F478900

General Info

Members Datasets Scaffolds Average Seq Length
746 718 140 166

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221688|2644491789
Length 176
Sequence DLGPRHPRTPAEGSYWLAPDAHVIGDVELGEDVGIWFGAVLRGDNERISIGSRSNIQEGAVVHVDPGYPVTIGEGCTIGHRAIVHGCSIGDNSLIGMGATVLNGAVIGRNCLVGANALITEGKSFPDNSLIVGAPARAIRVLDETAVAGLRKSAESYVEKWRHFATSLSLVDQAKR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
51 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
52 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
53 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
54 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
55 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
56 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
57 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
58 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
59 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
60 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
61 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
62 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
63 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
64 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
65 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
66 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
67 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
68 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
69 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
70 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
71 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
72 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
73 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
74 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
75 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
76 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
77 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
78 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
79 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
80 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
81 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
82 2643221557 Ensifer sp. Root558 Isolate Unclassified
83 2643221558 Rhizobium sp. Root149 Isolate Unclassified
84 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
85 2643221599 Rhizobium sp. Root708 Isolate Unclassified
86 2643221607 Rhizobium sp. Root73 Isolate Unclassified
87 2643221610 Ensifer sp. Root74 Isolate Unclassified
88 2643221618 Ensifer sp. Root231 Isolate Unclassified
89 2643221626 Ensifer sp. Root31 Isolate Unclassified
90 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
91 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
92 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
93 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
94 2643221655 Ensifer sp. Root1252 Isolate Unclassified
95 2643221659 Ensifer sp. Root127 Isolate Unclassified
96 2643221668 Ensifer sp. Root423 Isolate Unclassified
97 2643221675 Ensifer sp. Root1298 Isolate Unclassified
98 2643221680 Ensifer sp. Root1312 Isolate Unclassified
99 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
100 2643221688 Rhizobium sp. Root482 Isolate Unclassified
101 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
102 2643221698 Ensifer sp. Root142 Isolate Unclassified
103 2643221712 Ensifer sp. Root258 Isolate Unclassified
104 2643221718 Rhizobium sp. Root268 Isolate Unclassified
105 2643221723 Ensifer sp. Root278 Isolate Unclassified
106 2643221726 Ensifer sp. Root954 Isolate Unclassified
107 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
108 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
109 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
110 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
111 2718217882 Rhizobium sp. N741 Isolate Nodule
112 2718217927 Rhizobium sp. N324 Isolate Nodule
113 2718218009 Rhizobium sp. N561 Isolate Nodule
114 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
115 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
116 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
117 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
118 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
119 2718218363 Rhizobium sp. N113 Isolate Nodule
120 2718218365 Rhizobium sp. N731 Isolate Nodule
121 2718218366 Rhizobium sp. N621 Isolate Nodule
122 2718218423 Rhizobium sp. N941 Isolate Nodule
123 2721755514 Rhizobium sp. N6212 Isolate Nodule
124 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
125 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
126 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
127 2721755809 Rhizobium sp. N541 Isolate Nodule
128 2721755810 Rhizobium sp. N871 Isolate Nodule
129 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
130 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
131 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
132 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
133 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
134 2728369365 Rhizobium sp. N1341 Isolate Nodule
135 2728369397 Rhizobium sp. N1314 Isolate Nodule
136 2738541293 Rhizobium sp. GV031 Isolate Unclassified
137 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
138 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
139 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
140 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
141 2773857925 Microvirga vignae BR3299 Isolate Unclassified
142 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
143 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
144 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
145 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
146 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
147 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
148 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
149 2791355256 Rhizobium sp. M10 Isolate Nodule
150 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
151 2791355260 Rhizobium sp. L9 Isolate Nodule
152 2791355261 Rhizobium sp. J15 Isolate Nodule
153 2791355262 Rhizobium sp. M1 Isolate Nodule
154 2791355264 Rhizobium sp. S9 Isolate Nodule
155 2791355265 Rhizobium sp. H4 Isolate Nodule
156 2791355266 Rhizobium sp. L43 Isolate Nodule
157 2791355267 Rhizobium sp. L18 Isolate Nodule
158 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
159 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
160 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
161 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
162 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
163 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
164 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
165 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
166 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
167 2802429633 Rhizobium anhuiense J3 Isolate Nodule
168 2802429634 Rhizobium anhuiense S10 Isolate Nodule
169 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
170 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
171 2802429637 Rhizobium anhuiense C15 Isolate Nodule
172 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
173 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
174 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
