F479432

General Info

Members Datasets Scaffolds Average Seq Length
758 206 1516 64

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10146071|Ga0070676_101460713
Length 79
Sequence VGEPWVPPRGATMPGRMSRVCAICGKKPATGNNRSHSMVATKRRFNPNLQRVRLVLDGKPTRDYVCTRCLKAGKVTKAV

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
120 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
121 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
122 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
123 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
124 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 0.92
Rhizosphere 97.23
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10146071 3300005328 Bacteria 1510
2 JGI24746J21847_1000294 3300001977 Bacteria 7115
3 JGI24748J21848_1035848 3300002074 Bacteria 623
4 JGI24034J26672_10000246 3300002239 Bacteria 7108
5 JGI24742J22300_10001869 3300002244 Bacteria 3351
6 rootH2_10086106 3300003320 Bacteria 2229
7 JGI25407J50210_10182057 3300003373 Bacteria 518
8 JGI25404J52841_10079918 3300003659 Bacteria 683
9 Ga0070658_10226281 3300005327 Bacteria 1583
10 Ga0070658_10246997 3300005327 Bacteria 1514
11 Ga0070658_10281033 3300005327 Bacteria 1417
12 Ga0070658_10515326 3300005327 Bacteria 1034
13 Ga0070658_11012160 3300005327 Unclassified 723
14 Ga0070658_11522297 3300005327 Bacteria 580
15 Ga0070676_10068783 3300005328 Bacteria 2120
16 Ga0070676_10072256 3300005328 Bacteria 2074
17 Ga0070683_100008260 3300005329 Bacteria 8846
18 Ga0070683_100021138 3300005329 Bacteria 5803
19 Ga0070683_100022356 3300005329 Bacteria 5651
20 Ga0070683_100025552 3300005329 Bacteria 5305
21 Ga0070683_100031264 3300005329 Bacteria 4839
22 Ga0070683_100069056 3300005329 Bacteria 3293
23 Ga0070683_101094226 3300005329 Unclassified 765
24 Ga0070683_101498146 3300005329 Bacteria 648
25 Ga0070670_100059328 3300005331 Bacteria 3284
26 Ga0070670_100214958 3300005331 Bacteria 1672
27 Ga0070670_100232648 3300005331 Bacteria 1604
28 Ga0068869_100034615 3300005334 Bacteria 3574
29 Ga0068869_100047776 3300005334 Bacteria 3092
30 Ga0068869_100121217 3300005334 Bacteria 2000
31 Ga0068869_100167033 3300005334 Bacteria 1716
32 Ga0068869_101319210 3300005334 Bacteria 637
33 Ga0070666_10026450 3300005335 Bacteria 3791
34 Ga0070666_10410953 3300005335 Bacteria 974
35 Ga0070666_10755883 3300005335 Bacteria 715
36 Ga0070680_100032301 3300005336 Bacteria 4213
37 Ga0070680_100058647 3300005336 Bacteria 3148
38 Ga0070680_100446370 3300005336 Bacteria 1105
39 Ga0070680_100459191 3300005336 Bacteria 1088
40 Ga0070680_100622939 3300005336 Bacteria 926
41 Ga0070680_101593285 3300005336 Unclassified 566
42 Ga0070682_100000708 3300005337 Bacteria 19980
43 Ga0070682_100002641 3300005337 Bacteria 9903
44 Ga0070682_100003834 3300005337 Bacteria 8353
45 Ga0070682_100017680 3300005337 Bacteria 4159
46 Ga0070682_100029712 3300005337 Bacteria 3292
47 Ga0070682_100044892 3300005337 Bacteria 2737
48 Ga0070682_100349693 3300005337 Bacteria 1101
49 Ga0070682_100455859 3300005337 Bacteria 980
50 Ga0068868_100004616 3300005338 Bacteria 9664
51 Ga0068868_100013301 3300005338 Bacteria 6031
52 Ga0068868_100140034 3300005338 Bacteria 1985
53 Ga0068868_100339848 3300005338 Bacteria 1283
54 Ga0068868_100347342 3300005338 Bacteria 1270
55 Ga0068868_101134273 3300005338 Bacteria 720
56 Ga0068868_101317249 3300005338 Bacteria 671
57 Ga0068868_101512999 3300005338 Bacteria 629
58 Ga0070660_100032160 3300005339 Bacteria 3946
59 Ga0070660_100588700 3300005339 Bacteria 929
60 Ga0070660_100677878 3300005339 Bacteria 864
61 Ga0070660_100684393 3300005339 Bacteria 859
62 Ga0070660_100770297 3300005339 Bacteria 808
63 Ga0070689_100007794 3300005340 Bacteria 7501
64 Ga0070689_100033752 3300005340 Bacteria 3901
65 Ga0070689_100039510 3300005340 Bacteria 3613
66 Ga0070689_100102201 3300005340 Bacteria 2270
67 Ga0070691_10000001 3300005341 Bacteria 94744
68 Ga0070691_10008629 3300005341 Bacteria 4665
69 Ga0070691_10010821 3300005341 Bacteria 4162
70 Ga0070691_10520018 3300005341 Bacteria 691
71 Ga0070691_10529077 3300005341 Bacteria 686
72 Ga0070691_11058092 3300005341 Bacteria 509
73 Ga0070687_100136437 3300005343 Bacteria 1423
74 Ga0070687_100570417 3300005343 Bacteria 773
75 Ga0070661_100000223 3300005344 Bacteria 46956
76 Ga0070661_100006632 3300005344 Bacteria 7985
77 Ga0070661_100065144 3300005344 Bacteria 2677
78 Ga0070661_100081972 3300005344 Bacteria 2382
79 Ga0070661_100225337 3300005344 Bacteria 1439
80 Ga0070661_100508203 3300005344 Bacteria 965
81 Ga0070661_100767953 3300005344 Bacteria 789
82 Ga0070692_10031195 3300005345 Bacteria 2670
83 Ga0070692_10036582 3300005345 Bacteria 2492
84 Ga0070692_10096758 3300005345 Bacteria 1613
85 Ga0070692_10126693 3300005345 Bacteria 1430
86 Ga0070692_10165478 3300005345 Bacteria 1270
87 Ga0070692_11171730 3300005345 Bacteria 546
88 Ga0070668_100098344 3300005347 Bacteria 2315
89 Ga0070668_100104123 3300005347 Bacteria 2252
90 Ga0070668_101305890 3300005347 Bacteria 660
91 Ga0070668_101566102 3300005347 Bacteria 603
92 Ga0070669_100450571 3300005353 Bacteria 1061
93 Ga0070669_100513916 3300005353 Bacteria 995
94 Ga0070675_100000025 3300005354 Bacteria 115134
95 Ga0070675_100071878 3300005354 Bacteria 2871
96 Ga0070675_100121803 3300005354 Bacteria 2216
97 Ga0070675_100145575 3300005354 Bacteria 2028
98 Ga0070675_100285030 3300005354 Bacteria 1452
99 Ga0070675_101105315 3300005354 Bacteria 729
100 Ga0070671_100492667 3300005355 Bacteria 1054
101 Ga0070671_102032884 3300005355 Bacteria 512
102 Ga0070674_100066305 3300005356 Bacteria 2536
103 Ga0070674_100392547 3300005356 Bacteria 1132
104 Ga0070674_100475709 3300005356 Bacteria 1036
105 Ga0070674_100579506 3300005356 Bacteria 945
106 Ga0070674_100673251 3300005356 Bacteria 882
107 Ga0070673_100033994 3300005364 Bacteria 3853
108 Ga0070673_100457186 3300005364 Bacteria 1149
109 Ga0070673_101362882 3300005364 Bacteria 667
110 Ga0070673_101475916 3300005364 Bacteria 641
111 Ga0070688_100000069 3300005365 Bacteria 50704
112 Ga0070688_100001589 3300005365 Bacteria 11359
113 Ga0070688_100056090 3300005365 Bacteria 2473
114 Ga0070688_100142930 3300005365 Bacteria 1628
115 Ga0070688_100198827 3300005365 Bacteria 1401
116 Ga0070688_100356140 3300005365 Bacteria 1073
117 Ga0070688_100547612 3300005365 Bacteria 879
118 Ga0070688_100660820 3300005365 Bacteria 806
119 Ga0070688_101814947 3300005365 Bacteria 501
120 Ga0070659_100010760 3300005366 Bacteria 6745
121 Ga0070659_100039831 3300005366 Bacteria 3670
122 Ga0070659_100115854 3300005366 Bacteria 2166
123 Ga0070659_100214002 3300005366 Bacteria 1589
124 Ga0070659_100237790 3300005366 Bacteria 1506
125 Ga0070659_100266063 3300005366 Bacteria 1423
126 Ga0070659_100585182 3300005366 Bacteria 958
127 Ga0070667_100078627 3300005367 Bacteria 2818
128 Ga0070667_100135502 3300005367 Bacteria 2153
129 Ga0070667_100205782 3300005367 Bacteria 1747
130 Ga0070667_100600722 3300005367 Bacteria 1014
131 Ga0070703_10009201 3300005406 Bacteria 2787
132 Ga0070703_10381567 3300005406 Bacteria 609
133 Ga0070709_10480009 3300005434 Bacteria 941
134 Ga0070709_10660710 3300005434 Bacteria 810
135 Ga0070709_10989302 3300005434 Bacteria 669
136 Ga0070714_100149596 3300005435 Bacteria 2103
