F479413

General Info

Members Datasets Scaffolds Average Seq Length
757 234 1514 107

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000518|Ga0495606_0000518_56869_57222
Length 117
Sequence MSAFIKRRPFSSVLLIVLLALAALAWVNRVHLAAFPGIIGALSAKEYCSCRYVMDNEAGYCKAYVKQIIPISGFFDDAANKRVTARGLGSTQTAQWIGQREGCQLLPQAAELPASSN

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
13 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
28 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
47 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
48 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
49 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
50 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
51 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
52 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
53 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
54 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
55 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
56 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
59 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
60 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
61 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
62 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
63 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
64 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
65 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
66 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
67 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
68 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
71 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
72 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
73 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
74 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
75 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
76 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
77 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
78 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
79 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
80 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
81 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
82 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
83 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
84 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
85 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
86 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
87 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
88 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
89 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
93 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 2511231004 Pseudomonas sp. GM102 Isolate Nodule
194 2511231007 Pseudomonas sp. GM18 Isolate Nodule
195 2511231008 Pseudomonas sp. GM21 Isolate Nodule
196 2511231012 Pseudomonas sp. GM33 Isolate Nodule
197 2511231016 Pseudomonas sp. GM50 Isolate Nodule
198 2511231018 Pseudomonas sp. GM60 Isolate Nodule
199 2511231019 Pseudomonas sp. GM67 Isolate Nodule
200 2511231021 Pseudomonas sp. GM78 Isolate Nodule
201 2511231022 Pseudomonas sp. GM79 Isolate Nodule
202 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
203 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
204 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
205 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
206 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
207 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
208 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
209 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
210 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
211 2773857670 Pseudomonas sp. 478 Isolate Unclassified
212 2773857673 Pseudomonas sp. 443 Isolate Unclassified
213 2784132063 Pseudomonas sp. 424 Isolate Unclassified
214 2784132072 Pseudomonas sp. 460 Isolate Unclassified
215 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
216 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
217 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
218 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
219 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
220 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
221 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
222 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
223 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
224 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
225 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
226 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
227 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
228 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
229 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
230 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
231 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
232 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
233 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
234 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.45
Metatranscriptomes 0
Isolates 5.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 1.45
Rhizoplane 1.06
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0000518 3300046507 Bacteria 62348
2 MRS2a_Contig_16238 2124908027 Bacteria 669
3 MRS2a_Contig_6398 2124908027 Bacteria 8371
4 MRS2a_Contig_6699 2124908027 Bacteria 3453
5 MRS2a_Contig_804 2124908027 Bacteria 2008
6 Ga0065714_10005397 3300005288 Bacteria 5421
7 Ga0065712_10099222 3300005290 Bacteria 2097
8 Ga0065715_10101186 3300005293 Bacteria 3229
9 Ga0070714_100750694 3300005435 Bacteria 943
10 Ga0070663_100403674 3300005455 Bacteria 1118
11 Ga0070662_100013270 3300005457 Bacteria 5480
12 Ga0075364_10023780 3300006051 Bacteria 3882
13 Ga0075364_10416091 3300006051 Bacteria 917
14 Ga0075432_10000336 3300006058 Bacteria 13380
15 Ga0075432_10016581 3300006058 Bacteria 2515
16 Ga0075362_10707971 3300006177 Bacteria 526
17 Ga0075369_10067459 3300006186 Bacteria 1570
18 Ga0075436_100077057 3300006914 Bacteria 2309
19 Ga0075436_100101881 3300006914 Bacteria 2000
20 Ga0075436_100911256 3300006914 Bacteria 658
21 Ga0079104_1000090 3300006946 Bacteria 132824
22 Ga0105251_10000216 3300009011 Bacteria 58674
23 Ga0105251_10187162 3300009011 Bacteria 932
24 Ga0105244_10009033 3300009036 Bacteria 6167
25 Ga0105244_10052819 3300009036 Bacteria 2068
26 Ga0105244_10081018 3300009036 Bacteria 1607
27 Ga0105244_10313767 3300009036 Bacteria 725
28 Ga0105244_10326825 3300009036 Bacteria 708
29 Ga0105244_10608794 3300009036 Bacteria 500
30 Ga0105250_10060872 3300009092 Bacteria 1517
31 Ga0105250_10187867 3300009092 Bacteria 869
32 Ga0105250_10240936 3300009092 Bacteria 771
33 Ga0105243_10012626 3300009148 Bacteria 6380
34 Ga0105246_10019360 3300011119 Bacteria 4348
35 Ga0105246_10777414 3300011119 Bacteria 847
36 Ga0157373_10001914 3300013100 Bacteria 15802
37 Ga0157373_10304091 3300013100 Bacteria 1132
38 Ga0157373_10992596 3300013100 Bacteria 626
39 Ga0157371_11130571 3300013102 Bacteria 601
40 Ga0157370_10000055 3300013104 Bacteria 118355
41 Ga0157370_10014036 3300013104 Bacteria 8223
42 Ga0157370_10179375 3300013104 Bacteria 1968
43 Ga0157370_10307796 3300013104 Bacteria 1462
44 Ga0157370_10307976 3300013104 Bacteria 1462