175 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
176 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
177 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
178 2838048938 Rhizobium pisi 27/80 Isolate Nodule
179 2838061910 Rhizobium phaseoli L15 Isolate Nodule
180 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
181 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
182 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
183 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
184 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
185 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
186 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
187 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
188 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
189 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
190 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
191 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
192 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
193 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
194 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
195 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
196 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
197 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
198 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
199 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
200 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
201 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
202 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
203 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
204 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
205 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
206 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
207 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
208 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
209 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
210 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
211 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
212 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
213 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
214 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
215 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
216 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
217 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
218 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
219 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
220 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
221 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
222 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
223 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
224 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
225 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
226 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
227 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
228 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
229 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
230 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
231 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
232 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
233 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
234 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
235 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
236 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
237 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
238 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
239 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
240 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
241 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
242 2844163670 Ensifer sp. 1H6 Isolate Unclassified
243 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
244 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
245 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
246 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
247 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
248 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
249 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
250 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
251 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
252 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
253 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
254 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
255 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
256 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
257 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
258 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
259 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
260 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
261 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
262 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
263 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
264 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
265 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
266 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
267 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
268 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
269 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
270 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
271 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
272 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
273 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
274 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
275 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
276 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
277 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
278 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
279 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
280 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
281 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
282 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
283 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
284 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
285 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
286 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
287 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
288 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
289 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
290 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
291 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
292 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
293 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
294 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
295 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
296 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
297 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
298 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
299 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
300 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
