Ga0207700_10017506
1249 Ga0207700_10052188
1250 Ga0207700_10098543
1251 Ga0207700_10282797
1252 Ga0207700_10340908
1253 Ga0207700_10468606
1254 Ga0207700_10792206
1255 Ga0207700_11075937
1256 Ga0207700_11289487
1257 Ga0207664_10000636
1258 Ga0207664_10017803
1259 Ga0207664_10020398
1260 Ga0207664_10062293
1261 Ga0207664_10078674
1262 Ga0207664_10083866
1263 Ga0207664_10111361
1264 Ga0207664_10236894
1265 Ga0207664_10466956
1266 Ga0207664_11079600
1267 Ga0207644_11214408
1268 Ga0207690_10117999
1269 Ga0207690_10603387
1270 Ga0207706_10000370
1271 Ga0207706_10038235
1272 Ga0207706_10127021
1273 Ga0207686_10028856
1274 Ga0207686_10085871
1275 Ga0207670_10094510
1276 Ga0207670_11482304
1277 Ga0207704_10127946
1278 Ga0207704_10918411
1279 Ga0207665_10017156
1280 Ga0207665_10024061
1281 Ga0207665_10044657
1282 Ga0207665_10080122
1283 Ga0207665_10303292
1284 Ga0207665_10332842
1285 Ga0207691_10396879
1286 Ga0207691_10684651
1287 Ga0207691_10691789
1288 Ga0207711_10023956
1289 Ga0207711_10183464
1290 Ga0207711_10201887
1291 Ga0207711_10399399
1292 Ga0207711_11670004
1293 Ga0207689_10013884
1294 Ga0207689_10048522
1295 Ga0207689_10057406
1296 Ga0207661_10114833
1297 Ga0207661_10203540
1298 Ga0207679_10004663
1299 Ga0207679_10038194
1300 Ga0207679_10043033
1301 Ga0207679_10107008
1302 Ga0207667_10000996
1303 Ga0207667_10007025
1304 Ga0207667_10010971
1305 Ga0207667_10107611
1306 Ga0207667_10346903
1307 Ga0207651_10099496
1308 Ga0207712_10025235
1309 Ga0207668_10006101
1310 Ga0207640_10023771
1311 Ga0207640_10030456
1312 Ga0207640_10211112
1313 Ga0207658_10070764
1314 Ga0207658_10700680
1315 Ga0207677_10001021
1316 Ga0207677_10017918
1317 Ga0207677_10047462
1318 Ga0207677_10076163
1319 Ga0207677_10078740
1320 Ga0207677_10124843
1321 Ga0207703_10009051
1322 Ga0207703_10009521
1323 Ga0207703_10018786
1324 Ga0207703_10077486
1325 Ga0207703_10646232
1326 Ga0207639_10036730
1327 Ga0207639_10056811
1328 Ga0207639_10159479
1329 Ga0207639_10201849
1330 Ga0207678_10002740
1331 Ga0207702_10006631
1332 Ga0207702_10011612
1333 Ga0207702_10018995
1334 Ga0207702_10019240
1335 Ga0207702_10021063
1336 Ga0207702_10022194
1337 Ga0207702_10210982
1338 Ga0207702_11396473
1339 Ga0207641_10018032
1340 Ga0207641_10140161
1341 Ga0207641_10154153
1342 Ga0207641_10237198
1343 Ga0207648_10024771
1344 Ga0207648_10027559
1345 Ga0207648_10381109
1346 Ga0207676_10011829
1347 Ga0207676_10060741
1348 Ga0207676_10082329
1349 Ga0207676_10343599
1350 Ga0207674_10001595
1351 Ga0207674_10002031
1352 Ga0207674_10084504
1353 Ga0207675_100006622
1354 Ga0207683_10081014
1355 Ga0207683_10906766
1356 Ga0207698_10078223
1357 Ga0207698_10105094
1358 Ga0207698_10152600
1359 Ga0207698_10567492
1360 Ga0268266_10140520
1361 Ga0268265_10020026
1362 Ga0268265_12637694
1363 Ga0268264_10014425
1364 Ga0268264_10106177
1365 Ga0268264_10396989
1366 Ga0268264_10929858
1367 Ga0265770_1048937
1368 Ga0265760_10008744
1369 Ga0265760_10032742
1370 Ga0265339_10082609
1371 Ga0265316_10098075
1372 Ga0265314_10177216
1373 Ga0373938_0097991
1374 Ga0373926_0014732
1375 Ga0373944_0044681
1376 Ga0373944_0216245
1377 Ga0373936_0002927
1378 Ga0373936_0008231
1379 Ga0373939_0166320
1380 Ga0373941_0447273
1381 Ga0373945_0003097
1382 Ga0373953_0058095
1383 Ga0373954_0245602
1384 Ga0373960_0028732
1385 Ga0373960_0201954
1386 Ga0373943_0000165
1387 Ga0373943_0042687
1388 Ga0373943_0049025
1389 Ga0373946_0012023
1390 Ga0373946_0025086
1391 Ga0373946_0067632