45 Ga0157370_10830110 3300013104 Bacteria 840
46 Ga0157370_11345720 3300013104 Bacteria 643
47 Ga0157369_10978805 3300013105 Bacteria 866
48 Ga0163162_10001527 3300013306 Bacteria 21568
49 Ga0163162_10082576 3300013306 Bacteria 3286
50 Ga0163162_12787614 3300013306 Bacteria 563
51 Ga0182008_10004108 3300014497 Bacteria 8578
52 Ga0182008_10014956 3300014497 Bacteria 4059
53 Ga0182008_10026788 3300014497 Bacteria 2922
54 Ga0182008_10033846 3300014497 Bacteria 2563
55 Ga0182008_10347817 3300014497 Bacteria 786
56 Ga0182008_10855885 3300014497 Bacteria 532
57 Ga0182006_1000984 3300015261 Bacteria 18788
58 Ga0182006_1007515 3300015261 Bacteria 4983
59 Ga0182006_1021529 3300015261 Bacteria 2688
60 Ga0182006_1108749 3300015261 Bacteria 975
61 Ga0182007_10000110 3300015262 Bacteria 56498
62 Ga0182007_10056260 3300015262 Bacteria 1292
63 Ga0182007_10392371 3300015262 Bacteria 528
64 Ga0182005_1001315 3300015265 Bacteria 10170
65 Ga0182005_1005338 3300015265 Bacteria 4025
66 Ga0182005_1009602 3300015265 Bacteria 2808
67 Ga0182005_1028135 3300015265 Bacteria 1533
68 Ga0182005_1083626 3300015265 Bacteria 883
69 Ga0163161_10015329 3300017792 Bacteria 5343
70 Ga0163161_10017757 3300017792 Bacteria 4985
71 Ga0163161_10019710 3300017792 Bacteria 4732
72 Ga0163161_10039667 3300017792 Bacteria 3381
73 Ga0163161_10129614 3300017792 Bacteria 1901
74 Ga0163161_10292174 3300017792 Bacteria 1281
75 Ga0163161_10300756 3300017792 Bacteria 1263
76 Ga0163161_11420959 3300017792 Bacteria 607
77 Ga0209563_102306 3300025230 Bacteria 4385
78 Ga0209676_1002589 3300025292 Bacteria 12441
79 Ga0209050_1002202 3300025298 Bacteria 17554
80 Ga0209257_1062101 3300025304 Bacteria 1012
81 Ga0207696_1030073 3300025711 Bacteria 1653
82 Ga0207655_1000005 3300025728 Bacteria 917277
83 Ga0207655_1003778 3300025728 Bacteria 11088
84 Ga0207655_1009218 3300025728 Bacteria 6156
85 Ga0207655_1016808 3300025728 Bacteria 3979
86 Ga0207655_1019102 3300025728 Bacteria 3602
87 Ga0207655_1029551 3300025728 Bacteria 2563
88 Ga0207655_1164934 3300025728 Bacteria 689
89 Ga0207713_1000104 3300025735 Bacteria 138310
90 Ga0207713_1004406 3300025735 Bacteria 9135
91 Ga0207713_1020065 3300025735 Bacteria 3251
92 Ga0207664_10482689 3300025929 Bacteria 1109
93 Ga0207690_10378195 3300025932 Bacteria 1125
94 Ga0207706_10013861 3300025933 Bacteria 7312
95 Ga0207709_10182715 3300025935 Bacteria 1482
96 Ga0207678_10499795 3300026067 Bacteria 1060
97 Ga0209281_1000013 3300027111 Bacteria 653449
98 Ga0207428_10030967 3300027907 Bacteria 4420
99 Ga0207428_10074762 3300027907 Bacteria 2657
100 Ga0207428_10282164 3300027907 Bacteria 1233
101 Ga0207428_10371488 3300027907 Bacteria 1050
102 Ga0307516_10394004 3300031730 Bacteria 1045
103 Ga0307413_12201749 3300031824 Bacteria 500
104 Ga0307510_10054942 3300033180 Bacteria 4164
105 Ga0439438_005595 3300041405 Bacteria 4587
106 Ga0439438_005603 3300041405 Bacteria 4582
107 Ga0439438_006279 3300041405 Bacteria 4222
108 Ga0439438_012734 3300041405 Bacteria 2565
109 Ga0439438_019526 3300041405 Bacteria 1914
110 Ga0439438_035056 3300041405 Bacteria 1319
111 Ga0439438_054959 3300041405 Bacteria 1005
112 Ga0439447_003674 3300041407 Bacteria 5411
113 Ga0439447_003908 3300041407 Bacteria 5225
114 Ga0439447_005225 3300041407 Bacteria 4336
115 Ga0439447_011940 3300041407 Bacteria 2514
116 Ga0439447_107242 3300041407 Bacteria 641
117 Ga0439461_0031091 3300041410 Bacteria 1113
118 Ga0439466_0006780 3300041411 Bacteria 4345
119 Ga0439466_0008283 3300041411 Bacteria 3919
120 Ga0439466_0011525 3300041411 Bacteria 3269
121 Ga0439466_0013089 3300041411 Bacteria 3040
122 Ga0439466_0015022 3300041411 Bacteria 2814
123 Ga0439466_0073355 3300041411 Bacteria 1087
124 Ga0439466_0128462 3300041411 Bacteria 780
125 Ga0439465_0006850 3300041413 Bacteria 3620
126 Ga0439465_0049813 3300041413 Bacteria 1369
127 Ga0451789_0903580 3300041443 Bacteria 597
128 Ga0439431_0015913 3300041997 Bacteria 1755
129 Ga0439437_008775 3300042000 Bacteria 1140
130 Ga0439443_085010 3300042003 Bacteria 592
131 Ga0439445_0023907 3300042004 Bacteria 1550
132 Ga0439432_000627 3300042006 Bacteria 13275
133 Ga0439432_008543 3300042006 Bacteria 3593
134 Ga0439432_015394 3300042006 Bacteria 2581
135 Ga0439432_043197 3300042006 Bacteria 1423
136 Ga0439451_005394 3300042009 Bacteria 2607
137 Ga0439451_006492 3300042009 Bacteria 2391
138 Ga0439451_042547 3300042009 Bacteria 911
139 Ga0439452_000487 3300042010 Bacteria 22000
140 Ga0439452_000978 3300042010 Bacteria 12819
141 Ga0439452_002141 3300042010 Bacteria 7459
142 Ga0439452_002277 3300042010 Bacteria 7168
143 Ga0439452_004437 3300042010 Bacteria 4708
144 Ga0439452_014341 3300042010 Bacteria 2204
145 Ga0439456_004688 3300042013 Bacteria 2763
146 Ga0439456_006671 3300042013 Bacteria 2362
147 Ga0439456_008693 3300042013 Bacteria 2097
148 Ga0439456_019902 3300042013 Bacteria 1413
149 Ga0439456_027831 3300042013 Bacteria 1205
150 Ga0439456_028394 3300042013 Bacteria 1193
151 Ga0450911_000008 3300042115 Bacteria 168304
152 Ga0450911_001653 3300042115 Bacteria 4941
153 Ga0450911_003253 3300042115 Bacteria 2909
154 Ga0450911_004006 3300042115 Bacteria 2481
155 Ga0450911_008714 3300042115 Bacteria 1437
156 Ga0450911_015641 3300042115 Bacteria 1004
157 Ga0450919_000643 3300042121 Bacteria 4421
158 Ga0450919_001130 3300042121 Bacteria 3461
159 Ga0450920_033755 3300042122 Bacteria 1011
160 Ga0450922_000397 3300042124 Bacteria 4673
161 Ga0450922_000593 3300042124 Bacteria 3773
162 Ga0450923_023773 3300042125 Bacteria 1211
163 Ga0450890_000723 3300042127 Bacteria 4784
164 Ga0450900_002697 3300042136 Bacteria 1909
165 Ga0450902_019858 3300042137 Bacteria 1107
166 Ga0450902_052485 3300042137 Bacteria 701
167 Ga0450902_053310 3300042137 Bacteria 696
168 Ga0450902_070928 3300042137 Bacteria 607
169 Ga0450902_105253 3300042137 Bacteria 503
170 Ga0450903_001067 3300042138 Bacteria 5227
171 Ga0450903_010263 3300042138 Bacteria 1517
172 Ga0450903_017458 3300042138 Bacteria 1121
173 Ga0450904_002292 3300042139 Bacteria 2318
174 Ga0450904_024851 3300042139 Bacteria 615
175 Ga0450905_016331 3300042142 Bacteria 1070
176 Ga0450889_013812 3300042144 Bacteria 856
177 Ga0450906_000545 3300042145 Bacteria 7942
178 Ga0450906_001303 3300042145 Bacteria 5472
179 Ga0450907_000240 3300042146 Bacteria 18832
180 Ga0450907_000970 3300042146 Bacteria 6781
181 Ga0450907_002331 3300042146 Bacteria 3669
182 Ga0450910_002667 3300042147 Bacteria 2343
183 Ga0450910_003295 3300042147 Bacteria 2142
184 Ga0439446_0002353 3300042156 Bacteria 4522
185 Ga0439446_0026847 3300042156 Bacteria 1651
186 Ga0439446_0032952 3300042156 Bacteria 1504
187 Ga0450908_003686 3300042184 Bacteria 2972
188 Ga0450908_007629 3300042184 Bacteria 2036
189 Ga0450909_000295 3300042185 Bacteria 6130
190 Ga0439434_0002529 3300042435 Bacteria 5322
191 Ga0439434_0010319 3300042435 Bacteria 2754
192 Ga0439435_0236555 3300042436 Bacteria 611
193 Ga0439459_0004407 3300042438 Bacteria 2264
194 Ga0439464_0005866 3300042439 Bacteria 3190
195 Ga0439464_0200907 3300042439 Bacteria 636
196 Ga0439460_0005109 3300042461 Bacteria 3210
197 Ga0439460_0010158 3300042461 Bacteria 2402
198 Ga0450916_003156 3300042530 Bacteria 1797
199 Ga0450918_002820 3300042531 Bacteria 3266
200 Ga0450918_058000 3300042531 Bacteria 712
201 Ga0450893_0005201 3300042532 Bacteria 2083
202 Ga0450893_0006991 3300042532 Bacteria 1829
203 Ga0450893_0036504 3300042532 Bacteria 889