301 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
302 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
303 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
304 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
305 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
306 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
307 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
308 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
309 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
310 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
311 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
312 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
313 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
314 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
315 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
316 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
317 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
318 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
319 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
320 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
321 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
322 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
323 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
324 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
325 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
326 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
327 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
328 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
329 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
330 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
331 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
332 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
333 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
334 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
335 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
336 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
337 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
338 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
339 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
340 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
341 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
342 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
343 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
344 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
345 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
346 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
347 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
348 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
349 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
350 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
351 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
352 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
353 2933599457 Rhizobium phaseoli M3 Isolate Nodule
354 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
355 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
356 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
357 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
358 2936381700 Rhizobium chutanense C16 Isolate Unclassified
359 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
360 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
361 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
362 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
363 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
364 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
365 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
366 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
367 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
368 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
369 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
370 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
371 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
372 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
373 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
374 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
375 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
376 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
377 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
378 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
379 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
380 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
381 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
382 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
383 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
384 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
385 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
386 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
387 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
388 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
389 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
390 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
391 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
392 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
393 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
394 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
395 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
396 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
397 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
398 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
399 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
400 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
401 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
402 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
403 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
404 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
405 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
406 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
407 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
408 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
409 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
410 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
411 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
412 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
413 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
414 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
415 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
416 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
417 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
418 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
419 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
420 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
421 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
422 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
423 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
424 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
425 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
426 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
427 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