137 Ga0070714_100478496 3300005435 Bacteria 1186
138 Ga0070714_100668761 3300005435 Bacteria 1000
139 Ga0070714_100880694 3300005435 Bacteria 869
140 Ga0070714_101276420 3300005435 Bacteria 717
141 Ga0070714_102150278 3300005435 Bacteria 544
142 Ga0070713_100000079 3300005436 Bacteria 60238
143 Ga0070713_100030706 3300005436 Bacteria 4270
144 Ga0070713_100120406 3300005436 Bacteria 2301
145 Ga0070713_100306444 3300005436 Bacteria 1463
146 Ga0070713_100567468 3300005436 Bacteria 1076
147 Ga0070713_101588099 3300005436 Bacteria 635
148 Ga0070713_101854072 3300005436 Bacteria 585
149 Ga0070710_10120005 3300005437 Bacteria 1590
150 Ga0070710_10211324 3300005437 Bacteria 1230
151 Ga0070710_11487318 3300005437 Bacteria 508
152 Ga0070701_10031903 3300005438 Bacteria 2618
153 Ga0070701_10052333 3300005438 Bacteria 2121
154 Ga0070701_10088832 3300005438 Bacteria 1689
155 Ga0070701_10154826 3300005438 Bacteria 1323
156 Ga0070701_10287587 3300005438 Bacteria 1006
157 Ga0070701_10430365 3300005438 Bacteria 843
158 Ga0070701_10930633 3300005438 Bacteria 602
159 Ga0070711_100001934 3300005439 Bacteria 11598
160 Ga0070711_100007530 3300005439 Bacteria 6628
161 Ga0070711_100138903 3300005439 Bacteria 1819
162 Ga0070711_100155732 3300005439 Bacteria 1727
163 Ga0070711_100676819 3300005439 Bacteria 867
164 Ga0070711_101349397 3300005439 Bacteria 619
165 Ga0070711_101892084 3300005439 Bacteria 524
166 Ga0070705_100234984 3300005440 Bacteria 1277
167 Ga0070705_101198142 3300005440 Bacteria 625
168 Ga0070700_100004837 3300005441 Bacteria 7071
169 Ga0070700_100032041 3300005441 Bacteria 3156
170 Ga0070700_100045258 3300005441 Bacteria 2714
171 Ga0070700_100172052 3300005441 Bacteria 1500
172 Ga0070694_100181588 3300005444 Bacteria 1557
173 Ga0070694_100448159 3300005444 Bacteria 1019
174 Ga0070694_100572895 3300005444 Bacteria 906
175 Ga0070694_101460793 3300005444 Bacteria 578
176 Ga0070708_100553819 3300005445 Bacteria 1085
177 Ga0070708_101914271 3300005445 Bacteria 550
178 Ga0070708_102268184 3300005445 Bacteria 501
179 Ga0070663_100000454 3300005455 Bacteria 21701
180 Ga0070663_100011546 3300005455 Bacteria 5551
181 Ga0070663_100099013 3300005455 Bacteria 2173
182 Ga0070663_100746012 3300005455 Bacteria 835
183 Ga0070663_101011570 3300005455 Unclassified 723
184 Ga0070663_101872046 3300005455 Bacteria 539
185 Ga0070678_100009903 3300005456 Bacteria 5793
186 Ga0070678_100010905 3300005456 Bacteria 5576
187 Ga0070678_100061891 3300005456 Bacteria 2761
188 Ga0070678_100303310 3300005456 Bacteria 1358
189 Ga0070678_101567620 3300005456 Bacteria 618
190 Ga0070678_102099966 3300005456 Bacteria 535
191 Ga0070662_100027154 3300005457 Bacteria 3971
192 Ga0070662_100035236 3300005457 Bacteria 3534
193 Ga0070662_100054771 3300005457 Bacteria 2891
194 Ga0070662_100080099 3300005457 Bacteria 2430
195 Ga0070662_100670508 3300005457 Bacteria 876
196 Ga0070662_101380091 3300005457 Bacteria 607
197 Ga0070662_101584403 3300005457 Unclassified 565
198 Ga0070681_10075093 3300005458 Bacteria 3340
199 Ga0070681_10176456 3300005458 Bacteria 2059
200 Ga0070681_10391551 3300005458 Bacteria 1300
201 Ga0070681_10462131 3300005458 Bacteria 1182
202 Ga0070681_10807020 3300005458 Bacteria 856
203 Ga0070681_11656229 3300005458 Bacteria 566
204 Ga0070681_11662042 3300005458 Bacteria 564
205 Ga0068867_100021497 3300005459 Bacteria 4603
206 Ga0068867_100240079 3300005459 Bacteria 1469
207 Ga0068867_100541239 3300005459 Bacteria 1007
208 Ga0068867_100611002 3300005459 Bacteria 952
209 Ga0070685_10000024 3300005466 Bacteria 101602
210 Ga0070685_10001752 3300005466 Bacteria 11359
211 Ga0070685_10005261 3300005466 Bacteria 6561
212 Ga0070685_10032878 3300005466 Bacteria 2908
213 Ga0070685_10955502 3300005466 Bacteria 641
214 Ga0070706_100698032 3300005467 Bacteria 941
215 Ga0070706_101132498 3300005467 Bacteria 720
216 Ga0070707_100326963 3300005468 Bacteria 1490
217 Ga0070707_100604515 3300005468 Bacteria 1059
218 Ga0070707_101344452 3300005468 Bacteria 681
219 Ga0070698_100003507 3300005471 Bacteria 17259
220 Ga0070698_100054912 3300005471 Bacteria 4042
221 Ga0070698_101719541 3300005471 Bacteria 580
222 Ga0070698_101986579 3300005471 Bacteria 535
223 Ga0070699_100138603 3300005518 Bacteria 2147
224 Ga0070699_100229241 3300005518 Bacteria 1656
225 Ga0070699_100339822 3300005518 Bacteria 1351
226 Ga0070679_100000982 3300005530 Bacteria 24847
227 Ga0070679_100037915 3300005530 Bacteria 4789
228 Ga0070679_100054240 3300005530 Bacteria 3990
229 Ga0070679_100501195 3300005530 Bacteria 1158
230 Ga0070679_100622503 3300005530 Bacteria 1022
231 Ga0070679_100803257 3300005530 Unclassified 884
232 Ga0070679_101545380 3300005530 Bacteria 611
233 Ga0070679_102156016 3300005530 Bacteria 507
234 Ga0070684_100001264 3300005535 Bacteria 18112
235 Ga0070684_100001594 3300005535 Bacteria 16385
236 Ga0070684_100007013 3300005535 Bacteria 8756
237 Ga0070684_100008199 3300005535 Bacteria 8161
238 Ga0070684_100030928 3300005535 Bacteria 4553
239 Ga0070684_100040125 3300005535 Bacteria 4029
240 Ga0070684_100056948 3300005535 Bacteria 3412
241 Ga0070684_100247614 3300005535 Bacteria 1629
242 Ga0070684_100261779 3300005535 Bacteria 1582
243 Ga0070684_100452601 3300005535 Bacteria 1187
244 Ga0070684_100813859 3300005535 Unclassified 873
245 Ga0070684_101114176 3300005535 Bacteria 742
246 Ga0070684_101720764 3300005535 Unclassified 592
247 Ga0068853_100004216 3300005539 Bacteria 11098
248 Ga0068853_100135291 3300005539 Bacteria 2209
249 Ga0068853_100470079 3300005539 Bacteria 1184
250 Ga0068853_100626577 3300005539 Bacteria 1022
251 Ga0068853_100660290 3300005539 Bacteria 996
252 Ga0070672_100050734 3300005543 Bacteria 3233
253 Ga0070672_100196404 3300005543 Bacteria 1686
254 Ga0070672_100289656 3300005543 Bacteria 1386
255 Ga0070686_100017723 3300005544 Bacteria 4167
256 Ga0070686_100034570 3300005544 Bacteria 3116
257 Ga0070686_100101178 3300005544 Bacteria 1947
258 Ga0070686_100145356 3300005544 Bacteria 1655
259 Ga0070686_100146231 3300005544 Bacteria 1650
260 Ga0070686_100725652 3300005544 Bacteria 795
261 Ga0070686_100975670 3300005544 Bacteria 694
262 Ga0070695_100080033 3300005545 Bacteria 2158
263 Ga0070695_100917901 3300005545 Bacteria 708
264 Ga0070695_101177250 3300005545 Bacteria 630
265 Ga0070695_101204935 3300005545 Bacteria 623
266 Ga0070696_100098428 3300005546 Bacteria 2092
267 Ga0070696_100126091 3300005546 Bacteria 1858
268 Ga0070696_100285021 3300005546 Bacteria 1260
269 Ga0070696_100585367 3300005546 Bacteria 898
270 Ga0070696_100625980 3300005546 Bacteria 870
271 Ga0070696_101240952 3300005546 Bacteria 631
272 Ga0070693_100050501 3300005547 Bacteria 2378
273 Ga0070693_100073346 3300005547 Bacteria 2022
274 Ga0070693_100127603 3300005547 Bacteria 1585
275 Ga0070693_100254806 3300005547 Bacteria 1165
276 Ga0070693_101326582 3300005547 Bacteria 557
277 Ga0070665_100000040 3300005548 Bacteria 305480
278 Ga0070665_100010065 3300005548 Bacteria 9570
279 Ga0070665_100105007 3300005548 Bacteria 2827
280 Ga0070665_100164838 3300005548 Bacteria 2218
281 Ga0070665_100488319 3300005548 Bacteria 1242
282 Ga0070665_100932749 3300005548 Bacteria 881
283 Ga0070665_101912820 3300005548 Bacteria 599
284 Ga0070665_101991134 3300005548 Bacteria 586