204 Ga0450901_001144 3300042533 Bacteria 3079
205 Ga0439440_0001393 3300042993 Bacteria 4389
206 Ga0439440_0002140 3300042993 Bacteria 3693
207 Ga0495617_010389 3300046452 Bacteria 3189
208 Ga0495617_013494 3300046452 Bacteria 2781
209 Ga0495617_015461 3300046452 Bacteria 2585
210 Ga0495617_024218 3300046452 Bacteria 2048
211 Ga0495617_103121 3300046452 Bacteria 926
212 Ga0495627_020355 3300046453 Bacteria 2212
213 Ga0495627_075877 3300046453 Bacteria 978
214 Ga0495627_077770 3300046453 Bacteria 964
215 Ga0495603_0011096 3300046455 Bacteria 5462
216 Ga0495603_0012778 3300046455 Bacteria 5077
217 Ga0495603_0171849 3300046455 Bacteria 1255
218 Ga0495603_0543484 3300046455 Bacteria 665
219 Ga0495590_0000419 3300046457 Bacteria 21433
220 Ga0495590_0000559 3300046457 Bacteria 17741
221 Ga0495590_0010583 3300046457 Bacteria 3461
222 Ga0495590_0018255 3300046457 Bacteria 2512
223 Ga0495590_0072416 3300046457 Bacteria 1210
224 Ga0495591_008262 3300046458 Bacteria 4287
225 Ga0495591_017258 3300046458 Bacteria 2485
226 Ga0495591_022556 3300046458 Bacteria 2032
227 Ga0495591_028129 3300046458 Bacteria 1723
228 Ga0495591_041662 3300046458 Bacteria 1302
229 Ga0495591_063172 3300046458 Bacteria 978
230 Ga0495629_0018696 3300046459 Bacteria 4953
231 Ga0495629_0256526 3300046459 Bacteria 1202
232 Ga0495638_0009911 3300046460 Bacteria 6648
233 Ga0495638_0026958 3300046460 Bacteria 3722
234 Ga0495638_0028254 3300046460 Bacteria 3623
235 Ga0495638_0030078 3300046460 Bacteria 3498
236 Ga0495638_0033221 3300046460 Bacteria 3300
237 Ga0495638_0041567 3300046460 Bacteria 2907
238 Ga0495638_0041967 3300046460 Bacteria 2891
239 Ga0495638_0058701 3300046460 Bacteria 2383
240 Ga0495638_0069700 3300046460 Bacteria 2154
241 Ga0495638_0129413 3300046460 Bacteria 1484
242 Ga0495638_0132889 3300046460 Bacteria 1460
243 Ga0495653_0009941 3300046463 Bacteria 7783
244 Ga0495653_0052828 3300046463 Bacteria 3112
245 Ga0495653_0053417 3300046463 Bacteria 3091
246 Ga0495650_0012231 3300046471 Bacteria 4630
247 Ga0495650_0015337 3300046471 Bacteria 3933
248 Ga0495650_0022620 3300046471 Bacteria 3011
249 Ga0495650_0070024 3300046471 Bacteria 1378
250 Ga0495580_0331063 3300046472 Bacteria 1034
251 Ga0495582_0021571 3300046473 Bacteria 3524
252 Ga0495605_0006884 3300046474 Bacteria 6493
253 Ga0495605_0013017 3300046474 Bacteria 4599
254 Ga0495605_0017667 3300046474 Bacteria 3836
255 Ga0495605_0022996 3300046474 Bacteria 3283
256 Ga0495605_0027057 3300046474 Bacteria 2974
257 Ga0495605_0030592 3300046474 Bacteria 2758
258 Ga0495605_0054938 3300046474 Bacteria 1926
259 Ga0495605_0071405 3300046474 Bacteria 1639
260 Ga0495605_0071463 3300046474 Bacteria 1638
261 Ga0495605_0204092 3300046474 Bacteria 860
262 Ga0495639_0000129 3300046475 Bacteria 38829
263 Ga0495639_0013215 3300046475 Bacteria 3562
264 Ga0495639_0125405 3300046475 Bacteria 1227
265 Ga0495639_0161531 3300046475 Bacteria 1084
266 Ga0495584_0002404 3300046491 Bacteria 10636
267 Ga0495584_0004481 3300046491 Bacteria 7507
268 Ga0495584_0008773 3300046491 Bacteria 5227
269 Ga0495584_0013418 3300046491 Bacteria 4183
270 Ga0495584_0024933 3300046491 Bacteria 3032
271 Ga0495584_0049742 3300046491 Bacteria 2111
272 Ga0495584_0150693 3300046491 Bacteria 1181
273 Ga0495584_0181251 3300046491 Bacteria 1070
274 Ga0495584_0486318 3300046491 Bacteria 628
275 Ga0495584_0529942 3300046491 Bacteria 600
276 Ga0495585_0001683 3300046492 Bacteria 16896
277 Ga0495585_0016089 3300046492 Bacteria 4336
278 Ga0495585_0018468 3300046492 Bacteria 4020
279 Ga0495585_0022646 3300046492 Bacteria 3606
280 Ga0495585_0028224 3300046492 Bacteria 3201
281 Ga0495585_0029469 3300046492 Bacteria 3123
282 Ga0495585_0034500 3300046492 Bacteria 2860
283 Ga0495585_0047660 3300046492 Bacteria 2386
284 Ga0495585_0051127 3300046492 Bacteria 2291
285 Ga0495585_0064484 3300046492 Bacteria 2009
286 Ga0495585_0276300 3300046492 Bacteria 831
287 Ga0495585_0289666 3300046492 Bacteria 807
288 Ga0495594_0013557 3300046499 Bacteria 4256
289 Ga0495594_0030665 3300046499 Bacteria 2912
290 Ga0495594_0074568 3300046499 Bacteria 1890
291 Ga0495594_0499934 3300046499 Bacteria 690
292 Ga0495607_0001150 3300046501 Bacteria 23966
293 Ga0495607_0020321 3300046501 Bacteria 4201
294 Ga0495607_0027739 3300046501 Bacteria 3498
295 Ga0495607_0028470 3300046501 Bacteria 3447
296 Ga0495607_0040186 3300046501 Bacteria 2787
297 Ga0495607_0041290 3300046501 Bacteria 2741
298 Ga0495607_0049217 3300046501 Bacteria 2459
299 Ga0495607_0074314 3300046501 Bacteria 1887
300 Ga0495607_0079819 3300046501 Bacteria 1801
301 Ga0495607_0099672 3300046501 Bacteria 1558
302 Ga0495607_0125187 3300046501 Bacteria 1344
303 Ga0495607_0169269 3300046501 Bacteria 1104
304 Ga0495607_0288362 3300046501 Bacteria 776
305 Ga0495607_0322673 3300046501 Bacteria 720
306 Ga0495607_0452458 3300046501 Bacteria 576
307 Ga0495583_0001796 3300046506 Bacteria 20338
308 Ga0495583_0075480 3300046506 Bacteria 1474
309 Ga0495583_0115330 3300046506 Bacteria 1135
310 Ga0495583_0221477 3300046506 Bacteria 764
311 Ga0495583_0268434 3300046506 Bacteria 681
312 Ga0495583_0372294 3300046506 Bacteria 562
313 Ga0495606_0014306 3300046507 Bacteria 6205
314 Ga0495606_0026844 3300046507 Bacteria 4094
315 Ga0495606_0046178 3300046507 Bacteria 2880
316 Ga0495610_0005443 3300046512 Bacteria 9044
317 Ga0495610_0010441 3300046512 Bacteria 5768
318 Ga0495610_0059760 3300046512 Bacteria 1818
319 Ga0495610_0068035 3300046512 Bacteria 1670
320 Ga0495610_0077475 3300046512 Bacteria 1535
321 Ga0495610_0310161 3300046512 Bacteria 606
322 Ga0495616_0004833 3300046513 Bacteria 8441
323 Ga0495616_0009748 3300046513 Bacteria 5596
324 Ga0495616_0018174 3300046513 Bacteria 3864
325 Ga0495616_0048774 3300046513 Bacteria 2125
326 Ga0495616_0208756 3300046513 Bacteria 855
327 Ga0495616_0308104 3300046513 Bacteria 667
328 Ga0495620_0010866 3300046515 Bacteria 4781
329 Ga0495620_0011210 3300046515 Bacteria 4686
330 Ga0495620_0014359 3300046515 Bacteria 4027
331 Ga0495620_0141855 3300046515 Bacteria 939
332 Ga0495620_0163611 3300046515 Bacteria 864
333 Ga0495628_0179703 3300046516 Bacteria 1601
334 Ga0495630_0031968 3300046517 Bacteria 3920
335 Ga0495630_0056586 3300046517 Bacteria 2938
336 Ga0495630_0067613 3300046517 Bacteria 2686
337 Ga0495631_0000209 3300046518 Bacteria 40147
338 Ga0495631_0038382 3300046518 Bacteria 2129
339 Ga0495631_0107510 3300046518 Bacteria 1199
340 Ga0495631_0197546 3300046518 Bacteria 860
341 Ga0495631_0391616 3300046518 Bacteria 591
342 Ga0495632_0001115 3300046519 Bacteria 23045
343 Ga0495632_0006251 3300046519 Bacteria 7695
344 Ga0495632_0014427 3300046519 Bacteria 4470
345 Ga0495632_0028246 3300046519 Bacteria 2928
346 Ga0495632_0030601 3300046519 Bacteria 2792
347 Ga0495632_0037656 3300046519 Bacteria 2453
348 Ga0495632_0039401 3300046519 Bacteria 2385
349 Ga0495632_0044799 3300046519 Bacteria 2206
350 Ga0495632_0144775 3300046519 Bacteria 1101
351 Ga0495632_0166610 3300046519 Bacteria 1013
352 Ga0495637_0005414 3300046520 Bacteria 6510
353 Ga0495637_0006848 3300046520 Bacteria 5697
354 Ga0495637_0012056 3300046520 Bacteria 4142
355 Ga0495637_0028892 3300046520 Bacteria 2472
356 Ga0495637_0032708 3300046520 Bacteria 2289
357 Ga0495637_0034634 3300046520 Bacteria 2209
358 Ga0495637_0111216 3300046520 Bacteria 1061
359 Ga0495637_0214660 3300046520 Bacteria 702
360 Ga0495637_0315786 3300046520 Bacteria 552