428 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
429 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
430 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
431 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
432 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
433 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
434 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
435 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
436 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
437 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
438 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
439 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
440 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
441 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
442 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
443 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
444 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
445 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
446 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
447 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
448 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
449 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
450 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
451 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
452 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
453 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
454 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
455 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
456 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
457 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
458 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
459 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
460 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
461 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
462 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
463 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
464 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
465 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
466 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
467 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
468 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
469 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
470 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
471 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
472 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
473 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
474 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
475 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
476 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
477 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
478 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
479 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
480 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
481 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
482 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
483 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
484 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
485 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
486 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
487 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
488 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
489 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
490 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
491 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
492 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
493 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
494 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
495 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
496 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
497 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
498 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
499 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
500 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
501 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
502 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
503 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
504 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
505 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
506 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
507 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
508 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
509 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
510 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
511 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
512 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
513 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
514 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
515 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
516 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
517 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
518 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
519 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
520 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
521 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
522 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
523 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
524 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
525 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
526 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
527 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
528 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
529 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
530 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
531 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
532 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
533 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
534 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
535 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
536 2996887358 Rhizobium sp. R711 Isolate Nodule
537 2996893221 Rhizobium sp. R635 Isolate Nodule
538 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
539 3004167301 Mesorhizobium loti 582 Isolate Unclassified
540 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
541 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
542 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
543 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
544 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
545 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
546 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
547 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
548 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
549 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
550 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
551 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
552 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
553 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