1392 Ga0373955_0007735
1393 Ga0373942_0236278
1394 Ga0373924_0007363
1395 Ga0373924_0365307
1396 Ga0373931_0001355
1397 Ga0373931_0011944
1398 Ga0373931_0087481
1399 Ga0373935_0007363
1400 Ga0373935_0015420
1401 Ga0373935_0022164
1402 Ga0373935_0694656
1403 Ga0373927_0004594
1404 Ga0373927_0048097
1405 Ga0373927_0126117
1406 Ga0373927_0745999
1407 Ga0373927_0985109
1408 Ga0373933_0014048
1409 Ga0373933_0059432
1410 Ga0373933_0389914
1411 Ga0373933_0433262
1412 Ga0373933_0709709
1413 Ga0373933_0738479
1414 Ga0373947_0001334
1415 Ga0373947_0003467
1416 Ga0373947_0059140
1417 Ga0373947_0153638
1418 Ga0373937_0084993
1419 Ga0373937_0167525
1420 Ga0373937_0179794
1421 Ga0373937_0606414
1422 Ga0373925_0021047
1423 Ga0373925_0048973
1424 Ga0373925_0371131
1425 Ga0373925_0504908
1426 Ga0436365_0039278
1427 Ga0436363_0417699
1428 Ga0436363_1084670
1429 Ga0436362_1295402
1430 Ga0466961_0009128
1431 Ga0466963_0158764
1432 Ga0466968_0443418
1433 Ga0466957_0091174
1434 Ga0466959_0305123
1435 Ga0466958_0034420
1436 Ga0466958_0305881
1437 Ga0466967_0126227
1438 Ga0466967_1023829
1439 Ga0466967_1358290
1440 Ga0495591_110065
1441 Ga0495580_0000055
1442 Ga0495580_0000751
1443 Ga0495580_0001473
1444 Ga0495580_0022308
1445 Ga0495582_0001114
1446 Ga0495582_0025299
1447 Ga0495582_0059526
1448 Ga0495639_0059439
1449 Ga0495664_0115516
1450 Ga0495664_0242530
1451 Ga0495630_0042188
1452 Ga0495630_0220445
1453 Ga0495666_0008202
1454 Ga0495665_0000559
1455 Ga0495665_0599239
1456 Ga0495645_0107533
1457 Ga0495645_0138810
1458 Ga0495635_0022808
1459 Ga0495623_0486958
1460 Ga0495658_0593585
1461 Ga0495581_0301414
1462 Ga0495674_0010792
1463 Ga0495674_0042633
1464 Ga0495676_0225111
1465 Ga0495676_0831316
1466 Ga0495675_0048183
1467 Ga0495684_0435781
1468 Ga0495602_0267744
1469 Ga0495602_0317098
1470 Ga0496100_0015291
1471 Ga0496100_0059453
1472 Ga0496100_0439096
1473 Ga0496101_0064331
1474 Ga0496101_0142833
1475 Ga0496101_0232318
1476 Ga0496101_1536719
1477 Ga0496102_0001547
1478 Ga0496102_0023329
1479 Ga0496102_0037505
1480 Ga0496102_0053703
1481 Ga0496102_0072616
1482 Ga0496102_0310137
1483 Ga0496102_0481718
1484 Ga0496102_0836916
1485 Ga0496103_0001819
1486 Ga0496103_0015349
1487 Ga0496103_0169703
1488 Ga0496103_0221509
1489 Ga0496103_0240293
1490 Ga0496104_0005039
1491 Ga0496104_0015610
1492 Ga0496104_0174532
1493 Ga0496105_0119772
1494 Ga0496105_0158423
1495 Ga0496105_0326986
1496 Ga0496106_0044131
1497 Ga0496106_0120651
1498 Ga0496106_0586736
1499 Ga0496107_0204360
1500 Ga0496107_0211051
1501 Ga0496107_0381060
1502 Ga0496107_0445247
1503 Ga0496108_0126946
1504 Ga0496109_0097062
1505 Ga0496109_0266201
1506 Ga0496109_0334920
1507 Ga0496110_0197968
1508 Ga0496110_1208069
1509 Ga0496111_0011615
1510 Ga0496111_0236345
1511 Ga0496112_0031122
1512 Ga0496112_0071591
1513 Ga0496112_0079062
1514 Ga0496112_0113905
1515 Ga0496112_0134792
1516 Ga0496112_0296630
1517 Ga0496112_0652914
1518 Ga0496112_0963041
1519 Ga0496113_0063990
1520 Ga0496113_0189352
1521 Ga0496114_0021588
1522 Ga0496115_0014369
1523 Ga0496115_0133308
1524 nmdc:mga0n895_267256_c1
1525 nmdc:mga0rr50_18121_c1
1526 nmdc:mga0rr50_330632_c1
1527 nmdc:mga0rr50_805979_c1
1528 nmdc:mga08x19_1246474_c1
1529 nmdc:mga08x19_24594_c1
1530 nmdc:mga08x19_6245_c1
1531 nmdc:mga08x19_64043_c1
1532 nmdc:mga08x19_83569_c1
1533 nmdc:mga08x19_903460_c1
1534 Ga0495601_0217192
1535 Ga0495612_0361952
1536 Ga0466962_0156668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map