285 Ga0070704_100012954 3300005549 Bacteria 5159
286 Ga0070704_100040445 3300005549 Bacteria 3209
287 Ga0070704_100185905 3300005549 Bacteria 1666
288 Ga0070704_101812142 3300005549 Bacteria 565
289 Ga0068855_100019406 3300005563 Bacteria 8169
290 Ga0068855_100135354 3300005563 Bacteria 2811
291 Ga0068855_100269247 3300005563 Bacteria 1895
292 Ga0068855_100521859 3300005563 Bacteria 1288
293 Ga0068855_100577018 3300005563 Bacteria 1215
294 Ga0070664_100005802 3300005564 Bacteria 9960
295 Ga0070664_100023319 3300005564 Bacteria 5110
296 Ga0070664_100126027 3300005564 Bacteria 2247
297 Ga0070664_100294422 3300005564 Bacteria 1465
298 Ga0070664_100482761 3300005564 Bacteria 1140
299 Ga0070664_102365273 3300005564 Bacteria 504
300 Ga0068857_100008127 3300005577 Bacteria 9057
301 Ga0068857_100046336 3300005577 Bacteria 3858
302 Ga0068857_100083748 3300005577 Bacteria 2849
303 Ga0068857_100110534 3300005577 Bacteria 2470
304 Ga0068857_100368479 3300005577 Bacteria 1332
305 Ga0068857_100822648 3300005577 Bacteria 888
306 Ga0068854_100000065 3300005578 Bacteria 76046
307 Ga0068854_100022177 3300005578 Bacteria 4321
308 Ga0068854_100088699 3300005578 Bacteria 2297
309 Ga0068854_100274373 3300005578 Bacteria 1355
310 Ga0068854_100292080 3300005578 Bacteria 1316
311 Ga0068854_100496957 3300005578 Bacteria 1026
312 Ga0068854_100654012 3300005578 Bacteria 903
313 Ga0068854_101252734 3300005578 Bacteria 666
314 Ga0068854_102269898 3300005578 Bacteria 503
315 Ga0068854_102276266 3300005578 Bacteria 502
316 Ga0068856_100027642 3300005614 Bacteria 5534
317 Ga0068856_100035505 3300005614 Bacteria 4886
318 Ga0068856_100358249 3300005614 Bacteria 1477
319 Ga0068856_101233540 3300005614 Bacteria 764
320 Ga0070702_100020610 3300005615 Bacteria 3456
321 Ga0070702_100025470 3300005615 Bacteria 3170
322 Ga0070702_100057471 3300005615 Bacteria 2251
323 Ga0070702_100127646 3300005615 Bacteria 1602
324 Ga0070702_100395670 3300005615 Bacteria 987
325 Ga0070702_100447669 3300005615 Bacteria 936
326 Ga0070702_100610427 3300005615 Bacteria 819
327 Ga0070702_100968711 3300005615 Bacteria 671
328 Ga0068852_100000094 3300005616 Bacteria 59653
329 Ga0068852_100002610 3300005616 Bacteria 12453
330 Ga0068852_100075352 3300005616 Bacteria 2976
331 Ga0068852_100109600 3300005616 Bacteria 2507
332 Ga0068852_100115680 3300005616 Bacteria 2445
333 Ga0068852_100178616 3300005616 Bacteria 1994
334 Ga0068852_100670724 3300005616 Bacteria 1045
335 Ga0068852_102064641 3300005616 Bacteria 592
336 Ga0068859_100153039 3300005617 Bacteria 2382
337 Ga0068859_100158352 3300005617 Bacteria 2343
338 Ga0068859_101482278 3300005617 Bacteria 749
339 Ga0068864_100178432 3300005618 Bacteria 1940
340 Ga0068864_100585934 3300005618 Bacteria 1081
341 Ga0068866_10000340 3300005718 Bacteria 22024
342 Ga0068866_10065807 3300005718 Bacteria 1897
343 Ga0068866_10234124 3300005718 Bacteria 1115
344 Ga0068866_11009231 3300005718 Bacteria 592
345 Ga0068866_11120812 3300005718 Bacteria 564
346 Ga0068861_100061971 3300005719 Bacteria 2871
347 Ga0068861_100351837 3300005719 Bacteria 1292
348 Ga0068851_10000355 3300005834 Bacteria 20703
349 Ga0068851_10011523 3300005834 Bacteria 4148
350 Ga0068851_10014806 3300005834 Bacteria 3709
351 Ga0068851_10149530 3300005834 Bacteria 1276
352 Ga0068851_10602651 3300005834 Bacteria 669
353 Ga0068870_10035630 3300005840 Bacteria 2555
354 Ga0068870_10204536 3300005840 Bacteria 1199
355 Ga0068863_100033001 3300005841 Bacteria 4932
356 Ga0068863_100566437 3300005841 Bacteria 1123
357 Ga0068863_101171658 3300005841 Bacteria 774
358 Ga0068863_101758424 3300005841 Bacteria 630
359 Ga0068858_100001002 3300005842 Bacteria 29191
360 Ga0068858_100080459 3300005842 Bacteria 3027
361 Ga0068858_100237057 3300005842 Bacteria 1730
362 Ga0068858_100651194 3300005842 Bacteria 1024
363 Ga0068858_100800160 3300005842 Bacteria 920
364 Ga0068860_100170556 3300005843 Bacteria 2102
365 Ga0068860_100173094 3300005843 Bacteria 2086
366 Ga0068860_100534755 3300005843 Bacteria 1173
367 Ga0068860_102511768 3300005843 Bacteria 535
368 Ga0068862_100851260 3300005844 Bacteria 894
369 Ga0068862_100987590 3300005844 Bacteria 832
370 Ga0068862_101896024 3300005844 Unclassified 606
371 Ga0068862_101900671 3300005844 Bacteria 605
372 Ga0081455_10011124 3300005937 Bacteria 9058
373 Ga0081455_10038588 3300005937 Bacteria 4228
374 Ga0081455_10129299 3300005937 Bacteria 1977
375 Ga0081455_10230124 3300005937 Bacteria 1368
376 Ga0081538_10001123 3300005981 Bacteria 28341
377 Ga0081538_10003844 3300005981 Bacteria 14025
378 Ga0081538_10023272 3300005981 Bacteria 4458
379 Ga0081538_10085366 3300005981 Bacteria 1659
380 Ga0081539_10098156 3300005985 Bacteria 1499
381 Ga0081539_10382784 3300005985 Bacteria 587
382 Ga0070717_10282341 3300006028 Bacteria 1473
383 Ga0070717_10576675 3300006028 Bacteria 1020
384 Ga0070717_10910368 3300006028 Bacteria 801
385 Ga0070717_10922377 3300006028 Unclassified 795
386 Ga0070717_11527694 3300006028 Bacteria 606
387 Ga0075365_10000710 3300006038 Bacteria 13422
388 Ga0075365_10023169 3300006038 Bacteria 3902
389 Ga0075365_10152125 3300006038 Bacteria 1610
390 Ga0075365_10170493 3300006038 Unclassified 1519
391 Ga0075365_10200192 3300006038 Bacteria 1399
392 Ga0075368_10106594 3300006042 Bacteria 1153
393 Ga0075363_100053857 3300006048 Bacteria 2151
394 Ga0075364_10001605 3300006051 Bacteria 12371
395 Ga0075364_10044242 3300006051 Bacteria 2896
396 Ga0075364_10804622 3300006051 Bacteria 641
397 Ga0075432_10000919 3300006058 Bacteria 9281
398 Ga0075432_10044611 3300006058 Bacteria 1555
399 Ga0075432_10303635 3300006058 Bacteria 663
400 Ga0075432_10330243 3300006058 Bacteria 641
401 Ga0075432_10468491 3300006058 Bacteria 556
402 Ga0070715_10435325 3300006163 Bacteria 737
403 Ga0070715_10955849 3300006163 Unclassified 531
404 Ga0070716_100059816 3300006173 Bacteria 2198
405 Ga0070712_100020573 3300006175 Bacteria 4320
406 Ga0070712_100026650 3300006175 Bacteria 3853
407 Ga0070712_100336794 3300006175 Bacteria 1231
408 Ga0070712_100519789 3300006175 Bacteria 1000
409 Ga0070712_100552879 3300006175 Bacteria 970
410 Ga0070712_100639886 3300006175 Bacteria 903
411 Ga0070712_100972708 3300006175 Unclassified 734
412 Ga0070712_101295523 3300006175 Bacteria 635
413 Ga0070712_101590163 3300006175 Bacteria 572
414 Ga0075367_10129909 3300006178 Bacteria 1557
415 Ga0075367_10564054 3300006178 Bacteria 723
416 Ga0075367_10969403 3300006178 Bacteria 543
417 Ga0097621_100540480 3300006237 Bacteria 1060
418 Ga0097621_100562815 3300006237 Bacteria 1039
419 Ga0068871_100095814 3300006358 Bacteria 2479
420 Ga0068871_100738933 3300006358 Bacteria 904
421 Ga0075428_100002371 3300006844 Bacteria 20453
422 Ga0075428_100183723 3300006844 Bacteria 2263
423 Ga0075428_100356392 3300006844 Bacteria 1570
424 Ga0075428_100372457 3300006844 Bacteria 1531
425 Ga0075428_100683328 3300006844 Bacteria 1094
426 Ga0075431_100000832 3300006847 Bacteria 26974
427 Ga0075431_100104444 3300006847 Bacteria 2924
428 Ga0075431_100518975 3300006847 Bacteria 1181
429 Ga0075431_100594108 3300006847 Bacteria 1091
430 Ga0075431_101826512 3300006847 Bacteria 564
431 Ga0075433_10024851 3300006852 Bacteria 5061
432 Ga0075433_10036220 3300006852 Bacteria 4249