554 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
555 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
556 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
557 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
558 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
559 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
560 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
561 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
562 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
563 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
564 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
565 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
566 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
567 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
568 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
569 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
570 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
571 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
572 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
573 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
574 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
575 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
576 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
577 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
578 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
579 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
580 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
581 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
582 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
583 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
584 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
585 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
586 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
587 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
588 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
589 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
590 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
592 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
593 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
594 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
595 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
596 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
597 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
598 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
599 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
600 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
601 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
602 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
603 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
604 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
605 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
606 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
607 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
608 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
609 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
610 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
611 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
612 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
613 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
614 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
615 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
616 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
617 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
618 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
619 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
620 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
621 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
622 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
623 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
624 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
625 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
626 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
627 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
628 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
629 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
630 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
631 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
633 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
634 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
635 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
636 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
637 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
638 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
640 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
641 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
642 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
643 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
644 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
645 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
646 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
647 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
648 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
649 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
650 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
651 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
652 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
653 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
654 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
655 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
656 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
657 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
658 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
659 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
660 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
661 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
662 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
663 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
664 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
665 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
666 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
667 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
668 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
669 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
670 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
671 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
672 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
673 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
674 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
675 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
676 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
677 8005258706 Rhizobium sp. R693 Isolate Nodule
678 8005275841 Rhizobium sp. N4311 Isolate Nodule
679 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
680 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
681 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
682 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
683 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