361 Ga0495643_0000116 3300046522 Bacteria 130165
362 Ga0495643_0009775 3300046522 Bacteria 5932
363 Ga0495643_0014528 3300046522 Bacteria 4682
364 Ga0495643_0022437 3300046522 Bacteria 3602
365 Ga0495643_0034712 3300046522 Bacteria 2781
366 Ga0495643_0044485 3300046522 Bacteria 2413
367 Ga0495643_0057124 3300046522 Bacteria 2081
368 Ga0495643_0109147 3300046522 Bacteria 1408
369 Ga0495643_0419892 3300046522 Bacteria 587
370 Ga0495644_0034558 3300046523 Bacteria 1908
371 Ga0495648_0003403 3300046524 Bacteria 13982
372 Ga0495648_0027473 3300046524 Bacteria 3807
373 Ga0495648_0028446 3300046524 Bacteria 3723
374 Ga0495648_0043279 3300046524 Bacteria 2825
375 Ga0495648_0046867 3300046524 Bacteria 2676
376 Ga0495648_0058192 3300046524 Bacteria 2312
377 Ga0495648_0080125 3300046524 Bacteria 1861
378 Ga0495648_0089364 3300046524 Bacteria 1729
379 Ga0495648_0090027 3300046524 Bacteria 1720
380 Ga0495648_0136319 3300046524 Bacteria 1297
381 Ga0495648_0152954 3300046524 Bacteria 1201
382 Ga0495648_0154085 3300046524 Bacteria 1195
383 Ga0495648_0186633 3300046524 Bacteria 1049
384 Ga0495648_0205599 3300046524 Bacteria 982
385 Ga0495648_0252021 3300046524 Bacteria 851
386 Ga0495648_0292224 3300046524 Bacteria 767
387 Ga0495666_0006760 3300046526 Bacteria 5766
388 Ga0495666_0009265 3300046526 Bacteria 4922
389 Ga0495666_0042630 3300046526 Bacteria 2193
390 Ga0495666_0419509 3300046526 Bacteria 600
391 Ga0495642_0000101 3300046528 Bacteria 48249
392 Ga0495642_0000205 3300046528 Bacteria 34692
393 Ga0495642_0008340 3300046528 Bacteria 3964
394 Ga0495654_0005727 3300046530 Bacteria 7160
395 Ga0495654_0006957 3300046530 Bacteria 6373
396 Ga0495654_0008168 3300046530 Bacteria 5798
397 Ga0495654_0018837 3300046530 Bacteria 3612
398 Ga0495654_0019311 3300046530 Bacteria 3565
399 Ga0495654_0030073 3300046530 Bacteria 2765
400 Ga0495654_0032980 3300046530 Bacteria 2623
401 Ga0495654_0036274 3300046530 Bacteria 2478
402 Ga0495654_0036329 3300046530 Bacteria 2475
403 Ga0495654_0064133 3300046530 Bacteria 1757
404 Ga0495654_0126043 3300046530 Bacteria 1154
405 Ga0495654_0128738 3300046530 Bacteria 1138
406 Ga0495654_0180170 3300046530 Bacteria 915
407 Ga0495654_0195667 3300046530 Bacteria 868
408 Ga0495654_0314316 3300046530 Bacteria 636
409 Ga0495654_0328052 3300046530 Bacteria 619
410 Ga0495654_0411990 3300046530 Bacteria 535
411 Ga0495665_0253241 3300046531 Bacteria 906
412 Ga0495586_0014847 3300046535 Bacteria 4139
413 Ga0495587_0005892 3300046536 Bacteria 7986
414 Ga0495587_0035813 3300046536 Bacteria 2988
415 Ga0495587_0138761 3300046536 Bacteria 1388
416 Ga0495587_0447148 3300046536 Bacteria 716
417 Ga0495609_0004014 3300046538 Bacteria 8213
418 Ga0495609_0011550 3300046538 Bacteria 4203
419 Ga0495609_0034214 3300046538 Bacteria 2304
420 Ga0495609_0034680 3300046538 Bacteria 2286
421 Ga0495609_0034712 3300046538 Bacteria 2285
422 Ga0495609_0040779 3300046538 Bacteria 2088
423 Ga0495609_0045886 3300046538 Bacteria 1957
424 Ga0495609_0079007 3300046538 Bacteria 1439
425 Ga0495609_0112707 3300046538 Bacteria 1173
426 Ga0495609_0133833 3300046538 Bacteria 1060
427 Ga0495609_0297790 3300046538 Bacteria 657
428 Ga0495597_0006135 3300046542 Bacteria 6252
429 Ga0495597_0011056 3300046542 Bacteria 4386
430 Ga0495597_0022214 3300046542 Bacteria 2944
431 Ga0495597_0028641 3300046542 Bacteria 2548
432 Ga0495597_0042495 3300046542 Bacteria 2026
433 Ga0495597_0066890 3300046542 Bacteria 1556
434 Ga0495597_0075421 3300046542 Bacteria 1447
435 Ga0495597_0080416 3300046542 Bacteria 1394
436 Ga0495597_0119643 3300046542 Bacteria 1098
437 Ga0495597_0185242 3300046542 Bacteria 839
438 Ga0495597_0248780 3300046542 Bacteria 699
439 Ga0495622_0000818 3300046557 Bacteria 17227
440 Ga0495622_0010618 3300046557 Bacteria 4248
441 Ga0495622_0031331 3300046557 Bacteria 2485
442 Ga0495622_0129840 3300046557 Bacteria 1148
443 Ga0495622_0177413 3300046557 Bacteria 956
444 Ga0495633_0004833 3300046558 Bacteria 8439
445 Ga0495633_0012194 3300046558 Bacteria 4586
446 Ga0495633_0040588 3300046558 Bacteria 2216
447 Ga0495633_0103610 3300046558 Bacteria 1320
448 Ga0495656_0016169 3300046615 Bacteria 2828
449 Ga0495656_0027172 3300046615 Bacteria 2283
450 Ga0495656_0196320 3300046615 Bacteria 999
451 Ga0495656_0297354 3300046615 Bacteria 826
452 Ga0495656_0346018 3300046615 Bacteria 769
453 Ga0495668_0004711 3300046616 Bacteria 9565
454 Ga0495668_0081932 3300046616 Bacteria 1770
455 Ga0495634_0006307 3300046642 Bacteria 9033
456 Ga0495634_0042913 3300046642 Bacteria 3066
457 Ga0495634_0106148 3300046642 Bacteria 1810
458 Ga0495611_0011881 3300046648 Bacteria 3696
459 Ga0495611_0105522 3300046648 Bacteria 1310
460 Ga0495611_0109483 3300046648 Bacteria 1286
461 Ga0495611_0150784 3300046648 Bacteria 1085
462 Ga0495625_0031480 3300046660 Bacteria 3945
463 Ga0495625_0032051 3300046660 Bacteria 3903
464 Ga0495625_0047667 3300046660 Bacteria 3089
465 Ga0495625_0072007 3300046660 Bacteria 2424
466 Ga0495625_0079432 3300046660 Bacteria 2287
467 Ga0495625_0083986 3300046660 Bacteria 2212
468 Ga0495625_0141951 3300046660 Bacteria 1619
469 Ga0495625_0231535 3300046660 Bacteria 1206
470 Ga0495625_0393344 3300046660 Bacteria 867
471 Ga0495625_0547157 3300046660 Bacteria 701
472 Ga0495625_0644228 3300046660 Bacteria 631
473 Ga0495625_0763486 3300046660 Bacteria 565
474 Ga0495635_0012261 3300046663 Bacteria 6006
475 Ga0495635_0028991 3300046663 Bacteria 3848
476 Ga0495659_0000115 3300046664 Bacteria 35815
477 Ga0495659_0003766 3300046664 Bacteria 4819
478 Ga0495659_0009883 3300046664 Bacteria 3051
479 Ga0495659_0027878 3300046664 Bacteria 1951
480 Ga0495659_0395984 3300046664 Bacteria 595
481 Ga0495661_0017337 3300046665 Bacteria 4757
482 Ga0495661_0029282 3300046665 Bacteria 3517
483 Ga0495661_0066697 3300046665 Bacteria 2117
484 Ga0495661_0078666 3300046665 Bacteria 1907
485 Ga0495661_0086381 3300046665 Bacteria 1795
486 Ga0495661_0099741 3300046665 Bacteria 1637
487 Ga0495588_0015618 3300046674 Bacteria 3659
488 Ga0495588_0130544 3300046674 Bacteria 1325
489 Ga0495588_0358331 3300046674 Bacteria 766
490 Ga0495657_0117935 3300046675 Bacteria 1674
491 Ga0495599_0115401 3300046678 Bacteria 1671
492 Ga0495623_0017544 3300046679 Bacteria 4623
493 Ga0495623_0023026 3300046679 Bacteria 4021
494 Ga0495646_0014976 3300046680 Bacteria 4926
495 Ga0495646_0016812 3300046680 Bacteria 4647
496 Ga0495669_0000620 3300046684 Bacteria 15453
497 Ga0495669_0008535 3300046684 Bacteria 4313
498 Ga0495669_0115389 3300046684 Bacteria 1256
499 Ga0495613_0020644 3300046689 Bacteria 4911
500 Ga0495613_0026485 3300046689 Bacteria 4318
501 Ga0495613_0061244 3300046689 Bacteria 2756
502 Ga0495613_0182899 3300046689 Bacteria 1484
503 Ga0495624_0015665 3300046690 Bacteria 5112
504 Ga0495670_0006443 3300046691 Bacteria 5763
505 Ga0495670_0007325 3300046691 Bacteria 5424
506 Ga0495670_0014217 3300046691 Bacteria 3916
507 Ga0495670_0019229 3300046691 Bacteria 3365
508 Ga0495670_0072755 3300046691 Bacteria 1742
509 Ga0495670_0119331 3300046691 Bacteria 1369
510 Ga0495670_0205215 3300046691 Bacteria 1044
511 Ga0495670_0262296 3300046691 Bacteria 922
512 Ga0495671_0005003 3300046692 Bacteria 7811
513 Ga0495671_0006662 3300046692 Bacteria 6656
514 Ga0495671_0007510 3300046692 Bacteria 6207
515 Ga0495671_0019581 3300046692 Bacteria 3575
516 Ga0495671_0031221 3300046692 Bacteria 2724
517 Ga0495671_0064743 3300046692 Bacteria 1799