433 Ga0075433_10044706 3300006852 Bacteria 3848
434 Ga0075433_10052664 3300006852 Bacteria 3547
435 Ga0075433_10412131 3300006852 Bacteria 1192
436 Ga0075433_10438085 3300006852 Bacteria 1152
437 Ga0075433_10750106 3300006852 Bacteria 854
438 Ga0075434_100000243 3300006871 Bacteria 38048
439 Ga0075434_100005700 3300006871 Bacteria 11373
440 Ga0075434_100049932 3300006871 Bacteria 4155
441 Ga0075434_100093505 3300006871 Bacteria 3010
442 Ga0075434_100159208 3300006871 Bacteria 2278
443 Ga0075434_100368723 3300006871 Bacteria 1457
444 Ga0075434_101188209 3300006871 Bacteria 775
445 Ga0075434_101341674 3300006871 Bacteria 726
446 Ga0075429_100322807 3300006880 Bacteria 1351
447 Ga0075429_100510759 3300006880 Bacteria 1053
448 Ga0075429_101371121 3300006880 Bacteria 616
449 Ga0068865_100008017 3300006881 Bacteria 6522
450 Ga0068865_100019702 3300006881 Bacteria 4368
451 Ga0068865_100021907 3300006881 Bacteria 4161
452 Ga0068865_100179598 3300006881 Bacteria 1629
453 Ga0068865_100180678 3300006881 Bacteria 1624
454 Ga0068865_100278984 3300006881 Bacteria 1330
455 Ga0068865_100359630 3300006881 Bacteria 1182
456 Ga0075436_100851955 3300006914 Unclassified 680
457 Ga0097620_100153039 3300006931 Bacteria 2382
458 Ga0097620_100158343 3300006931 Bacteria 2343
459 Ga0097620_101482400 3300006931 Bacteria 749
460 Ga0097620_102945002 3300006931 Bacteria 521
461 Ga0075435_100035003 3300007076 Bacteria 3983
462 Ga0075435_100060825 3300007076 Bacteria 3063
463 Ga0075435_100243878 3300007076 Bacteria 1529
464 Ga0075435_100959723 3300007076 Bacteria 746
465 Ga0075435_101136519 3300007076 Bacteria 683
466 Ga0105244_10305238 3300009036 Bacteria 736
467 Ga0105240_10572202 3300009093 Bacteria 1247
468 Ga0111539_10002660 3300009094 Bacteria 23683
469 Ga0111539_10052577 3300009094 Bacteria 4849
470 Ga0111539_10061209 3300009094 Bacteria 4460
471 Ga0111539_10136259 3300009094 Bacteria 2875
472 Ga0111539_10551537 3300009094 Bacteria 1342
473 Ga0111539_11028344 3300009094 Bacteria 958
474 Ga0111539_11097438 3300009094 Bacteria 925
475 Ga0111539_11372537 3300009094 Bacteria 820
476 Ga0111539_11398067 3300009094 Bacteria 812
477 Ga0111539_11730719 3300009094 Bacteria 725
478 Ga0111539_12179355 3300009094 Bacteria 643
479 Ga0111539_12299373 3300009094 Bacteria 625
480 Ga0105245_10001072 3300009098 Bacteria 24802
481 Ga0105245_10003665 3300009098 Bacteria 13715
482 Ga0105245_10003973 3300009098 Bacteria 13150
483 Ga0105245_10013875 3300009098 Bacteria 7020
484 Ga0105245_10014821 3300009098 Bacteria 6791
485 Ga0105245_10027098 3300009098 Bacteria 5049
486 Ga0105245_10097380 3300009098 Bacteria 2717
487 Ga0105245_10131445 3300009098 Bacteria 2348
488 Ga0105245_10136282 3300009098 Bacteria 2307
489 Ga0105245_10144818 3300009098 Bacteria 2241
490 Ga0105245_10149975 3300009098 Bacteria 2204
491 Ga0105245_10191399 3300009098 Bacteria 1960
492 Ga0105245_10993757 3300009098 Unclassified 883
493 Ga0105245_11015807 3300009098 Bacteria 874
494 Ga0105245_11416892 3300009098 Bacteria 745
495 Ga0105245_11434146 3300009098 Bacteria 741
496 Ga0105245_11785749 3300009098 Bacteria 668
497 Ga0105245_11949583 3300009098 Bacteria 641
498 Ga0105247_10160803 3300009101 Bacteria 1487
499 Ga0105247_10210849 3300009101 Bacteria 1310
500 Ga0105247_11551331 3300009101 Bacteria 542
501 Ga0114129_10035952 3300009147 Bacteria 6995
502 Ga0114129_10171836 3300009147 Bacteria 2954
503 Ga0114129_10218841 3300009147 Bacteria 2570
504 Ga0114129_10371854 3300009147 Bacteria 1889
505 Ga0114129_10590759 3300009147 Bacteria 1440
506 Ga0114129_10677648 3300009147 Bacteria 1328
507 Ga0114129_10877564 3300009147 Bacteria 1138
508 Ga0114129_10991566 3300009147 Bacteria 1058
509 Ga0114129_11034344 3300009147 Bacteria 1032
510 Ga0114129_11093086 3300009147 Bacteria 999
511 Ga0114129_11763692 3300009147 Bacteria 754
512 Ga0114129_12410214 3300009147 Bacteria 630
513 Ga0105243_10011477 3300009148 Bacteria 6702
514 Ga0105243_10032297 3300009148 Bacteria 4043
515 Ga0105243_10042904 3300009148 Bacteria 3544
516 Ga0105243_10164477 3300009148 Bacteria 1916
517 Ga0105243_10510008 3300009148 Bacteria 1141
518 Ga0105243_11136485 3300009148 Bacteria 791
519 Ga0105243_11280456 3300009148 Bacteria 749
520 Ga0105243_12390571 3300009148 Bacteria 567
521 Ga0105243_12935556 3300009148 Bacteria 517
522 Ga0105241_10017025 3300009174 Bacteria 5335
523 Ga0105241_10117578 3300009174 Bacteria 2137
524 Ga0105241_10140989 3300009174 Bacteria 1962
525 Ga0105241_10436870 3300009174 Bacteria 1155
526 Ga0105241_10517332 3300009174 Bacteria 1067
527 Ga0105241_12387913 3300009174 Bacteria 528
528 Ga0105242_10000732 3300009176 Bacteria 25604
529 Ga0105242_10001790 3300009176 Bacteria 16949
530 Ga0105242_10018497 3300009176 Bacteria 5448
531 Ga0105242_10158578 3300009176 Bacteria 1979
532 Ga0105242_10182350 3300009176 Bacteria 1853
533 Ga0105242_10189690 3300009176 Bacteria 1819
534 Ga0105242_10292927 3300009176 Bacteria 1483
535 Ga0105242_10345251 3300009176 Bacteria 1373
536 Ga0105242_10566771 3300009176 Bacteria 1091
537 Ga0105242_10660188 3300009176 Bacteria 1018
538 Ga0105242_10931476 3300009176 Bacteria 871
539 Ga0105242_12702900 3300009176 Bacteria 546
540 Ga0105242_13087353 3300009176 Bacteria 516
541 Ga0105248_10107192 3300009177 Bacteria 3150
542 Ga0105248_10107473 3300009177 Bacteria 3146
543 Ga0105248_10398516 3300009177 Bacteria 1550
544 Ga0105248_11580605 3300009177 Bacteria 743
545 Ga0105248_11615858 3300009177 Bacteria 734
546 Ga0105237_10003430 3300009545 Bacteria 18830
547 Ga0105237_10071906 3300009545 Bacteria 3453
548 Ga0105237_10909550 3300009545 Bacteria 887
549 Ga0105237_11316270 3300009545 Bacteria 729
550 Ga0105237_12399504 3300009545 Bacteria 538
551 Ga0105238_10226679 3300009551 Bacteria 1845
552 Ga0105238_10228783 3300009551 Bacteria 1836
553 Ga0105238_10297107 3300009551 Bacteria 1598
554 Ga0105238_10485948 3300009551 Bacteria 1234
555 Ga0105238_11012583 3300009551 Bacteria 852
556 Ga0105238_11439760 3300009551 Bacteria 717
557 Ga0105238_11965669 3300009551 Bacteria 618
558 Ga0105249_10092394 3300009553 Bacteria 2833
559 Ga0105249_10136832 3300009553 Bacteria 2345
560 Ga0105249_10394119 3300009553 Bacteria 1413
561 Ga0105249_10489108 3300009553 Bacteria 1274
562 Ga0105249_10833412 3300009553 Bacteria 987
563 Ga0105249_11782285 3300009553 Bacteria 688
564 Ga0105249_12182055 3300009553 Bacteria 627
565 Ga0105249_13304204 3300009553 Bacteria 519
566 Ga0105239_10012638 3300010375 Bacteria 9394
567 Ga0105239_10072941 3300010375 Bacteria 3774
568 Ga0105239_10097736 3300010375 Bacteria 3245
569 Ga0105239_10127914 3300010375 Bacteria 2824
570 Ga0105239_10168730 3300010375 Bacteria 2447
571 Ga0105239_10179318 3300010375 Bacteria 2370
572 Ga0105239_10265764 3300010375 Bacteria 1929
573 Ga0105239_10664719 3300010375 Bacteria 1190
574 Ga0105239_10713661 3300010375 Bacteria 1147
575 Ga0105239_10760308 3300010375 Bacteria 1109
576 Ga0105239_11823280 3300010375 Bacteria 705
577 Ga0105246_10114970 3300011119 Bacteria 1984
578 Ga0105246_10140934 3300011119 Bacteria 1813
579 Ga0105246_10173293 3300011119 Bacteria 1654
580 Ga0105246_10726113 3300011119 Bacteria 873
581 Ga0105246_10748164 3300011119 Bacteria 862
582 Ga0105246_12483897 3300011119 Bacteria 510