684 8005321885 Rhizobium sp. R72 Isolate Nodule
685 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
686 8005382845 Rhizobium sp. R634 Isolate Nodule
687 8005395548 Rhizobium sp. R339 Isolate Nodule
688 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
689 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
690 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
691 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
692 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
693 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
694 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
695 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
696 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
697 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
698 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
699 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
700 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
701 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
702 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
703 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
704 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
705 8018176218 Rhizobium sp. N122 Isolate Nodule
706 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
707 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
708 8024501048 Rhizobium sp. H4 Isolate Nodule
709 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
710 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
711 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
712 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
713 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
714 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
715 8056382006 Rhizobium croatiense 13T Isolate Nodule
716 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
717 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
718 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 18.77
Metatranscriptomes 0
Isolates 81.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.37
Nodule 66.89
Rhizoplane 0.4
Rhizosphere 13.54
Stem 0
Stem Tuber 0
Unclassified 11.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002558 3300002773 Bacteria 6835
2 JGI25152J39213_1011653 3300002773 Bacteria 1933
3 JGI25151J46595_10007278 3300003187 Bacteria 5444
4 JGI25153J46596_10001820 3300003215 Bacteria 12635
5 JGI25153J46596_10005206 3300003215 Bacteria 6843
6 JGI25153J46596_10007402 3300003215 Bacteria 5405
7 JGI25153J46596_10023064 3300003215 Bacteria 2276
8 JGI25160J50197_1004135 3300003354 Bacteria 6325
9 Ga0055526_1007248 3300003771 Bacteria 5815
10 Ga0055524_1000368 3300003775 Bacteria 39894
11 Ga0055524_1008288 3300003775 Bacteria 4328
12 Ga0055528_1000276 3300003790 Bacteria 43646
13 Ga0055528_1006908 3300003790 Bacteria 5088
14 Ga0055540_1000109 3300003792 Bacteria 89131
15 Ga0055540_1013928 3300003792 Bacteria 2426
16 Ga0055543_1003714 3300004625 Bacteria 4372
17 Ga0065165_1005533 3300005262 Bacteria 7050
18 Ga0065165_1041522 3300005262 Bacteria 1365
19 Ga0070708_100050471 3300005445 Bacteria 3684
20 Ga0081455_10376311 3300005937 Bacteria 993
21 Ga0075365_10004578 3300006038 Bacteria 7355
22 Ga0075363_100042125 3300006048 Bacteria 2411
23 Ga0075362_10058624 3300006177 Bacteria 1737
24 Ga0075367_10000761 3300006178 Bacteria 12596
25 Ga0075369_10000891 3300006186 Bacteria 9908
26 Ga0075370_10007766 3300006353 Bacteria 5479
27 Ga0075431_100610314 3300006847 Unclassified 1074
28 Ga0075434_100016837 3300006871 Bacteria 7032
29 Ga0068865_100577563 3300006881 Bacteria 947
30 Ga0075435_100053272 3300007076 Bacteria 3262
31 Ga0105245_10998400 3300009098 Bacteria 881
32 Ga0114129_10033328 3300009147 Bacteria 7279
33 Ga0105246_10145092 3300011119 Bacteria 1790
34 Ga0157380_10010005 3300014326 Bacteria 6808
35 Ga0207425_1001756 3300025245 Bacteria 8463
36 Ga0207425_1001768 3300025245 Bacteria 8420
37 Ga0209129_1002408 3300025258 Bacteria 9189
38 Ga0209129_1003537 3300025258 Bacteria 6740
39 Ga0209673_1000800 3300025273 Bacteria 41711
40 Ga0209673_1001640 3300025273 Bacteria 19356
41 Ga0209673_1014858 3300025273 Bacteria 2993
42 Ga0209025_1000058 3300025294 Bacteria 311398
43 Ga0209025_1010902 3300025294 Bacteria 6085
44 Ga0209564_1000458 3300025295 Bacteria 68749
45 Ga0209564_1042434 3300025295 Bacteria 1206
46 Ga0209758_1000398 3300025297 Bacteria 75220
47 Ga0209758_1002319 3300025297 Bacteria 19677
48 Ga0209758_1003828 3300025297 Bacteria 13214
49 Ga0209256_1000705 3300025299 Bacteria 44446
50 Ga0207426_1000147 3300025302 Bacteria 190586
51 Ga0209051_1000224 3300025303 Bacteria 95355
52 Ga0209051_1002923 3300025303 Bacteria 11715
53 Ga0209257_1001240 3300025304 Bacteria 31535
54 Ga0207704_10354274 3300025938 Bacteria 1144
55 Ga0207708_10636496 3300026075 Bacteria 907
56 Ga0307515_10082850 3300028794 Bacteria 4141
57 Ga0307408_100093545 3300031548 Bacteria 2274
58 Ga0307405_10041549 3300031731 Bacteria 2793
59 Ga0307413_10062107 3300031824 Bacteria 2309
60 Ga0307410_10123805 3300031852 Bacteria 1889
61 Ga0307406_10087127 3300031901 Bacteria 2092
62 Ga0307407_10054399 3300031903 Bacteria 2308
63 Ga0307409_100013850 3300031995 Bacteria 5214
64 Ga0307416_100299444 3300032002 Bacteria 1597
65 Ga0307414_10176596 3300032004 Bacteria 1713
66 Ga0307414_10402775 3300032004 Bacteria 1189
67 Ga0307411_10049782 3300032005 Bacteria 2725
68 Ga0307415_100085236 3300032126 Bacteria 2269
69 Ga0395905_0300532 3300037471 Bacteria 1492
70 Ga0439439_0079733 3300041406 Bacteria 884
71 Ga0439465_0050271 3300041413 Bacteria 1363
72 Ga0439465_0217877 3300041413 Bacteria 699
73 Ga0451787_476991 3300041441 Bacteria 1562
74 Ga0451837_1803467 3300041494 Bacteria 1139
75 Ga0451839_0288950 3300041496 Bacteria 997
76 Ga0451841_0107823 3300041498 Bacteria 4242
77 Ga0451845_0557307 3300041501 Bacteria 1566
78 Ga0451847_0009481 3300041503 Bacteria 5271
79 Ga0451853_1978418 3300041512 Bacteria 783
80 Ga0439449_0034371 3300042007 Bacteria 1888
81 Ga0466960_0054234 3300044901 Bacteria 1946
82 Ga0495650_0072316 3300046471 Bacteria 1350
83 Ga0495605_0106471 3300046474 Bacteria 1283
84 Ga0495585_0063793 3300046492 Bacteria 2021
85 Ga0495607_0144386 3300046501 Bacteria 1224
86 Ga0495606_0011221 3300046507 Bacteria 7332
87 Ga0495610_0034282 3300046512 Bacteria 2615
88 Ga0495620_0160237 3300046515 Bacteria 874
89 Ga0495631_0222813 3300046518 Bacteria 805
90 Ga0495643_0016673 3300046522 Bacteria 4313
91 Ga0495648_0214975 3300046524 Bacteria 952
92 Ga0495633_0169189 3300046558 Bacteria 1007
93 Ga0495625_0006095 3300046660 Bacteria 10814
94 Ga0495670_0082427 3300046691 Bacteria 1640
95 Ga0495671_0222166 3300046692 Bacteria 914
96 Ga0495660_0004700 3300046810 Bacteria 8237
97 Ga0496124_0535309 3300048927 Bacteria 777
98 Ga0501031_0067853 3300049568 Bacteria 2323
99 Ga0501032_0070391 3300049569 Bacteria 2333
100 Ga0501032_0232288 3300049569 Bacteria 1199
101 Ga0501034_0067418 3300049571 Bacteria 3591
102 Ga0501034_0092734 3300049571 Bacteria 3017
103 Ga0501038_0041980 3300049574 Bacteria 3985
104 Ga0501039_0074244 3300049575 Bacteria 2643
105 Ga0501039_0323824 3300049575 Bacteria 1211
106 Ga0501043_0175928 3300049579 Bacteria 1668
107 Ga0501046_0267307 3300049580 Bacteria 1255
108 Ga0501047_0098625 3300049581 Bacteria 2800
109 Ga0501047_0114963 3300049581 Bacteria 2573