518 Ga0495671_0078242 3300046692 Bacteria 1621
519 Ga0495671_0293420 3300046692 Bacteria 782
520 Ga0495671_0326607 3300046692 Bacteria 736
521 Ga0495671_0390391 3300046692 Bacteria 666
522 Ga0495649_0001605 3300046694 Bacteria 16843
523 Ga0495649_0002534 3300046694 Bacteria 12809
524 Ga0495649_0008273 3300046694 Bacteria 6266
525 Ga0495649_0030054 3300046694 Bacteria 3001
526 Ga0495649_0030980 3300046694 Bacteria 2951
527 Ga0495649_0034776 3300046694 Bacteria 2772
528 Ga0495649_0055891 3300046694 Bacteria 2132
529 Ga0495649_0070061 3300046694 Bacteria 1880
530 Ga0495649_0096825 3300046694 Bacteria 1570
531 Ga0495649_0107016 3300046694 Bacteria 1484
532 Ga0495649_0197507 3300046694 Bacteria 1045
533 Ga0495649_0423661 3300046694 Bacteria 666
534 Ga0495589_0003298 3300046794 Bacteria 8758
535 Ga0495589_0003778 3300046794 Bacteria 8147
536 Ga0495589_0007848 3300046794 Bacteria 5586
537 Ga0495589_0009447 3300046794 Bacteria 5072
538 Ga0495589_0013561 3300046794 Bacteria 4203
539 Ga0495589_0024869 3300046794 Bacteria 3041
540 Ga0495589_0030696 3300046794 Bacteria 2706
541 Ga0495589_0046363 3300046794 Bacteria 2157
542 Ga0495589_0326038 3300046794 Bacteria 709
543 Ga0495600_0031833 3300046809 Bacteria 3419
544 Ga0495600_0164452 3300046809 Bacteria 1433
545 Ga0495660_0012406 3300046810 Bacteria 4946
546 Ga0495660_0019639 3300046810 Bacteria 3879
547 Ga0495660_0032429 3300046810 Bacteria 2933
548 Ga0495660_0032544 3300046810 Bacteria 2927
549 Ga0495660_0037834 3300046810 Bacteria 2686
550 Ga0495660_0038420 3300046810 Bacteria 2661
551 Ga0495660_0048175 3300046810 Bacteria 2331
552 Ga0495660_0082198 3300046810 Bacteria 1687
553 Ga0495660_0108913 3300046810 Bacteria 1415
554 Ga0495660_0136967 3300046810 Bacteria 1222
555 Ga0495660_0159696 3300046810 Bacteria 1106
556 Ga0495660_0185118 3300046810 Bacteria 1004
557 Ga0495660_0197587 3300046810 Bacteria 962
558 Ga0495660_0253106 3300046810 Bacteria 816
559 Ga0495581_0034217 3300047315 Bacteria 2939
560 Ga0495581_0272940 3300047315 Bacteria 988
561 Ga0495604_0014515 3300047317 Bacteria 6282
562 Ga0495604_0020770 3300047317 Bacteria 5243
563 Ga0495604_0212905 3300047317 Bacteria 1334
564 Ga0495636_0013406 3300047318 Bacteria 3253
565 Ga0495636_0019781 3300047318 Bacteria 2708
566 Ga0495636_0043806 3300047318 Bacteria 1862
567 Ga0495636_0136467 3300047318 Bacteria 1093
568 Ga0495636_0302393 3300047318 Bacteria 748
569 Ga0495636_0613198 3300047318 Bacteria 533
570 Ga0495674_0028152 3300047319 Bacteria 5129
571 Ga0495674_1210034 3300047319 Bacteria 570
572 Ga0495672_0000780 3300047320 Bacteria 34591
573 Ga0495672_0002482 3300047320 Bacteria 16903
574 Ga0495672_0004331 3300047320 Bacteria 11688
575 Ga0495672_0007926 3300047320 Bacteria 7919
576 Ga0495672_0019254 3300047320 Bacteria 4506
577 Ga0495672_0028094 3300047320 Bacteria 3565
578 Ga0495672_0040000 3300047320 Bacteria 2846
579 Ga0495672_0040911 3300047320 Bacteria 2807
580 Ga0495672_0074078 3300047320 Bacteria 1918
581 Ga0495672_0171001 3300047320 Bacteria 1108
582 Ga0495680_0018805 3300047322 Bacteria 5855
583 Ga0495680_0020299 3300047322 Bacteria 5592
584 Ga0495680_0041581 3300047322 Bacteria 3654
585 Ga0495680_0178980 3300047322 Bacteria 1531
586 Ga0495683_0000285 3300047323 Bacteria 43752
587 Ga0495683_0002401 3300047323 Bacteria 11345
588 Ga0495683_0010036 3300047323 Bacteria 5021
589 Ga0495683_0012967 3300047323 Bacteria 4367
590 Ga0495683_0019402 3300047323 Bacteria 3509
591 Ga0495683_0025763 3300047323 Bacteria 3012
592 Ga0495683_0033302 3300047323 Bacteria 2623
593 Ga0495683_0055132 3300047323 Bacteria 1979
594 Ga0495683_0057378 3300047323 Bacteria 1935
595 Ga0495683_0181885 3300047323 Bacteria 959
596 Ga0495683_0252911 3300047323 Bacteria 772
597 Ga0495687_000966 3300047443 Bacteria 29301
598 Ga0495687_002102 3300047443 Bacteria 16699
599 Ga0495687_004965 3300047443 Bacteria 8698
600 Ga0495687_175766 3300047443 Bacteria 704
601 Ga0495675_0002716 3300047444 Bacteria 10604
602 Ga0495675_0021164 3300047444 Bacteria 4140
603 Ga0495675_0188616 3300047444 Bacteria 1259
604 Ga0495677_0001143 3300047445 Bacteria 10602
605 Ga0495679_027358 3300047446 Bacteria 1882
606 Ga0495679_049705 3300047446 Bacteria 1264
607 Ga0495685_071932 3300047447 Bacteria 1157
608 Ga0495673_0001767 3300047469 Bacteria 16444
609 Ga0495673_0003593 3300047469 Bacteria 10173
610 Ga0495673_0003882 3300047469 Bacteria 9620
611 Ga0495673_0006278 3300047469 Bacteria 7005
612 Ga0495673_0018966 3300047469 Bacteria 3455
613 Ga0495673_0023413 3300047469 Bacteria 3004
614 Ga0495673_0026381 3300047469 Bacteria 2779
615 Ga0495673_0048000 3300047469 Bacteria 1884
616 Ga0495673_0064583 3300047469 Bacteria 1556
617 Ga0495673_0072326 3300047469 Bacteria 1447
618 Ga0495673_0124587 3300047469 Bacteria 1017
619 Ga0495681_0003522 3300047470 Bacteria 10879
620 Ga0495681_0006840 3300047470 Bacteria 7410
621 Ga0495681_0011500 3300047470 Bacteria 5265
622 Ga0495681_0013410 3300047470 Bacteria 4754
623 Ga0495681_0013582 3300047470 Bacteria 4716
624 Ga0495681_0024003 3300047470 Bacteria 3223
625 Ga0495681_0030531 3300047470 Bacteria 2742
626 Ga0495681_0031949 3300047470 Bacteria 2655
627 Ga0495681_0035161 3300047470 Bacteria 2489
628 Ga0495681_0044294 3300047470 Bacteria 2140
629 Ga0495681_0044558 3300047470 Bacteria 2130
630 Ga0495681_0149620 3300047470 Bacteria 980
631 Ga0495681_0300679 3300047470 Bacteria 621
632 Ga0495684_0072169 3300047471 Bacteria 2623
633 Ga0495686_0004894 3300047472 Bacteria 10801
634 Ga0495686_0015849 3300047472 Bacteria 5127
635 Ga0495686_0077363 3300047472 Bacteria 2037
636 Ga0495686_0100382 3300047472 Bacteria 1746
637 Ga0495686_0265428 3300047472 Bacteria 959
638 Ga0495593_0006620 3300047673 Bacteria 6780
639 Ga0495593_0016409 3300047673 Bacteria 4178
640 Ga0495593_0036330 3300047673 Bacteria 2671
641 Ga0495593_0044010 3300047673 Bacteria 2390
642 Ga0495593_0117738 3300047673 Bacteria 1353
643 Ga0495602_0032448 3300048088 Bacteria 4916
644 Ga0495602_0083356 3300048088 Bacteria 2679
645 Ga0495614_0154260 3300048089 Bacteria 1025
646 Ga0495614_0190331 3300048089 Bacteria 925
647 Ga0495626_0001639 3300048091 Bacteria 17352
648 Ga0495626_0001827 3300048091 Bacteria 16035
649 Ga0495626_0003427 3300048091 Bacteria 10178
650 Ga0495626_0022337 3300048091 Bacteria 3126
651 Ga0495626_0042972 3300048091 Bacteria 2121
652 Ga0495626_0069903 3300048091 Bacteria 1580
653 Ga0495626_0168887 3300048091 Bacteria 913
654 Ga0496102_0005973 3300048905 Bacteria 10370
655 Ga0496103_0008801 3300048906 Bacteria 5989
656 Ga0496105_0126799 3300048908 Bacteria 2104
657 Ga0496105_0559165 3300048908 Bacteria 892
658 Ga0496107_0074378 3300048910 Bacteria 2472
659 Ga0496110_0032094 3300048913 Bacteria 4533
660 Ga0496111_0810291 3300048914 Bacteria 677
661 Ga0496116_0002285 3300048919 Bacteria 20324
662 Ga0496116_0034479 3300048919 Bacteria 3570
663 Ga0496116_0045867 3300048919 Bacteria 2954
664 Ga0496117_0024567 3300048920 Bacteria 4762
665 Ga0496117_0110948 3300048920 Bacteria 1709
666 Ga0496117_0232222 3300048920 Bacteria 1018
667 Ga0496117_0313854 3300048920 Bacteria 824
668 Ga0496118_0023805 3300048921 Bacteria 5307
669 Ga0496118_0051067 3300048921 Bacteria 3166
670 Ga0496118_0065629 3300048921 Bacteria 2655
671 Ga0496119_0187950 3300048922 Bacteria 1078
672 Ga0496119_0357084 3300048922 Bacteria 706
673 Ga0496121_0073904 3300048924 Bacteria 2729
674 Ga0496121_0080330 3300048924 Bacteria 2585