583 Ga0157319_1012223 3300012497 Bacteria 721
584 Ga0157347_1056512 3300012502 Bacteria 552
585 Ga0157313_1030911 3300012503 Bacteria 607
586 Ga0157339_1016698 3300012505 Bacteria 738
587 Ga0157339_1048744 3300012505 Bacteria 554
588 Ga0157316_1038490 3300012510 Bacteria 613
589 Ga0157338_1091728 3300012515 Bacteria 508
590 Ga0157371_10015479 3300013102 Bacteria 5720
591 Ga0157371_10017938 3300013102 Bacteria 5246
592 Ga0157371_10087501 3300013102 Bacteria 2206
593 Ga0157371_10217803 3300013102 Bacteria 1371
594 Ga0157371_11016167 3300013102 Bacteria 633
595 Ga0157371_11128969 3300013102 Bacteria 602
596 Ga0157370_10036811 3300013104 Bacteria 4747
597 Ga0157370_10171795 3300013104 Bacteria 2015
598 Ga0157370_10333402 3300013104 Bacteria 1398
599 Ga0157370_10661128 3300013104 Bacteria 955
600 Ga0157370_11064867 3300013104 Unclassified 731
601 Ga0157370_11105891 3300013104 Bacteria 716
602 Ga0157369_10010013 3300013105 Bacteria 10828
603 Ga0157369_10121144 3300013105 Bacteria 2776
604 Ga0157369_10246010 3300013105 Bacteria 1867
605 Ga0157369_10263753 3300013105 Bacteria 1796
606 Ga0157369_10615525 3300013105 Bacteria 1121
607 Ga0157369_10745106 3300013105 Bacteria 1008
608 Ga0157369_11115404 3300013105 Bacteria 806
609 Ga0157374_10021720 3300013296 Bacteria 5715
610 Ga0157374_10154152 3300013296 Bacteria 2235
611 Ga0157374_10412787 3300013296 Bacteria 1348
612 Ga0157374_10645307 3300013296 Bacteria 1070
613 Ga0157374_11053921 3300013296 Bacteria 833
614 Ga0157374_11382360 3300013296 Bacteria 727
615 Ga0157374_12920754 3300013296 Bacteria 505
616 Ga0157378_10010027 3300013297 Bacteria 8259
617 Ga0157378_10168855 3300013297 Bacteria 2050
618 Ga0157378_10672541 3300013297 Bacteria 1053
619 Ga0157378_11218633 3300013297 Bacteria 792
620 Ga0157378_12279251 3300013297 Bacteria 593
621 Ga0163162_10308065 3300013306 Bacteria 1716
622 Ga0163162_10515240 3300013306 Bacteria 1326
623 Ga0163162_11151907 3300013306 Bacteria 879
624 Ga0163162_11518034 3300013306 Bacteria 763
625 Ga0163162_12513652 3300013306 Bacteria 592
626 Ga0163162_13292707 3300013306 Bacteria 517
627 Ga0157372_10010592 3300013307 Bacteria 9808
628 Ga0157372_10020049 3300013307 Bacteria 7209
629 Ga0157372_10180310 3300013307 Bacteria 2445
630 Ga0157372_10327308 3300013307 Bacteria 1784
631 Ga0157372_10508640 3300013307 Bacteria 1404
632 Ga0157372_10528207 3300013307 Bacteria 1375
633 Ga0157372_11190767 3300013307 Bacteria 881
634 Ga0157372_12248381 3300013307 Bacteria 626
635 Ga0157375_10019710 3300013308 Bacteria 6143
636 Ga0157375_10039332 3300013308 Bacteria 4552
637 Ga0157375_10041080 3300013308 Bacteria 4464
638 Ga0157375_10063832 3300013308 Bacteria 3666
639 Ga0157375_10090707 3300013308 Bacteria 3116
640 Ga0157375_10302550 3300013308 Bacteria 1763
641 Ga0157375_10462632 3300013308 Bacteria 1434
642 Ga0157375_10531558 3300013308 Bacteria 1339
643 Ga0157375_10537861 3300013308 Bacteria 1331
644 Ga0157375_10645895 3300013308 Bacteria 1215
645 Ga0157375_10646759 3300013308 Bacteria 1214
646 Ga0157375_11927875 3300013308 Bacteria 702
647 Ga0157375_13634543 3300013308 Bacteria 513
648 Ga0163163_10021419 3300014325 Bacteria 6101
649 Ga0163163_10459333 3300014325 Bacteria 1334
650 Ga0163163_10541729 3300014325 Bacteria 1226
651 Ga0163163_10567435 3300014325 Bacteria 1198
652 Ga0163163_10608158 3300014325 Bacteria 1156
653 Ga0163163_10877117 3300014325 Bacteria 961
654 Ga0163163_10919224 3300014325 Bacteria 938
655 Ga0163163_11416565 3300014325 Bacteria 757
656 Ga0157380_10000614 3300014326 Bacteria 21967
657 Ga0157380_10141409 3300014326 Bacteria 2068
658 Ga0157380_10179243 3300014326 Bacteria 1860
659 Ga0157380_10251184 3300014326 Bacteria 1601
660 Ga0157380_10324946 3300014326 Bacteria 1428
661 Ga0157380_10935614 3300014326 Bacteria 895
662 Ga0157380_11910174 3300014326 Bacteria 654
663 Ga0182008_10361609 3300014497 Bacteria 772
664 Ga0157377_10006107 3300014745 Bacteria 5717
665 Ga0157377_10020382 3300014745 Bacteria 3472
666 Ga0157377_10094917 3300014745 Bacteria 1767
667 Ga0157377_10347034 3300014745 Bacteria 995
668 Ga0157377_10770109 3300014745 Bacteria 706
669 Ga0157377_11200306 3300014745 Unclassified 587
670 Ga0157377_11475471 3300014745 Bacteria 540
671 Ga0157379_10042398 3300014968 Bacteria 4063
672 Ga0157379_10050707 3300014968 Bacteria 3706
673 Ga0157379_10268030 3300014968 Bacteria 1552
674 Ga0157379_11572287 3300014968 Bacteria 641
675 Ga0157376_10113883 3300014969 Bacteria 2385
676 Ga0157376_10129847 3300014969 Bacteria 2247
677 Ga0157376_10217249 3300014969 Bacteria 1768
678 Ga0157376_10405872 3300014969 Bacteria 1319
679 Ga0157376_10643515 3300014969 Bacteria 1060
680 Ga0157376_10872197 3300014969 Bacteria 916
681 Ga0182006_1057247 3300015261 Bacteria 1482
682 Ga0163161_10225749 3300017792 Bacteria 1452
683 Ga0207656_10498361 3300025321 Bacteria 618
684 Ga0207653_10151009 3300025885 Bacteria 855
685 Ga0207642_10001965 3300025899 Bacteria 6347
686 Ga0207688_10028282 3300025901 Bacteria 3084
687 Ga0207680_10105730 3300025903 Bacteria 1816
688 Ga0207643_10028510 3300025908 Bacteria 3101
689 Ga0207643_10253966 3300025908 Bacteria 1084
690 Ga0207684_10886491 3300025910 Bacteria 751
691 Ga0207657_10691557 3300025919 Bacteria 792
692 Ga0207652_10828744 3300025921 Bacteria 820
693 Ga0207681_10158403 3300025923 Bacteria 1704
694 Ga0207650_10600795 3300025925 Bacteria 925
695 Ga0207659_10059310 3300025926 Bacteria 2750
696 Ga0207706_10053850 3300025933 Bacteria 3552
697 Ga0207686_10120851 3300025934 Bacteria 1783
698 Ga0207686_10132529 3300025934 Bacteria 1711
699 Ga0207709_10062106 3300025935 Bacteria 2337
700 Ga0207670_10808834 3300025936 Bacteria 781
701 Ga0207669_10000006 3300025937 Bacteria 176348
702 Ga0207669_10242542 3300025937 Bacteria 1337
703 Ga0207704_10182901 3300025938 Bacteria 1516
704 Ga0207691_10002148 3300025940 Bacteria 19308
705 Ga0207691_10012713 3300025940 Bacteria 8063
706 Ga0207711_11020077 3300025941 Bacteria 767
707 Ga0207689_10024184 3300025942 Bacteria 5096
708 Ga0207661_10770716 3300025944 Bacteria 886
709 Ga0207679_11110327 3300025945 Bacteria 725
710 Ga0207651_10111451 3300025960 Bacteria 2055
711 Ga0207712_10038389 3300025961 Bacteria 3275
712 Ga0207712_11210182 3300025961 Bacteria 674
713 Ga0207640_10148495 3300025981 Bacteria 1719
714 Ga0207703_10591168 3300026035 Bacteria 1049
715 Ga0207639_11515920 3300026041 Bacteria 629
716 Ga0207678_10025505 3300026067 Bacteria 5160
717 Ga0207708_10009906 3300026075 Bacteria 7075
718 Ga0207676_10179105 3300026095 Bacteria 1854
719 Ga0207675_100021148 3300026118 Bacteria 6062
720 Ga0207675_102371015 3300026118 Bacteria 543
721 Ga0207675_102473793 3300026118 Bacteria 530
722 Ga0268266_10640533 3300028379 Bacteria 1022
723 Ga0268264_10047758 3300028381 Bacteria 3559
724 Ga0307406_11486848 3300031901 Bacteria 596
725 Ga0307416_100300145 3300032002 Bacteria 1596
726 Ga0307416_100730923 3300032002 Bacteria 1081
727 Ga0307415_100791125 3300032126 Bacteria 865
728 Ga0373959_0087201 3300034820 Bacteria 727
729 Ga0373938_0032226 3300034957 Bacteria 1128
730 Ga0373941_0414815 3300035115 Bacteria 559
731 Ga0373960_0015897 3300035121 Bacteria 1928
732 Ga0395899_0230739 3300037312 Bacteria 1278
733 Ga0395900_0172368 3300037418 Bacteria 2202
734 Ga0395898_0085417 3300037466 Bacteria 3042