110 Ga0501048_0245404 3300049582 Bacteria 1271
111 Ga0501067_0077292 3300049583 Bacteria 1845
112 Ga0501068_0345057 3300049584 Bacteria 956
113 Ga0501070_0074835 3300049586 Bacteria 2803
114 Ga0501072_0115047 3300049588 Bacteria 2142
115 Ga0501073_0234504 3300049589 Bacteria 1267
116 Ga0501074_0024172 3300049590 Bacteria 4416
117 Ga0501080_0782973 3300049742 Bacteria 837
118 Ga0501083_0124571 3300049744 Bacteria 1689
119 Ga0501083_0730532 3300049744 Bacteria 644
120 Ga0501269_013449 3300049766 Bacteria 1002
121 Ga0501035_0251018 3300049822 Bacteria 1502
122 Ga0501035_0671566 3300049822 Bacteria 838
123 Ga0501044_0016126 3300049823 Bacteria 8031
124 nmdc:mga03683_2318_c1 3300050489 Bacteria 5888
125 nmdc:mga0yw44_15986_c1 3300050492 Bacteria 4040
126 nmdc:mga0k408_4212_c1 3300050493 Bacteria 7626
127 nmdc:mga0k408_677368_c1 3300050493 Bacteria 605
128 nmdc:mga06z11_817_c1 3300050494 Bacteria 11396
129 nmdc:mga07m45_187668_c1 3300050496 Bacteria 1202
130 nmdc:mga07m45_928_c1 3300050496 Bacteria 12810
131 nmdc:mga05p37_24117_c1 3300050507 Bacteria 7390
132 nmdc:mga0n895_119455_c1 3300050512 Bacteria 2657
133 nmdc:mga0rr50_208314_c1 3300050513 Bacteria 1610
134 nmdc:mga0a205_97554_c1 3300050515 Bacteria 2838
135 nmdc:mga0sz30_708_c1 3300050516 Bacteria 12251
136 Ga0495655_0108319 3300053083 Bacteria 832
137 Ga0500578_0228446 3300053086 Bacteria 1128
138 Ga0500658_0000945 3300053134 Bacteria 11858
139 Ga0500616_0024755 3300053153 Bacteria 3332
140 Ga0500627_0040435 3300053158 Bacteria 2001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2906386501 2906391034 101
2 iso_pu_bacteria 2878774303 2878780288 104
3 iso_pu_bacteria 8004300914 8004304002 106
4 iso_pu_bacteria 2965119406 2965127520 113
5 iso_pu_bacteria 2878781027 2878786443 116
6 iso_pu_bacteria 2933016740 2933019773 118
7 iso_pu_bacteria 2937980651 2937981901 118
8 3300048927 Ga0496124_0535309 Ga0496124_0535309_12_503 121
9 iso_pu_bacteria 2871459585 2871462629 123
10 iso_pu_bacteria 2979793036 2979798622 123
11 iso_pu_bacteria 2937106411 2937110000 125
12 iso_pu_bacteria 2503198000 2503202756 129
13 iso_pu_bacteria 2510917028 2511181647 129
14 iso_pu_bacteria 2512875016 2512930470 129
15 iso_pu_bacteria 2513237088 2513594684 129
16 iso_pu_bacteria 2513237138 2513864752 129
17 iso_pu_bacteria 2513237164 2514032669 129
18 iso_pu_bacteria 2534681796 2535516595 129
19 iso_pu_bacteria 2582581867 2585402114 129
20 iso_pu_bacteria 2585427590 2585821899 129
21 iso_pu_bacteria 2643221558 2643811652 129
22 iso_pu_bacteria 2643221595 2643989514 129
23 iso_pu_bacteria 2643221599 2644003864 129
24 iso_pu_bacteria 2643221627 2644153908 129
25 iso_pu_bacteria 2643221643 2644239671 129
26 iso_pu_bacteria 2687453392 2688598881 129
27 iso_pu_bacteria 2756170246 2756677490 129
28 iso_pu_bacteria 2840764183 2840764263 129
29 iso_pu_bacteria 2856320880 2856324945 129
30 iso_pu_bacteria 2856334872 2856341763 129
31 iso_pu_bacteria 2857367948 2857375303 129
32 iso_pu_bacteria 2869169390 2869176181 129
33 iso_pu_bacteria 2869234852 2869240416 129
34 iso_pu_bacteria 2869242130 2869249492 129
35 iso_pu_bacteria 2869278585 2869281002 129
36 iso_pu_bacteria 2871451962 2871454507 129
37 iso_pu_bacteria 2871481445 2871487088 129
38 iso_pu_bacteria 2874109183 2874111968 129
39 iso_pu_bacteria 2874116593 2874121438 129
40 iso_pu_bacteria 2874139085 2874141331 129
41 iso_pu_bacteria 2874168670 2874170717 129
42 iso_pu_bacteria 2876363079 2876368188 129
43 iso_pu_bacteria 2876386047 2876388866 129
44 iso_pu_bacteria 2876420981 2876427714 129
45 iso_pu_bacteria 2878730984 2878732081 129
46 iso_pu_bacteria 2878738818 2878743059 129
47 iso_pu_bacteria 2885326080 2885332566 129
48 iso_pu_bacteria 2888337043 2888340794 129
49 iso_pu_bacteria 2889016732 2889023043 129
50 iso_pu_bacteria 2899803654 2899809002 129
51 iso_pu_bacteria 2903448605 2903452206 129
52 iso_pu_bacteria 2903513507 2903521238 129
53 iso_pu_bacteria 2903521522 2903527184 129
54 iso_pu_bacteria 2903528002 2903530248 129
55 iso_pu_bacteria 2906401398 2906404794 129
56 iso_pu_bacteria 2906427513 2906428718 129
57 iso_pu_bacteria 2919171160 2919174973 129
58 iso_pu_bacteria 2923556063 2923558033 129
59 iso_pu_bacteria 2924718760 2924723471 129
60 iso_pu_bacteria 2924733363 2924739266 129
61 iso_pu_bacteria 2924741084 2924741342 129
62 iso_pu_bacteria 2924776078 2924780858 129
63 iso_pu_bacteria 2937848649 2937854427 129
64 iso_pu_bacteria 2937861824 2937867390 129
65 iso_pu_bacteria 2937877337 2937879511 129
66 iso_pu_bacteria 2937972304 2937974846 129
67 iso_pu_bacteria 2958034702 2958036965 129
68 iso_pu_bacteria 2958041894 2958050588 129
69 iso_pu_bacteria 2958064165 2958067285 129
70 iso_pu_bacteria 2958084443 2958086686 129
71 iso_pu_bacteria 2958100919 2958105943 129
72 iso_pu_bacteria 2958108152 2958112208 129
73 iso_pu_bacteria 2958122699 2958125749 129
74 iso_pu_bacteria 2958144490 2958149960 129
75 iso_pu_bacteria 2958172287 2958177874 129
76 iso_pu_bacteria 2961183825 2961188176 129
77 iso_pu_bacteria 2963644680 2963648761 129
78 iso_pu_bacteria 2965032056 2965036047 129
79 iso_pu_bacteria 2968016561 2968020209 129
80 iso_pu_bacteria 2968083720 2968083986 129
81 iso_pu_bacteria 2970469710 2970473531 129
82 iso_pu_bacteria 2970489779 2970495787 129
83 iso_pu_bacteria 2970510686 2970512296 129
84 iso_pu_bacteria 2970593180 2970595606 129
85 iso_pu_bacteria 2970619444 2970625272 129
86 iso_pu_bacteria 2970627176 2970631250 129
87 iso_pu_bacteria 2977851361 2977852781 129
88 iso_pu_bacteria 2977872689 2977873964 129
89 iso_pu_bacteria 2977907340 2977913892 129
90 iso_pu_bacteria 2977922695 2977926612 129
91 iso_pu_bacteria 2977957713 2977959429 129
92 iso_pu_bacteria 2977986579 2977991016 129
93 iso_pu_bacteria 2979710463 2979711646 129
94 iso_pu_bacteria 2979764755 2979771649 129
95 iso_pu_bacteria 2979772303 2979778399 129
96 iso_pu_bacteria 2996348954 2996351332 129
97 iso_pu_bacteria 2996887358 2996891809 129
98 iso_pu_bacteria 3004167301 3004170301 129
99 iso_pu_bacteria 3004211236 3004215168 129
100 iso_pu_bacteria 3004218560 3004222241 129
101 iso_pu_bacteria 3004232784 3004234157 129
102 iso_pu_bacteria 3004239961 3004246976 129
103 iso_pu_bacteria 3004248173 3004251147 129
104 iso_pu_bacteria 3004268573 3004268982 129
105 iso_pu_bacteria 3004275668 3004278030 129
106 iso_pu_bacteria 3004289098 3004292572 129
107 iso_pu_bacteria 3004334049 3004340069 129
108 iso_pu_bacteria 637000159 637073464 129
109 iso_pu_bacteria 649633066 649873397 129
110 iso_pu_bacteria 8004727605 8004732595 129
111 iso_pu_bacteria 8005258706 8005263140 129
112 iso_pu_bacteria 8005321885 8005326336 129
113 iso_pu_bacteria 8005542996 8005545253 129
114 iso_pu_bacteria 8056875544 8056877771 129
115 3300009098 Ga0105245_10998400 Ga0105245_109984002 130
116 3300026075 Ga0207708_10636496 Ga0207708_106364962 130
117 iso_pu_bacteria 2508501114 2509074174 130
118 iso_pu_bacteria 2508501122 2509111385 130
119 iso_pu_bacteria 2509276019 2509375676 130
120 iso_pu_bacteria 2509276021 2509392206 130
121 iso_pu_bacteria 2509276033 2509446841 130
122 iso_pu_bacteria 2510065019 2510133794 130
123 iso_pu_bacteria 2510065057 2510303302 130
124 iso_pu_bacteria 2510461076 2510895220 130
125 iso_pu_bacteria 2511231052 2511501957 130
126 iso_pu_bacteria 2512047086 2512533328 130
127 iso_pu_bacteria 2512875026 2512971117 130