675 Ga0496121_0118452 3300048924 Bacteria 2004
676 Ga0496121_0120607 3300048924 Bacteria 1981
677 Ga0496122_0027417 3300048925 Bacteria 4870
678 Ga0496122_0118386 3300048925 Bacteria 1716
679 Ga0496123_0132923 3300048926 Bacteria 1374
680 Ga0496123_0382371 3300048926 Bacteria 645
681 Ga0496124_0118041 3300048927 Bacteria 2124
682 Ga0496124_0185724 3300048927 Bacteria 1595
683 Ga0496124_0266496 3300048927 Bacteria 1257
684 Ga0496124_0305276 3300048927 Bacteria 1147
685 Ga0496124_0311180 3300048927 Bacteria 1132
686 Ga0496125_0048941 3300048928 Bacteria 3518
687 Ga0496125_0064766 3300048928 Bacteria 2901
688 Ga0496125_0078762 3300048928 Bacteria 2531
689 Ga0496126_0044120 3300048929 Bacteria 4108
690 Ga0495678_006835 3300049459 Bacteria 5999
691 Ga0495678_022159 3300049459 Bacteria 2783
692 Ga0495678_029100 3300049459 Bacteria 2323
693 Ga0495678_030931 3300049459 Bacteria 2236
694 Ga0495678_034814 3300049459 Bacteria 2069
695 Ga0495678_036148 3300049459 Bacteria 2018
696 Ga0495678_089029 3300049459 Bacteria 1091
697 Ga0495678_134469 3300049459 Bacteria 816
698 Ga0495678_245658 3300049459 Bacteria 533
699 Ga0495682_0005935 3300049460 Bacteria 5005
700 Ga0495682_0011135 3300049460 Bacteria 3465
701 Ga0495682_0019304 3300049460 Bacteria 2564
702 Ga0495682_0021361 3300049460 Bacteria 2425
703 Ga0495682_0042031 3300049460 Bacteria 1675
704 Ga0495682_0043357 3300049460 Bacteria 1647
705 Ga0495682_0121217 3300049460 Bacteria 936
706 Ga0495682_0149723 3300049460 Bacteria 832
707 Ga0495682_0167031 3300049460 Bacteria 783
708 Ga0495682_0193105 3300049460 Bacteria 722
709 Ga0501226_000005 3300049853 Bacteria 271019
710 nmdc:mga03683_47910_c1 3300050489 Bacteria 1775
711 nmdc:mga00v17_163997_c1 3300050491 Bacteria 1432
712 nmdc:mga00v17_280470_c1 3300050491 Bacteria 1082
713 nmdc:mga00v17_389682_c1 3300050491 Bacteria 906
714 nmdc:mga08x19_96153_c1 3300050514 Bacteria 1960
715 nmdc:mga0sz30_25378_c1 3300050516 Bacteria 2423
716 2511256682 2511231004 Bacteria 6669789
717 2511270564 2511231007 Bacteria 6306603
718 2511277687 2511231008 Bacteria 6624100
719 2511302990 2511231012 Bacteria 6738011
720 2511327034 2511231016 Bacteria 6704427
721 2511336645 2511231018 Bacteria 6436256
722 2511344069 2511231019 Bacteria 6520662
723 2511355205 2511231021 Bacteria 7302637
724 2511364989 2511231022 Bacteria 6719296
725 2624493880 2623620446 Bacteria 6500345
726 2643845268 2643221565 Bacteria 6216018
727 2643952037 2643221589 Bacteria 6250934
728 2644024204 2643221602 Bacteria 6249926
729 2644184895 2643221633 Bacteria 6733554
730 2715753025 2713897148 Bacteria 5883533
731 2739198648 2738543004 Bacteria 6381073
732 2739286430 2738543020 Bacteria 5718238
733 2739291743 2738543021 Bacteria 5718241
734 2774121468 2773857670 Bacteria 6407454
735 2774136084 2773857673 Bacteria 6513460
736 2784260156 2784132063 Bacteria 6262788
737 2784315644 2784132072 Bacteria 6596533
738 2808904773 2808606373 Bacteria 4423627
739 2808960894 2808606382 Bacteria 6841132
740 2809216087 2808606445 Bacteria 6057339
741 2819654649 2818991456 Bacteria 6123676
742 2842808798 2842805378 Bacteria 5385175
743 2852658616 2852657418 Bacteria 6472974
744 2860340368 2860339153 Bacteria 6846989
745 2904522466 2904518522 Bacteria 6068986
746 2919458027 2919456309 Bacteria 6586567
747 2919700202 2919697872 Bacteria 6553725
748 2931399727 2931396565 Bacteria 7251677
749 2939637798 2939636861 Bacteria 6297853
750 2998141325 2998139840 Bacteria 6073514
751 3007512698 3007511990 Bacteria 6481491
752 3007622055 3007619802 Bacteria 6411688
753 8019776869 8019775933 Bacteria 6858656
754 8029999421 8029995093 Bacteria 5990776
755 8056159448 8056155041 Bacteria 6486948
756 8056169730 8056166840 Bacteria 5820959
757 8056180295 8056177738 Bacteria 6748268
758 Ga0495606_0000518
759 MRS2a_Contig_16238
760 MRS2a_Contig_6398
761 MRS2a_Contig_6699
762 MRS2a_Contig_804
763 Ga0065714_10005397
764 Ga0065712_10099222
765 Ga0065715_10101186
766 Ga0070714_100750694
767 Ga0070663_100403674
768 Ga0070662_100013270
769 Ga0075364_10023780
770 Ga0075364_10416091
771 Ga0075432_10000336
772 Ga0075432_10016581
773 Ga0075362_10707971
774 Ga0075369_10067459
775 Ga0075436_100077057
776 Ga0075436_100101881
777 Ga0075436_100911256
778 Ga0079104_1000090
779 Ga0105251_10000216
780 Ga0105251_10187162
781 Ga0105244_10009033
782 Ga0105244_10052819
783 Ga0105244_10081018
784 Ga0105244_10313767
785 Ga0105244_10326825
786 Ga0105244_10608794
787 Ga0105250_10060872
788 Ga0105250_10187867
789 Ga0105250_10240936
790 Ga0105243_10012626
791 Ga0105246_10019360
792 Ga0105246_10777414
793 Ga0157373_10001914
794 Ga0157373_10304091
795 Ga0157373_10992596
796 Ga0157371_11130571
797 Ga0157370_10000055
798 Ga0157370_10014036
799 Ga0157370_10179375
800 Ga0157370_10307796
801 Ga0157370_10307976
802 Ga0157370_10830110
803 Ga0157370_11345720
804 Ga0157369_10978805
805 Ga0163162_10001527
806 Ga0163162_10082576
807 Ga0163162_12787614
808 Ga0182008_10004108
809 Ga0182008_10014956
810 Ga0182008_10026788
811 Ga0182008_10033846
812 Ga0182008_10347817
813 Ga0182008_10855885
814 Ga0182006_1000984
815 Ga0182006_1007515
816 Ga0182006_1021529
817 Ga0182006_1108749
818 Ga0182007_10000110
819 Ga0182007_10056260
820 Ga0182007_10392371
821 Ga0182005_1001315
822 Ga0182005_1005338
823 Ga0182005_1009602
824 Ga0182005_1028135
825 Ga0182005_1083626
826 Ga0163161_10015329
827 Ga0163161_10017757
828 Ga0163161_10019710
829 Ga0163161_10039667
830 Ga0163161_10129614
831 Ga0163161_10292174
832 Ga0163161_10300756
833 Ga0163161_11420959
834 Ga0209563_102306
835 Ga0209676_1002589
836 Ga0209050_1002202
837 Ga0209257_1062101
838 Ga0207696_1030073
839 Ga0207655_1000005
840 Ga0207655_1003778
841 Ga0207655_1009218
842 Ga0207655_1016808
843 Ga0207655_1019102
844 Ga0207655_1029551
845 Ga0207655_1164934
846 Ga0207713_1000104
847 Ga0207713_1004406
848 Ga0207713_1020065
849 Ga0207664_10482689
850 Ga0207690_10378195
851 Ga0207706_10013861
852 Ga0207709_10182715
853 Ga0207678_10499795
854 Ga0209281_1000013
855 Ga0207428_10030967
856 Ga0207428_10074762
857 Ga0207428_10282164
858 Ga0207428_10371488
859 Ga0307516_10394004
860 Ga0307413_12201749
861 Ga0307510_10054942
862 Ga0439438_005595
863 Ga0439438_005603
864 Ga0439438_006279
865 Ga0439438_012734
866 Ga0439438_019526
867 Ga0439438_035056
868 Ga0439438_054959
869 Ga0439447_003674
870 Ga0439447_003908
871 Ga0439447_005225
872 Ga0439447_011940
873 Ga0439447_107242
874 Ga0439461_0031091
875 Ga0439466_0006780
876 Ga0439466_0008283
877 Ga0439466_0011525
878 Ga0439466_0013089
879 Ga0439466_0015022
880 Ga0439466_0073355
881 Ga0439466_0128462
882 Ga0439465_0006850
883 Ga0439465_0049813
884 Ga0451789_0903580
885 Ga0439431_0015913
886 Ga0439437_008775
887 Ga0439443_085010
888 Ga0439445_0023907
889 Ga0439432_000627
890 Ga0439432_008543
891 Ga0439432_015394
892 Ga0439432_043197
893 Ga0439451_005394
894 Ga0439451_006492
895 Ga0439451_042547
896 Ga0439452_000487
897 Ga0439452_000978
898 Ga0439452_002141
899 Ga0439452_002277
900 Ga0439452_004437
901 Ga0439452_014341
902 Ga0439456_004688
903 Ga0439456_006671
904 Ga0439456_008693
905 Ga0439456_019902
906 Ga0439456_027831
907 Ga0439456_028394
908 Ga0450911_000008
909 Ga0450911_001653
910 Ga0450911_003253
911 Ga0450911_004006
912 Ga0450911_008714
913 Ga0450911_015641
914 Ga0450919_000643
915 Ga0450919_001130
916 Ga0450920_033755
917 Ga0450922_000397
918 Ga0450922_000593
919 Ga0450923_023773