735 Ga0395905_0315498 3300037471 Bacteria 1452
736 Ga0395905_1020881 3300037471 Bacteria 730
737 Ga0395901_0010134 3300038443 Bacteria 9550
738 Ga0395901_0370095 3300038443 Bacteria 1476
739 Ga0495617_139442 3300046452 Bacteria 775
740 Ga0495630_0000012 3300046517 Bacteria 223330
741 Ga0495644_0069735 3300046523 Bacteria 1321
742 Ga0495587_0731778 3300046536 Bacteria 542
743 Ga0495633_0395802 3300046558 Bacteria 625
744 Ga0495656_0242562 3300046615 Bacteria 908
745 Ga0495659_0125614 3300046664 Bacteria 1014
746 Ga0495599_0005015 3300046678 Bacteria 7877
747 Ga0495613_0703685 3300046689 Unclassified 665
748 Ga0495589_0586067 3300046794 Bacteria 508
749 Ga0495677_0392198 3300047445 Bacteria 549
750 Ga0496105_0119839 3300048908 Bacteria 2170
751 Ga0496108_0147702 3300048911 Bacteria 2027
752 Ga0496109_0319314 3300048912 Bacteria 1465
753 Ga0496110_0130781 3300048913 Bacteria 2266
754 Ga0496111_0493527 3300048914 Bacteria 901
755 Ga0496113_0398198 3300048916 Bacteria 1105
756 Ga0496114_0084884 3300048917 Bacteria 2681
757 nmdc:mga0a205_681053_c1 3300050515 Bacteria 879
758 Ga0495595_0168339 3300053084 Unclassified 1084
759 Ga0070676_10146071
760 JGI24746J21847_1000294
761 JGI24748J21848_1035848
762 JGI24034J26672_10000246
763 JGI24742J22300_10001869
764 rootH2_10086106
765 JGI25407J50210_10182057
766 JGI25404J52841_10079918
767 Ga0070658_10226281
768 Ga0070658_10246997
769 Ga0070658_10281033
770 Ga0070658_10515326
771 Ga0070658_11012160
772 Ga0070658_11522297
773 Ga0070676_10068783
774 Ga0070676_10072256
775 Ga0070683_100008260
776 Ga0070683_100021138
777 Ga0070683_100022356
778 Ga0070683_100025552
779 Ga0070683_100031264
780 Ga0070683_100069056
781 Ga0070683_101094226
782 Ga0070683_101498146
783 Ga0070670_100059328
784 Ga0070670_100214958
785 Ga0070670_100232648
786 Ga0068869_100034615
787 Ga0068869_100047776
788 Ga0068869_100121217
789 Ga0068869_100167033
790 Ga0068869_101319210
791 Ga0070666_10026450
792 Ga0070666_10410953
793 Ga0070666_10755883
794 Ga0070680_100032301
795 Ga0070680_100058647
796 Ga0070680_100446370
797 Ga0070680_100459191
798 Ga0070680_100622939
799 Ga0070680_101593285
800 Ga0070682_100000708
801 Ga0070682_100002641
802 Ga0070682_100003834
803 Ga0070682_100017680
804 Ga0070682_100029712
805 Ga0070682_100044892
806 Ga0070682_100349693
807 Ga0070682_100455859
808 Ga0068868_100004616
809 Ga0068868_100013301
810 Ga0068868_100140034
811 Ga0068868_100339848
812 Ga0068868_100347342
813 Ga0068868_101134273
814 Ga0068868_101317249
815 Ga0068868_101512999
816 Ga0070660_100032160
817 Ga0070660_100588700
818 Ga0070660_100677878
819 Ga0070660_100684393
820 Ga0070660_100770297
821 Ga0070689_100007794
822 Ga0070689_100033752
823 Ga0070689_100039510
824 Ga0070689_100102201
825 Ga0070691_10000001
826 Ga0070691_10008629
827 Ga0070691_10010821
828 Ga0070691_10520018
829 Ga0070691_10529077
830 Ga0070691_11058092
831 Ga0070687_100136437
832 Ga0070687_100570417
833 Ga0070661_100000223
834 Ga0070661_100006632
835 Ga0070661_100065144
836 Ga0070661_100081972
837 Ga0070661_100225337
838 Ga0070661_100508203
839 Ga0070661_100767953
840 Ga0070692_10031195
841 Ga0070692_10036582
842 Ga0070692_10096758
843 Ga0070692_10126693
844 Ga0070692_10165478
845 Ga0070692_11171730
846 Ga0070668_100098344
847 Ga0070668_100104123
848 Ga0070668_101305890
849 Ga0070668_101566102
850 Ga0070669_100450571
851 Ga0070669_100513916
852 Ga0070675_100000025
853 Ga0070675_100071878
854 Ga0070675_100121803
855 Ga0070675_100145575
856 Ga0070675_100285030
857 Ga0070675_101105315
858 Ga0070671_100492667
859 Ga0070671_102032884
860 Ga0070674_100066305
861 Ga0070674_100392547
862 Ga0070674_100475709
863 Ga0070674_100579506
864 Ga0070674_100673251
865 Ga0070673_100033994
866 Ga0070673_100457186
867 Ga0070673_101362882
868 Ga0070673_101475916
869 Ga0070688_100000069
870 Ga0070688_100001589
871 Ga0070688_100056090
872 Ga0070688_100142930
873 Ga0070688_100198827
874 Ga0070688_100356140
875 Ga0070688_100547612
876 Ga0070688_100660820
877 Ga0070688_101814947
878 Ga0070659_100010760
879 Ga0070659_100039831
880 Ga0070659_100115854
881 Ga0070659_100214002
882 Ga0070659_100237790
883 Ga0070659_100266063
884 Ga0070659_100585182
885 Ga0070667_100078627
886 Ga0070667_100135502
887 Ga0070667_100205782
888 Ga0070667_100600722
889 Ga0070703_10009201
890 Ga0070703_10381567
891 Ga0070709_10480009
892 Ga0070709_10660710
893 Ga0070709_10989302
894 Ga0070714_100149596
895 Ga0070714_100478496
896 Ga0070714_100668761
897 Ga0070714_100880694
898 Ga0070714_101276420
899 Ga0070714_102150278
900 Ga0070713_100000079
901 Ga0070713_100030706
902 Ga0070713_100120406
903 Ga0070713_100306444
904 Ga0070713_100567468
905 Ga0070713_101588099
906 Ga0070713_101854072
907 Ga0070710_10120005
908 Ga0070710_10211324
909 Ga0070710_11487318
910 Ga0070701_10031903
911 Ga0070701_10052333
912 Ga0070701_10088832
913 Ga0070701_10154826
914 Ga0070701_10287587
915 Ga0070701_10430365
916 Ga0070701_10930633
917 Ga0070711_100001934
918 Ga0070711_100007530
919 Ga0070711_100138903
920 Ga0070711_100155732
921 Ga0070711_100676819
922 Ga0070711_101349397
923 Ga0070711_101892084
924 Ga0070705_100234984
925 Ga0070705_101198142
926 Ga0070700_100004837
927 Ga0070700_100032041
928 Ga0070700_100045258
929 Ga0070700_100172052
930 Ga0070694_100181588
931 Ga0070694_100448159
932 Ga0070694_100572895
933 Ga0070694_101460793
934 Ga0070708_100553819
935 Ga0070708_101914271
936 Ga0070708_102268184
937 Ga0070663_100000454
938 Ga0070663_100011546
939 Ga0070663_100099013
940 Ga0070663_100746012
941 Ga0070663_101011570
942 Ga0070663_101872046
943 Ga0070678_100009903
944 Ga0070678_100010905
945 Ga0070678_100061891
946 Ga0070678_100303310
947 Ga0070678_101567620
948 Ga0070678_102099966
949 Ga0070662_100027154
950 Ga0070662_100035236
951 Ga0070662_100054771
952 Ga0070662_100080099
953 Ga0070662_100670508
954 Ga0070662_101380091
955 Ga0070662_101584403
956 Ga0070681_10075093
957 Ga0070681_10176456
958 Ga0070681_10391551
959 Ga0070681_10462131
960 Ga0070681_10807020
961 Ga0070681_11656229
962 Ga0070681_11662042
963 Ga0068867_100021497
964 Ga0068867_100240079
965 Ga0068867_100541239
966 Ga0068867_100611002
967 Ga0070685_10000024
968 Ga0070685_10001752
969 Ga0070685_10005261
970 Ga0070685_10032878
971 Ga0070685_10955502
972 Ga0070706_100698032
973 Ga0070706_101132498
974 Ga0070707_100326963
975 Ga0070707_100604515
976 Ga0070707_101344452
977 Ga0070698_100003507
978 Ga0070698_100054912
979 Ga0070698_101719541
980 Ga0070698_101986579
981 Ga0070699_100138603
982 Ga0070699_100229241
983 Ga0070699_100339822
984 Ga0070679_100000982
985 Ga0070679_100037915
986 Ga0070679_100054240
987 Ga0070679_100501195
988 Ga0070679_100622503
989 Ga0070679_100803257
990 Ga0070679_101545380
991 Ga0070679_102156016
992 Ga0070684_100001264
993 Ga0070684_100001594
994 Ga0070684_100007013
995 Ga0070684_100008199
996 Ga0070684_100030928
997 Ga0070684_100040125
998 Ga0070684_100056948
999 Ga0070684_100247614
1000 Ga0070684_100261779
1001 Ga0070684_100452601
1002 Ga0070684_100813859
1003 Ga0070684_101114176
1004 Ga0070684_101720764
1005 Ga0068853_100004216
1006 Ga0068853_100135291
1007 Ga0068853_100470079
1008 Ga0068853_100626577
1009 Ga0068853_100660290
1010 Ga0070672_100050734
1011 Ga0070672_100196404
1012 Ga0070672_100289656
1013 Ga0070686_100017723
1014 Ga0070686_100034570
1015 Ga0070686_100101178
1016 Ga0070686_100145356
1017 Ga0070686_100146231
1018 Ga0070686_100725652
1019 Ga0070686_100975670
1020 Ga0070695_100080033
1021 Ga0070695_100917901
1022 Ga0070695_101177250
1023 Ga0070695_101204935
1024 Ga0070696_100098428
1025 Ga0070696_100126091
1026 Ga0070696_100285021
1027 Ga0070696_100585367
1028 Ga0070696_100625980
1029 Ga0070696_101240952
1030 Ga0070693_100050501
1031 Ga0070693_100073346
1032 Ga0070693_100127603
1033 Ga0070693_100254806
1034 Ga0070693_101326582
1035 Ga0070665_100000040
1036 Ga0070665_100010065
1037 Ga0070665_100105007
1038 Ga0070665_100164838
1039 Ga0070665_100488319
1040 Ga0070665_100932749
1041 Ga0070665_101912820
1042 Ga0070665_101991134
1043 Ga0070704_100012954
1044 Ga0070704_100040445
1045 Ga0070704_100185905
1046 Ga0070704_101812142
1047 Ga0068855_100019406
1048 Ga0068855_100135354
1049 Ga0068855_100269247
1050 Ga0068855_100521859
1051 Ga0068855_100577018
1052 Ga0070664_100005802
1053 Ga0070664_100023319
1054 Ga0070664_100126027
1055 Ga0070664_100294422
1056 Ga0070664_100482761
1057 Ga0070664_102365273
1058 Ga0068857_100008127
1059 Ga0068857_100046336
1060 Ga0068857_100083748
1061 Ga0068857_100110534
1062 Ga0068857_100368479
1063 Ga0068857_100822648
1064 Ga0068854_100000065
1065 Ga0068854_100022177
1066 Ga0068854_100088699
1067 Ga0068854_100274373
1068 Ga0068854_100292080
1069 Ga0068854_100496957
1070 Ga0068854_100654012
1071 Ga0068854_101252734
1072 Ga0068854_102269898
1073 Ga0068854_102276266
1074 Ga0068856_100027642
1075 Ga0068856_100035505
1076 Ga0068856_100358249
1077 Ga0068856_101233540
1078 Ga0070702_100020610
1079 Ga0070702_100025470
1080 Ga0070702_100057471
1081 Ga0070702_100127646
1082 Ga0070702_100395670
1083 Ga0070702_100447669
1084 Ga0070702_100610427
1085 Ga0070702_100968711
1086 Ga0068852_100000094
1087 Ga0068852_100002610
1088 Ga0068852_100075352
1089 Ga0068852_100109600
1090 Ga0068852_100115680
1091 Ga0068852_100178616
1092 Ga0068852_100670724
1093 Ga0068852_102064641
1094 Ga0068859_100153039
1095 Ga0068859_100158352
1096 Ga0068859_101482278
1097 Ga0068864_100178432
1098 Ga0068864_100585934
1099 Ga0068866_10000340
1100 Ga0068866_10065807
1101 Ga0068866_10234124
1102 Ga0068866_11009231
1103 Ga0068866_11120812
1104 Ga0068861_100061971
1105 Ga0068861_100351837
1106 Ga0068851_10000355
1107 Ga0068851_10011523
1108 Ga0068851_10014806
1109 Ga0068851_10149530
1110 Ga0068851_10602651
1111 Ga0068870_10035630
1112 Ga0068870_10204536
1113 Ga0068863_100033001
1114 Ga0068863_100566437
1115 Ga0068863_101171658
1116 Ga0068863_101758424
1117 Ga0068858_100001002
1118 Ga0068858_100080459
1119 Ga0068858_100237057
1120 Ga0068858_100651194
1121 Ga0068858_100800160
1122 Ga0068860_100170556
1123 Ga0068860_100173094
1124 Ga0068860_100534755
1125 Ga0068860_102511768
1126 Ga0068862_100851260
1127 Ga0068862_100987590
1128 Ga0068862_101896024
1129 Ga0068862_101900671
1130 Ga0081455_10011124
1131 Ga0081455_10038588
1132 Ga0081455_10129299
1133 Ga0081455_10230124
1134 Ga0081538_10001123
1135 Ga0081538_10003844
1136 Ga0081538_10023272
1137 Ga0081538_10085366
1138 Ga0081539_10098156
1139 Ga0081539_10382784
1140 Ga0070717_10282341
1141 Ga0070717_10576675
1142 Ga0070717_10910368
1143 Ga0070717_10922377
1144 Ga0070717_11527694
1145 Ga0075365_10000710
1146 Ga0075365_10023169
1147 Ga0075365_10152125
1148 Ga0075365_10170493
1149 Ga0075365_10200192
1150 Ga0075368_10106594
1151 Ga0075363_100053857
1152 Ga0075364_10001605
1153 Ga0075364_10044242
1154 Ga0075364_10804622
1155 Ga0075432_10000919
1156 Ga0075432_10044611
1157 Ga0075432_10303635
1158 Ga0075432_10330243
1159 Ga0075432_10468491
1160 Ga0070715_10435325
1161 Ga0070715_10955849
1162 Ga0070716_100059816
1163 Ga0070712_100020573
1164 Ga0070712_100026650
1165 Ga0070712_100336794
1166 Ga0070712_100519789
1167 Ga0070712_100552879
1168 Ga0070712_100639886
1169 Ga0070712_100972708
1170 Ga0070712_101295523
1171 Ga0070712_101590163
1172 Ga0075367_10129909
1173 Ga0075367_10564054
1174 Ga0075367_10969403
1175 Ga0097621_100540480
1176 Ga0097621_100562815
1177 Ga0068871_100095814
1178 Ga0068871_100738933
1179 Ga0075428_100002371
1180 Ga0075428_100183723
1181 Ga0075428_100356392
1182 Ga0075428_100372457
1183 Ga0075428_100683328
1184 Ga0075431_100000832
1185 Ga0075431_100104444
1186 Ga0075431_100518975
1187 Ga0075431_100594108
1188 Ga0075431_101826512
1189 Ga0075433_10024851
1190 Ga0075433_10036220
1191 Ga0075433_10044706
1192 Ga0075433_10052664
1193 Ga0075433_10412131
1194 Ga0075433_10438085
1195 Ga0075433_10750106
1196 Ga0075434_100000243
1197 Ga0075434_100005700
1198 Ga0075434_100049932
1199 Ga0075434_100093505
1200 Ga0075434_100159208
1201 Ga0075434_100368723
1202 Ga0075434_101188209
1203 Ga0075434_101341674
1204 Ga0075429_100322807
1205 Ga0075429_100510759
1206 Ga0075429_101371121
1207 Ga0068865_100008017
1208 Ga0068865_100019702
1209 Ga0068865_100021907
1210 Ga0068865_100179598
1211 Ga0068865_100180678
1212 Ga0068865_100278984
1213 Ga0068865_100359630
1214 Ga0075436_100851955
1215 Ga0097620_100153039
1216 Ga0097620_100158343
1217 Ga0097620_101482400
1218 Ga0097620_102945002
1219 Ga0075435_100035003
1220 Ga0075435_100060825
1221 Ga0075435_100243878
1222 Ga0075435_100959723
1223 Ga0075435_101136519
1224 Ga0105244_10305238
1225 Ga0105240_10572202
1226 Ga0111539_10002660
1227 Ga0111539_10052577
1228 Ga0111539_10061209
1229 Ga0111539_10136259
1230 Ga0111539_10551537
1231 Ga0111539_11028344
1232 Ga0111539_11097438
1233 Ga0111539_11372537
1234 Ga0111539_11398067
1235 Ga0111539_11730719
1236 Ga0111539_12179355
1237 Ga0111539_12299373
1238 Ga0105245_10001072
1239 Ga0105245_10003665
1240 Ga0105245_10003973
1241 Ga0105245_10013875
1242 Ga0105245_10014821
1243 Ga0105245_10027098
1244 Ga0105245_10097380
1245 Ga0105245_10131445
1246 Ga0105245_10136282
1247 Ga0105245_10144818
1248 Ga0105245_10149975
1249 Ga0105245_10191399
1250 Ga0105245_10993757
1251 Ga0105245_11015807
1252 Ga0105245_11416892
1253 Ga0105245_11434146
1254 Ga0105245_11785749
1255 Ga0105245_11949583
1256 Ga0105247_10160803
1257 Ga0105247_10210849
1258 Ga0105247_11551331
1259 Ga0114129_10035952
1260 Ga0114129_10171836
1261 Ga0114129_10218841
1262 Ga0114129_10371854
1263 Ga0114129_10590759
1264 Ga0114129_10677648
1265 Ga0114129_10877564
1266 Ga0114129_10991566
1267 Ga0114129_11034344
1268 Ga0114129_11093086
1269 Ga0114129_11763692
1270 Ga0114129_12410214
1271 Ga0105243_10011477
1272 Ga0105243_10032297
1273 Ga0105243_10042904
1274 Ga0105243_10164477
1275 Ga0105243_10510008
1276 Ga0105243_11136485
1277 Ga0105243_11280456
1278 Ga0105243_12390571
1279 Ga0105243_12935556
1280 Ga0105241_10017025
1281 Ga0105241_10117578
1282 Ga0105241_10140989
1283 Ga0105241_10436870
1284 Ga0105241_10517332
1285 Ga0105241_12387913
1286 Ga0105242_10000732
1287 Ga0105242_10001790
1288 Ga0105242_10018497
1289 Ga0105242_10158578
1290 Ga0105242_10182350
1291 Ga0105242_10189690
1292 Ga0105242_10292927
1293 Ga0105242_10345251
1294 Ga0105242_10566771
1295 Ga0105242_10660188
1296 Ga0105242_10931476
1297 Ga0105242_12702900
1298 Ga0105242_13087353
1299 Ga0105248_10107192
1300 Ga0105248_10107473
1301 Ga0105248_10398516
1302 Ga0105248_11580605
1303 Ga0105248_11615858
1304 Ga0105237_10003430
1305 Ga0105237_10071906