920 Ga0450890_000723
921 Ga0450900_002697
922 Ga0450902_019858
923 Ga0450902_052485
924 Ga0450902_053310
925 Ga0450902_070928
926 Ga0450902_105253
927 Ga0450903_001067
928 Ga0450903_010263
929 Ga0450903_017458
930 Ga0450904_002292
931 Ga0450904_024851
932 Ga0450905_016331
933 Ga0450889_013812
934 Ga0450906_000545
935 Ga0450906_001303
936 Ga0450907_000240
937 Ga0450907_000970
938 Ga0450907_002331
939 Ga0450910_002667
940 Ga0450910_003295
941 Ga0439446_0002353
942 Ga0439446_0026847
943 Ga0439446_0032952
944 Ga0450908_003686
945 Ga0450908_007629
946 Ga0450909_000295
947 Ga0439434_0002529
948 Ga0439434_0010319
949 Ga0439435_0236555
950 Ga0439459_0004407
951 Ga0439464_0005866
952 Ga0439464_0200907
953 Ga0439460_0005109
954 Ga0439460_0010158
955 Ga0450916_003156
956 Ga0450918_002820
957 Ga0450918_058000
958 Ga0450893_0005201
959 Ga0450893_0006991
960 Ga0450893_0036504
961 Ga0450901_001144
962 Ga0439440_0001393
963 Ga0439440_0002140
964 Ga0495617_010389
965 Ga0495617_013494
966 Ga0495617_015461
967 Ga0495617_024218
968 Ga0495617_103121
969 Ga0495627_020355
970 Ga0495627_075877
971 Ga0495627_077770
972 Ga0495603_0011096
973 Ga0495603_0012778
974 Ga0495603_0171849
975 Ga0495603_0543484
976 Ga0495590_0000419
977 Ga0495590_0000559
978 Ga0495590_0010583
979 Ga0495590_0018255
980 Ga0495590_0072416
981 Ga0495591_008262
982 Ga0495591_017258
983 Ga0495591_022556
984 Ga0495591_028129
985 Ga0495591_041662
986 Ga0495591_063172
987 Ga0495629_0018696
988 Ga0495629_0256526
989 Ga0495638_0009911
990 Ga0495638_0026958
991 Ga0495638_0028254
992 Ga0495638_0030078
993 Ga0495638_0033221
994 Ga0495638_0041567
995 Ga0495638_0041967
996 Ga0495638_0058701
997 Ga0495638_0069700
998 Ga0495638_0129413
999 Ga0495638_0132889
1000 Ga0495653_0009941
1001 Ga0495653_0052828
1002 Ga0495653_0053417
1003 Ga0495650_0012231
1004 Ga0495650_0015337
1005 Ga0495650_0022620
1006 Ga0495650_0070024
1007 Ga0495580_0331063
1008 Ga0495582_0021571
1009 Ga0495605_0006884
1010 Ga0495605_0013017
1011 Ga0495605_0017667
1012 Ga0495605_0022996
1013 Ga0495605_0027057
1014 Ga0495605_0030592
1015 Ga0495605_0054938
1016 Ga0495605_0071405
1017 Ga0495605_0071463
1018 Ga0495605_0204092
1019 Ga0495639_0000129
1020 Ga0495639_0013215
1021 Ga0495639_0125405
1022 Ga0495639_0161531
1023 Ga0495584_0002404
1024 Ga0495584_0004481
1025 Ga0495584_0008773
1026 Ga0495584_0013418
1027 Ga0495584_0024933
1028 Ga0495584_0049742
1029 Ga0495584_0150693
1030 Ga0495584_0181251
1031 Ga0495584_0486318
1032 Ga0495584_0529942
1033 Ga0495585_0001683
1034 Ga0495585_0016089
1035 Ga0495585_0018468
1036 Ga0495585_0022646
1037 Ga0495585_0028224
1038 Ga0495585_0029469
1039 Ga0495585_0034500
1040 Ga0495585_0047660
1041 Ga0495585_0051127
1042 Ga0495585_0064484
1043 Ga0495585_0276300
1044 Ga0495585_0289666
1045 Ga0495594_0013557
1046 Ga0495594_0030665
1047 Ga0495594_0074568
1048 Ga0495594_0499934
1049 Ga0495607_0001150
1050 Ga0495607_0020321
1051 Ga0495607_0027739
1052 Ga0495607_0028470
1053 Ga0495607_0040186
1054 Ga0495607_0041290
1055 Ga0495607_0049217
1056 Ga0495607_0074314
1057 Ga0495607_0079819
1058 Ga0495607_0099672
1059 Ga0495607_0125187
1060 Ga0495607_0169269
1061 Ga0495607_0288362
1062 Ga0495607_0322673
1063 Ga0495607_0452458
1064 Ga0495583_0001796
1065 Ga0495583_0075480
1066 Ga0495583_0115330
1067 Ga0495583_0221477
1068 Ga0495583_0268434
1069 Ga0495583_0372294
1070 Ga0495606_0014306
1071 Ga0495606_0026844
1072 Ga0495606_0046178
1073 Ga0495610_0005443
1074 Ga0495610_0010441
1075 Ga0495610_0059760
1076 Ga0495610_0068035
1077 Ga0495610_0077475
1078 Ga0495610_0310161
1079 Ga0495616_0004833
1080 Ga0495616_0009748
1081 Ga0495616_0018174
1082 Ga0495616_0048774
1083 Ga0495616_0208756
1084 Ga0495616_0308104
1085 Ga0495620_0010866
1086 Ga0495620_0011210
1087 Ga0495620_0014359
1088 Ga0495620_0141855
1089 Ga0495620_0163611
1090 Ga0495628_0179703
1091 Ga0495630_0031968
1092 Ga0495630_0056586
1093 Ga0495630_0067613
1094 Ga0495631_0000209
1095 Ga0495631_0038382
1096 Ga0495631_0107510
1097 Ga0495631_0197546
1098 Ga0495631_0391616
1099 Ga0495632_0001115
1100 Ga0495632_0006251
1101 Ga0495632_0014427
1102 Ga0495632_0028246
1103 Ga0495632_0030601
1104 Ga0495632_0037656
1105 Ga0495632_0039401
1106 Ga0495632_0044799
1107 Ga0495632_0144775
1108 Ga0495632_0166610
1109 Ga0495637_0005414
1110 Ga0495637_0006848
1111 Ga0495637_0012056
1112 Ga0495637_0028892
1113 Ga0495637_0032708
1114 Ga0495637_0034634
1115 Ga0495637_0111216
1116 Ga0495637_0214660
1117 Ga0495637_0315786
1118 Ga0495643_0000116
1119 Ga0495643_0009775
1120 Ga0495643_0014528
1121 Ga0495643_0022437
1122 Ga0495643_0034712
1123 Ga0495643_0044485
1124 Ga0495643_0057124
1125 Ga0495643_0109147
1126 Ga0495643_0419892
1127 Ga0495644_0034558
1128 Ga0495648_0003403
1129 Ga0495648_0027473
1130 Ga0495648_0028446
1131 Ga0495648_0043279
1132 Ga0495648_0046867
1133 Ga0495648_0058192
1134 Ga0495648_0080125
1135 Ga0495648_0089364
1136 Ga0495648_0090027
1137 Ga0495648_0136319
1138 Ga0495648_0152954
1139 Ga0495648_0154085
1140 Ga0495648_0186633
1141 Ga0495648_0205599
1142 Ga0495648_0252021
1143 Ga0495648_0292224
1144 Ga0495666_0006760
1145 Ga0495666_0009265
1146 Ga0495666_0042630
1147 Ga0495666_0419509
1148 Ga0495642_0000101
1149 Ga0495642_0000205
1150 Ga0495642_0008340
1151 Ga0495654_0005727
1152 Ga0495654_0006957
1153 Ga0495654_0008168
1154 Ga0495654_0018837
1155 Ga0495654_0019311
1156 Ga0495654_0030073
1157 Ga0495654_0032980
1158 Ga0495654_0036274
1159 Ga0495654_0036329
1160 Ga0495654_0064133
1161 Ga0495654_0126043
1162 Ga0495654_0128738
1163 Ga0495654_0180170
1164 Ga0495654_0195667
1165 Ga0495654_0314316
1166 Ga0495654_0328052
1167 Ga0495654_0411990
1168 Ga0495665_0253241
1169 Ga0495586_0014847
1170 Ga0495587_0005892
1171 Ga0495587_0035813
1172 Ga0495587_0138761
1173 Ga0495587_0447148
1174 Ga0495609_0004014
1175 Ga0495609_0011550
1176 Ga0495609_0034214
1177 Ga0495609_0034680
1178 Ga0495609_0034712
1179 Ga0495609_0040779
1180 Ga0495609_0045886
1181 Ga0495609_0079007
1182 Ga0495609_0112707
1183 Ga0495609_0133833
1184 Ga0495609_0297790
1185 Ga0495597_0006135
1186 Ga0495597_0011056
1187 Ga0495597_0022214
1188 Ga0495597_0028641
1189 Ga0495597_0042495
1190 Ga0495597_0066890
1191 Ga0495597_0075421
1192 Ga0495597_0080416
1193 Ga0495597_0119643
1194 Ga0495597_0185242
1195 Ga0495597_0248780
1196 Ga0495622_0000818
1197 Ga0495622_0010618
1198 Ga0495622_0031331
1199 Ga0495622_0129840
1200 Ga0495622_0177413
1201 Ga0495633_0004833
1202 Ga0495633_0012194
1203 Ga0495633_0040588
1204 Ga0495633_0103610
1205 Ga0495656_0016169
1206 Ga0495656_0027172
1207 Ga0495656_0196320
1208 Ga0495656_0297354
1209 Ga0495656_0346018
1210 Ga0495668_0004711
1211 Ga0495668_0081932
1212 Ga0495634_0006307
1213 Ga0495634_0042913
1214 Ga0495634_0106148
1215 Ga0495611_0011881
1216 Ga0495611_0105522
1217 Ga0495611_0109483
1218 Ga0495611_0150784
1219 Ga0495625_0031480
1220 Ga0495625_0032051
1221 Ga0495625_0047667
1222 Ga0495625_0072007
1223 Ga0495625_0079432
1224 Ga0495625_0083986
1225 Ga0495625_0141951
1226 Ga0495625_0231535
1227 Ga0495625_0393344
1228 Ga0495625_0547157
1229 Ga0495625_0644228
1230 Ga0495625_0763486
1231 Ga0495635_0012261
1232 Ga0495635_0028991
1233 Ga0495659_0000115
1234 Ga0495659_0003766
1235 Ga0495659_0009883
1236 Ga0495659_0027878
1237 Ga0495659_0395984
1238 Ga0495661_0017337
1239 Ga0495661_0029282
1240 Ga0495661_0066697
1241 Ga0495661_0078666
1242 Ga0495661_0086381
1243 Ga0495661_0099741
1244 Ga0495588_0015618
1245 Ga0495588_0130544
1246 Ga0495588_0358331
1247 Ga0495657_0117935
1248 Ga0495599_0115401
1249 Ga0495623_0017544
1250 Ga0495623_0023026
1251 Ga0495646_0014976
1252 Ga0495646_0016812
1253 Ga0495669_0000620
1254 Ga0495669_0008535
1255 Ga0495669_0115389
1256 Ga0495613_0020644
1257 Ga0495613_0026485
1258 Ga0495613_0061244
1259 Ga0495613_0182899
1260 Ga0495624_0015665
1261 Ga0495670_0006443
1262 Ga0495670_0007325
1263 Ga0495670_0014217
1264 Ga0495670_0019229
1265 Ga0495670_0072755
1266 Ga0495670_0119331
1267 Ga0495670_0205215
1268 Ga0495670_0262296
1269 Ga0495671_0005003
1270 Ga0495671_0006662
1271 Ga0495671_0007510
1272 Ga0495671_0019581
1273 Ga0495671_0031221
1274 Ga0495671_0064743
1275 Ga0495671_0078242
1276 Ga0495671_0293420
1277 Ga0495671_0326607
1278 Ga0495671_0390391
1279 Ga0495649_0001605
1280 Ga0495649_0002534
1281 Ga0495649_0008273
1282 Ga0495649_0030054
1283 Ga0495649_0030980
1284 Ga0495649_0034776
1285 Ga0495649_0055891
1286 Ga0495649_0070061
1287 Ga0495649_0096825
1288 Ga0495649_0107016
1289 Ga0495649_0197507
1290 Ga0495649_0423661
1291 Ga0495589_0003298
1292 Ga0495589_0003778
1293 Ga0495589_0007848
1294 Ga0495589_0009447
1295 Ga0495589_0013561
1296 Ga0495589_0024869
1297 Ga0495589_0030696
1298 Ga0495589_0046363
1299 Ga0495589_0326038
1300 Ga0495600_0031833
1301 Ga0495600_0164452
1302 Ga0495660_0012406
1303 Ga0495660_0019639
1304 Ga0495660_0032429
1305 Ga0495660_0032544
1306 Ga0495660_0037834
1307 Ga0495660_0038420
1308 Ga0495660_0048175
1309 Ga0495660_0082198
1310 Ga0495660_0108913
1311 Ga0495660_0136967
1312 Ga0495660_0159696
1313 Ga0495660_0185118
1314 Ga0495660_0197587
1315 Ga0495660_0253106
1316 Ga0495581_0034217
1317 Ga0495581_0272940
1318 Ga0495604_0014515
1319 Ga0495604_0020770
1320 Ga0495604_0212905
1321 Ga0495636_0013406
1322 Ga0495636_0019781
1323 Ga0495636_0043806
1324 Ga0495636_0136467
1325 Ga0495636_0302393
1326 Ga0495636_0613198
1327 Ga0495674_0028152
1328 Ga0495674_1210034
1329 Ga0495672_0000780
1330 Ga0495672_0002482
1331 Ga0495672_0004331
1332 Ga0495672_0007926
1333 Ga0495672_0019254
1334 Ga0495672_0028094
1335 Ga0495672_0040000
1336 Ga0495672_0040911
1337 Ga0495672_0074078
1338 Ga0495672_0171001
1339 Ga0495680_0018805
1340 Ga0495680_0020299
1341 Ga0495680_0041581
1342 Ga0495680_0178980
1343 Ga0495683_0000285
1344 Ga0495683_0002401
1345 Ga0495683_0010036
1346 Ga0495683_0012967
1347 Ga0495683_0019402
1348 Ga0495683_0025763
1349 Ga0495683_0033302
1350 Ga0495683_0055132
1351 Ga0495683_0057378
1352 Ga0495683_0181885
1353 Ga0495683_0252911
1354 Ga0495687_000966
1355 Ga0495687_002102
1356 Ga0495687_004965
1357 Ga0495687_175766
1358 Ga0495675_0002716
1359 Ga0495675_0021164
1360 Ga0495675_0188616
1361 Ga0495677_0001143
1362 Ga0495679_027358
1363 Ga0495679_049705
1364 Ga0495685_071932
1365 Ga0495673_0001767
1366 Ga0495673_0003593
1367 Ga0495673_0003882
1368 Ga0495673_0006278
1369 Ga0495673_0018966
1370 Ga0495673_0023413
1371 Ga0495673_0026381
1372 Ga0495673_0048000
1373 Ga0495673_0064583
1374 Ga0495673_0072326
1375 Ga0495673_0124587
1376 Ga0495681_0003522
1377 Ga0495681_0006840
1378 Ga0495681_0011500
1379 Ga0495681_0013410
1380 Ga0495681_0013582
1381 Ga0495681_0024003
1382 Ga0495681_0030531
1383 Ga0495681_0031949
1384 Ga0495681_0035161
1385 Ga0495681_0044294
1386 Ga0495681_0044558
1387 Ga0495681_0149620
1388 Ga0495681_0300679
1389 Ga0495684_0072169
1390 Ga0495686_0004894
1391 Ga0495686_0015849
1392 Ga0495686_0077363
1393 Ga0495686_0100382
1394 Ga0495686_0265428
1395 Ga0495593_0006620
1396 Ga0495593_0016409
1397 Ga0495593_0036330
1398 Ga0495593_0044010
1399 Ga0495593_0117738
1400 Ga0495602_0032448
1401 Ga0495602_0083356
1402 Ga0495614_0154260
1403 Ga0495614_0190331
1404 Ga0495626_0001639
1405 Ga0495626_0001827
1406 Ga0495626_0003427
1407 Ga0495626_0022337
1408 Ga0495626_0042972
1409 Ga0495626_0069903
1410 Ga0495626_0168887
1411 Ga0496102_0005973
1412 Ga0496103_0008801
1413 Ga0496105_0126799
1414 Ga0496105_0559165
1415 Ga0496107_0074378
1416 Ga0496110_0032094
1417 Ga0496111_0810291
1418 Ga0496116_0002285
1419 Ga0496116_0034479
1420 Ga0496116_0045867
1421 Ga0496117_0024567
1422 Ga0496117_0110948
1423 Ga0496117_0232222
1424 Ga0496117_0313854
1425 Ga0496118_0023805
1426 Ga0496118_0051067
1427 Ga0496118_0065629
1428 Ga0496119_0187950
1429 Ga0496119_0357084
1430 Ga0496121_0073904
1431 Ga0496121_0080330
1432 Ga0496121_0118452
1433 Ga0496121_0120607
1434 Ga0496122_0027417
1435 Ga0496122_0118386
1436 Ga0496123_0132923
1437 Ga0496123_0382371
1438 Ga0496124_0118041
1439 Ga0496124_0185724
1440 Ga0496124_0266496
1441 Ga0496124_0305276
1442 Ga0496124_0311180
1443 Ga0496125_0048941
1444 Ga0496125_0064766
1445 Ga0496125_0078762
1446 Ga0496126_0044120
1447 Ga0495678_006835
1448 Ga0495678_022159
1449 Ga0495678_029100
1450 Ga0495678_030931
1451 Ga0495678_034814
1452 Ga0495678_036148
1453 Ga0495678_089029
1454 Ga0495678_134469
1455 Ga0495678_245658
1456 Ga0495682_0005935
1457 Ga0495682_0011135
1458 Ga0495682_0019304
1459 Ga0495682_0021361
1460 Ga0495682_0042031
1461 Ga0495682_0043357
1462 Ga0495682_0121217
1463 Ga0495682_0149723
1464 Ga0495682_0167031
1465 Ga0495682_0193105
1466 Ga0501226_000005
1467 nmdc:mga03683_47910_c1
1468 nmdc:mga00v17_163997_c1
1469 nmdc:mga00v17_280470_c1
1470 nmdc:mga00v17_389682_c1
1471 nmdc:mga08x19_96153_c1
1472 nmdc:mga0sz30_25378_c1
1473 2511256682
1474 2511270564
1475 2511277687
1476 2511302990
1477 2511327034
1478 2511336645
1479 2511344069
1480 2511355205
1481 2511364989
1482 2624493880
1483 2643845268
1484 2643952037
1485 2644024204
1486 2644184895
1487 2715753025
1488 2739198648
1489 2739286430
1490 2739291743
1491 2774121468
1492 2774136084
1493 2784260156
1494 2784315644
1495 2808904773
1496 2808960894
1497 2809216087
1498 2819654649
1499 2842808798
1500 2852658616
1501 2860340368
1502 2904522466
1503 2919458027
1504 2919700202
1505 2931399727
1506 2939637798
1507 2998141325
1508 3007512698
1509 3007622055
1510 8019776869
1511 8029999421
1512 8056159448
1513 8056169730
1514 8056180295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wzn-assembly1.cif.gz_A alpha-n-acetylgalactosaminidase nagbb from bifidobacterium bifidum - galnac complex 0.8036 71 97
5wzp-assembly2.cif.gz_B alpha-n-acetylgalactosaminidase nagbb from bifidobacterium bifidum - ligand free 0.7917 71 97
5wzr-assembly2.cif.gz_B alpha-n-acetylgalactosaminidase nagbb from bifidobacterium bifidum - gal-nhac-dnj complex 0.7872 71 97
8cti-assembly1.cif.gz_B cryo-em structure of human mettl1-wdr4-trna(val) complex 0.7579 75 109
7jq7-assembly1.cif.gz_B the phi-28 gp11 dna packaging motor 0.7543 74 100
ID Description Score Start End Superfamily
af_Q8IJT5_23_144_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8611 74 98 2.30.29.30
af_P92937_305_418_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.8367 74 100 3.30.310.80
af_Q8IV35_2_240_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8324 74 102 2.130.10.10
af_I1LHS2_20_276_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7698 74 109 2.130.10.10
af_Q21182_133_330_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7629 76 108 2.110.10.10
ID Description Score Start End GO Terms
AF-A0A2E6VTC6-F1-model_v4 Amidase 0.9231 38 109
AF-A0A2T4VCJ5-F1-model_v4 Lipoprotein 0.8983 38 109
AF-A0A2W5TKD2-F1-model_v4 Lipoprotein 0.8897 38 108
AF-A0A2E7URQ3-F1-model_v4 Uncharacterized protein 0.8802 38 109
AF-A0A084SWP0-F1-model_v4 Lipoprotein 0.8728 38 108

Map