1306 Ga0105237_10909550
1307 Ga0105237_11316270
1308 Ga0105237_12399504
1309 Ga0105238_10226679
1310 Ga0105238_10228783
1311 Ga0105238_10297107
1312 Ga0105238_10485948
1313 Ga0105238_11012583
1314 Ga0105238_11439760
1315 Ga0105238_11965669
1316 Ga0105249_10092394
1317 Ga0105249_10136832
1318 Ga0105249_10394119
1319 Ga0105249_10489108
1320 Ga0105249_10833412
1321 Ga0105249_11782285
1322 Ga0105249_12182055
1323 Ga0105249_13304204
1324 Ga0105239_10012638
1325 Ga0105239_10072941
1326 Ga0105239_10097736
1327 Ga0105239_10127914
1328 Ga0105239_10168730
1329 Ga0105239_10179318
1330 Ga0105239_10265764
1331 Ga0105239_10664719
1332 Ga0105239_10713661
1333 Ga0105239_10760308
1334 Ga0105239_11823280
1335 Ga0105246_10114970
1336 Ga0105246_10140934
1337 Ga0105246_10173293
1338 Ga0105246_10726113
1339 Ga0105246_10748164
1340 Ga0105246_12483897
1341 Ga0157319_1012223
1342 Ga0157347_1056512
1343 Ga0157313_1030911
1344 Ga0157339_1016698
1345 Ga0157339_1048744
1346 Ga0157316_1038490
1347 Ga0157338_1091728
1348 Ga0157371_10015479
1349 Ga0157371_10017938
1350 Ga0157371_10087501
1351 Ga0157371_10217803
1352 Ga0157371_11016167
1353 Ga0157371_11128969
1354 Ga0157370_10036811
1355 Ga0157370_10171795
1356 Ga0157370_10333402
1357 Ga0157370_10661128
1358 Ga0157370_11064867
1359 Ga0157370_11105891
1360 Ga0157369_10010013
1361 Ga0157369_10121144
1362 Ga0157369_10246010
1363 Ga0157369_10263753
1364 Ga0157369_10615525
1365 Ga0157369_10745106
1366 Ga0157369_11115404
1367 Ga0157374_10021720
1368 Ga0157374_10154152
1369 Ga0157374_10412787
1370 Ga0157374_10645307
1371 Ga0157374_11053921
1372 Ga0157374_11382360
1373 Ga0157374_12920754
1374 Ga0157378_10010027
1375 Ga0157378_10168855
1376 Ga0157378_10672541
1377 Ga0157378_11218633
1378 Ga0157378_12279251
1379 Ga0163162_10308065
1380 Ga0163162_10515240
1381 Ga0163162_11151907
1382 Ga0163162_11518034
1383 Ga0163162_12513652
1384 Ga0163162_13292707
1385 Ga0157372_10010592
1386 Ga0157372_10020049
1387 Ga0157372_10180310
1388 Ga0157372_10327308
1389 Ga0157372_10508640
1390 Ga0157372_10528207
1391 Ga0157372_11190767
1392 Ga0157372_12248381
1393 Ga0157375_10019710
1394 Ga0157375_10039332
1395 Ga0157375_10041080
1396 Ga0157375_10063832
1397 Ga0157375_10090707
1398 Ga0157375_10302550
1399 Ga0157375_10462632
1400 Ga0157375_10531558
1401 Ga0157375_10537861
1402 Ga0157375_10645895
1403 Ga0157375_10646759
1404 Ga0157375_11927875
1405 Ga0157375_13634543
1406 Ga0163163_10021419
1407 Ga0163163_10459333
1408 Ga0163163_10541729
1409 Ga0163163_10567435
1410 Ga0163163_10608158
1411 Ga0163163_10877117
1412 Ga0163163_10919224
1413 Ga0163163_11416565
1414 Ga0157380_10000614
1415 Ga0157380_10141409
1416 Ga0157380_10179243
1417 Ga0157380_10251184
1418 Ga0157380_10324946
1419 Ga0157380_10935614
1420 Ga0157380_11910174
1421 Ga0182008_10361609
1422 Ga0157377_10006107
1423 Ga0157377_10020382
1424 Ga0157377_10094917
1425 Ga0157377_10347034
1426 Ga0157377_10770109
1427 Ga0157377_11200306
1428 Ga0157377_11475471
1429 Ga0157379_10042398
1430 Ga0157379_10050707
1431 Ga0157379_10268030
1432 Ga0157379_11572287
1433 Ga0157376_10113883
1434 Ga0157376_10129847
1435 Ga0157376_10217249
1436 Ga0157376_10405872
1437 Ga0157376_10643515
1438 Ga0157376_10872197
1439 Ga0182006_1057247
1440 Ga0163161_10225749
1441 Ga0207656_10498361
1442 Ga0207653_10151009
1443 Ga0207642_10001965
1444 Ga0207688_10028282
1445 Ga0207680_10105730
1446 Ga0207643_10028510
1447 Ga0207643_10253966
1448 Ga0207684_10886491
1449 Ga0207657_10691557
1450 Ga0207652_10828744
1451 Ga0207681_10158403
1452 Ga0207650_10600795
1453 Ga0207659_10059310
1454 Ga0207706_10053850
1455 Ga0207686_10120851
1456 Ga0207686_10132529
1457 Ga0207709_10062106
1458 Ga0207670_10808834
1459 Ga0207669_10000006
1460 Ga0207669_10242542
1461 Ga0207704_10182901
1462 Ga0207691_10002148
1463 Ga0207691_10012713
1464 Ga0207711_11020077
1465 Ga0207689_10024184
1466 Ga0207661_10770716
1467 Ga0207679_11110327
1468 Ga0207651_10111451
1469 Ga0207712_10038389
1470 Ga0207712_11210182
1471 Ga0207640_10148495
1472 Ga0207703_10591168
1473 Ga0207639_11515920
1474 Ga0207678_10025505
1475 Ga0207708_10009906
1476 Ga0207676_10179105
1477 Ga0207675_100021148
1478 Ga0207675_102371015
1479 Ga0207675_102473793
1480 Ga0268266_10640533
1481 Ga0268264_10047758
1482 Ga0307406_11486848
1483 Ga0307416_100300145
1484 Ga0307416_100730923
1485 Ga0307415_100791125
1486 Ga0373959_0087201
1487 Ga0373938_0032226
1488 Ga0373941_0414815
1489 Ga0373960_0015897
1490 Ga0395899_0230739
1491 Ga0395900_0172368
1492 Ga0395898_0085417
1493 Ga0395905_0315498
1494 Ga0395905_1020881
1495 Ga0395901_0010134
1496 Ga0395901_0370095
1497 Ga0495617_139442
1498 Ga0495630_0000012
1499 Ga0495644_0069735
1500 Ga0495587_0731778
1501 Ga0495633_0395802
1502 Ga0495656_0242562
1503 Ga0495659_0125614
1504 Ga0495599_0005015
1505 Ga0495613_0703685
1506 Ga0495589_0586067
1507 Ga0495677_0392198
1508 Ga0496105_0119839
1509 Ga0496108_0147702
1510 Ga0496109_0319314
1511 Ga0496110_0130781
1512 Ga0496111_0493527
1513 Ga0496113_0398198
1514 Ga0496114_0084884
1515 nmdc:mga0a205_681053_c1
1516 Ga0495595_0168339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00830

Ribosomal_L28

Ribosomal L28 family

19

76

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d93-assembly2.cif.gz_C crystal structure of the na+,k+-atpase in the e2p state with bound mg2+ and anthroylouabain (p2(1)2(1)2(1) symmetry) 0.8025 33 48
6hma-assembly1.cif.gz_V improved model derived from cryo-em map of staphylococcus aureus large ribosomal subunit 0.7802 33 63
7q5q-assembly1.cif.gz_B protein community member oxoglutarate dehydrogenase complex e2 core from c. thermophilum 0.7786 33 48
8d3x-assembly1.cif.gz_A human alpha3 na+/k+-atpase in its k+-occluded state 0.7317 32 48
7nhk-assembly1.cif.gz_Z lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis 0.6866 2 61
ID Description Score Start End Superfamily
af_Q58095_565_968_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.8367 33 50 3.90.1860.10
af_G5EFR6_179_321_2.70.150.10 Mainly Beta;Distorted Sandwich;Calcium-transporting ATPase, cytoplasmic transduction domain A;Calcium-transporting ATPase, cytoplasmic transduction domain A 0.8114 34 47 2.70.150.10
af_O59666_301_417_2.70.150.10 Mainly Beta;Distorted Sandwich;Calcium-transporting ATPase, cytoplasmic transduction domain A;Calcium-transporting ATPase, cytoplasmic transduction domain A 0.8073 35 48 2.70.150.10
af_Q8I5J3_323_568_3.90.1860.10 Alpha Beta;Alpha-Beta Complex;tRNA-splicing ligase RtcB;tRNA-splicing ligase RtcB 0.7782 32 49 3.90.1860.10
af_Q2G2A4_188_428_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.7633 33 48 3.30.559.10
ID Description Score Start End GO Terms
AF-X1G0E4-F1-model_v4 Ribosomal protein L28 0.9877 31 63 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2Z4Y7K5-F1-model_v4 Large ribosomal subunit protein bL28 0.9813 31 62 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D0PMJ0-F1-model_v4 Large ribosomal subunit protein bL28 (50S ribosomal protein L28) 0.9801 32 62 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-C0EVD9-F1-model_v4 50S ribosomal protein L28 0.9777 32 62 GO:0003735
GO:0005840
GO:1990904
AF-A0A2W4MKS5-F1-model_v4 50S ribosomal protein L28 0.9775 31 62 GO:0003735
GO:0005840
GO:1990904

Map