128 iso_pu_bacteria 2513237084 2513573824 130
129 iso_pu_bacteria 2513237085 2513576796 130
130 iso_pu_bacteria 2513237086 2513584741 130
131 iso_pu_bacteria 2513237089 2513604526 130
132 iso_pu_bacteria 2513237091 2513615449 130
133 iso_pu_bacteria 2513237093 2513629555 130
134 iso_pu_bacteria 2513237103 2513708196 130
135 iso_pu_bacteria 2513237140 2513881237 130
136 iso_pu_bacteria 2513237143 2513902369 130
137 iso_pu_bacteria 2513237144 2513911752 130
138 iso_pu_bacteria 2513237146 2513926079 130
139 iso_pu_bacteria 2513237156 2513984615 130
140 iso_pu_bacteria 2513237159 2513997079 130
141 iso_pu_bacteria 2513237160 2514007579 130
142 iso_pu_bacteria 2513237162 2514020160 130
143 iso_pu_bacteria 2515075009 2515112838 130
144 iso_pu_bacteria 2515154107 2515608747 130
145 iso_pu_bacteria 2515154113 2515636478 130
146 iso_pu_bacteria 2515154114 2515640808 130
147 iso_pu_bacteria 2515154116 2515655508 130
148 iso_pu_bacteria 2515154134 2515744094 130
149 iso_pu_bacteria 2516143018 2516209677 130
150 iso_pu_bacteria 2516653046 2516893252 130
151 iso_pu_bacteria 2516653077 2517036547 130
152 iso_pu_bacteria 2516653085 2517076917 130
153 iso_pu_bacteria 2517093000 2517095675 130
154 iso_pu_bacteria 2517287029 2517407241 130
155 iso_pu_bacteria 2517487022 2517569999 130
156 iso_pu_bacteria 2519899620 2520381524 130
157 iso_pu_bacteria 2524023207 2524448846 130
158 iso_pu_bacteria 2529292951 2530646163 130
159 iso_pu_bacteria 2551306084 2551674931 130
160 iso_pu_bacteria 2551306084 2551680185 130
161 iso_pu_bacteria 2551306085 2551684838 130
162 iso_pu_bacteria 2551306086 2551695932 130
163 iso_pu_bacteria 2551306087 2551704470 130
164 iso_pu_bacteria 2551306089 2551711465 130
165 iso_pu_bacteria 2551306090 2551720830 130
166 iso_pu_bacteria 2551306091 2551728682 130
167 iso_pu_bacteria 2551306092 2551735017 130
168 iso_pu_bacteria 2551306093 2551739433 130
169 iso_pu_bacteria 2558860100 2558867992 130
170 iso_pu_bacteria 2582581283 2585166118 130
171 iso_pu_bacteria 2582581304 2585254863 130
172 iso_pu_bacteria 2582581306 2585267678 130
173 iso_pu_bacteria 2582581308 2585277305 130
174 iso_pu_bacteria 2582581315 2585323523 130
175 iso_pu_bacteria 2582581316 2585331658 130
176 iso_pu_bacteria 2582581865 2585386737 130
177 iso_pu_bacteria 2582581866 2585393035 130
178 iso_pu_bacteria 2585427526 2585527292 130
179 iso_pu_bacteria 2585427527 2585533960 130
180 iso_pu_bacteria 2585427528 2585538034 130
181 iso_pu_bacteria 2585427530 2585552189 130
182 iso_pu_bacteria 2585427593 2585835982 130
183 iso_pu_bacteria 2585427594 2585846822 130
184 iso_pu_bacteria 2599185170 2599417552 130
185 iso_pu_bacteria 2599185352 2600193104 130
186 iso_pu_bacteria 2615840624 2616293526 130
187 iso_pu_bacteria 2615840626 2616308682 130
188 iso_pu_bacteria 2615840698 2616557012 130
189 iso_pu_bacteria 2617270742 2617385780 130
190 iso_pu_bacteria 2643221557 2643803603 130
191 iso_pu_bacteria 2643221607 2644050750 130
192 iso_pu_bacteria 2643221610 2644067571 130
193 iso_pu_bacteria 2643221618 2644107718 130
194 iso_pu_bacteria 2643221626 2644148611 130
195 iso_pu_bacteria 2643221636 2644205224 130
196 iso_pu_bacteria 2643221637 2644210238 130
197 iso_pu_bacteria 2643221655 2644309112 130
198 iso_pu_bacteria 2643221659 2644332939 130
199 iso_pu_bacteria 2643221668 2644375250 130
200 iso_pu_bacteria 2643221675 2644418624 130
201 iso_pu_bacteria 2643221680 2644451991 130
202 iso_pu_bacteria 2643221686 2644483668 130
203 iso_pu_bacteria 2643221688 2644491789 130
204 iso_pu_bacteria 2643221689 2644501335 130
205 iso_pu_bacteria 2643221698 2644545889 130
206 iso_pu_bacteria 2643221712 2644615054 130
207 iso_pu_bacteria 2643221718 2644653790 130
208 iso_pu_bacteria 2643221723 2644676590 130
209 iso_pu_bacteria 2643221726 2644690753 130
210 iso_pu_bacteria 2657244999 2657681174 130
211 iso_pu_bacteria 2667528174 2671111619 130
212 iso_pu_bacteria 2690316117 2692315861 130
213 iso_pu_bacteria 2718217882 2719181648 130
214 iso_pu_bacteria 2718217927 2719386184 130
215 iso_pu_bacteria 2718218009 2719732312 130
216 iso_pu_bacteria 2718218199 2720492410 130
217 iso_pu_bacteria 2718218232 2720613765 130
218 iso_pu_bacteria 2718218233 2720620553 130
219 iso_pu_bacteria 2718218235 2720631978 130
220 iso_pu_bacteria 2718218269 2720775706 130
221 iso_pu_bacteria 2718218363 2721147740 130
222 iso_pu_bacteria 2718218365 2721159188 130
223 iso_pu_bacteria 2718218366 2721164575 130
224 iso_pu_bacteria 2718218423 2721399966 130
225 iso_pu_bacteria 2721755514 2722840745 130
226 iso_pu_bacteria 2721755556 2723027313 130
227 iso_pu_bacteria 2721755684 2723560932 130
228 iso_pu_bacteria 2721755685 2723567525 130
229 iso_pu_bacteria 2721755809 2724038779 130
230 iso_pu_bacteria 2721755810 2724045068 130
231 iso_pu_bacteria 2721755819 2724090313 130
232 iso_pu_bacteria 2721755822 2724104790 130
233 iso_pu_bacteria 2721755823 2724110591 130
234 iso_pu_bacteria 2724679232 2725950053 130
235 iso_pu_bacteria 2728369352 2730108249 130
236 iso_pu_bacteria 2728369365 2730164883 130
237 iso_pu_bacteria 2728369397 2730298820 130
238 iso_pu_bacteria 2738541293 2738804216 130
239 iso_pu_bacteria 2738541333 2739032691 130
240 iso_pu_bacteria 2751185821 2753461849 130
241 iso_pu_bacteria 2765235942 2766065716 130
242 iso_pu_bacteria 2773857925 2774869869 130
243 iso_pu_bacteria 2775506901 2776259083 130
244 iso_pu_bacteria 2775507266 2778174116 130
245 iso_pu_bacteria 2791355082 2792581776 130
246 iso_pu_bacteria 2791355091 2792620154 130
247 iso_pu_bacteria 2791355092 2792626426 130
248 iso_pu_bacteria 2791355094 2792639374 130
249 iso_pu_bacteria 2791355253 2793279933 130
250 iso_pu_bacteria 2791355256 2793298721 130
251 iso_pu_bacteria 2791355259 2793314691 130
252 iso_pu_bacteria 2791355260 2793320528 130
253 iso_pu_bacteria 2791355261 2793330433 130
254 iso_pu_bacteria 2791355262 2793338543 130
255 iso_pu_bacteria 2791355264 2793348721 130
256 iso_pu_bacteria 2791355265 2793351988 130
257 iso_pu_bacteria 2791355266 2793363837 130
258 iso_pu_bacteria 2791355267 2793367186 130
259 iso_pu_bacteria 2802428858 2802719494 130
260 iso_pu_bacteria 2802428859 2802726913 130
261 iso_pu_bacteria 2802428860 2802732228 130
262 iso_pu_bacteria 2802428861 2802739831 130
263 iso_pu_bacteria 2802428862 2802745337 130
264 iso_pu_bacteria 2802428863 2802752729 130
265 iso_pu_bacteria 2802429268 2804752373 130
266 iso_pu_bacteria 2802429605 2805931009 130
267 iso_pu_bacteria 2802429606 2805936020 130
268 iso_pu_bacteria 2802429633 2806043671 130
269 iso_pu_bacteria 2802429634 2806050398 130
270 iso_pu_bacteria 2802429635 2806057215 130
271 iso_pu_bacteria 2802429636 2806064596 130
272 iso_pu_bacteria 2802429637 2806071863 130
273 iso_pu_bacteria 2818991448 2819608965 130
274 iso_pu_bacteria 2818991453 2819637807 130
275 iso_pu_bacteria 2838016132 2838017822 130
276 iso_pu_bacteria 2838022645 2838028582 130
277 iso_pu_bacteria 2838029111 2838029990 130
278 iso_pu_bacteria 2838035591 2838038236 130
279 iso_pu_bacteria 2838048938 2838051884 130
280 iso_pu_bacteria 2838061910 2838068494 130
281 iso_pu_bacteria 2838068647 2838070312 130
282 iso_pu_bacteria 2838074704 2838079604 130
283 iso_pu_bacteria 2838661181 2838661887 130
284 iso_pu_bacteria 2838668709 2838674162 130
285 iso_pu_bacteria 2838680041 2838681763 130
286 iso_pu_bacteria 2838686498 2838687203 130
287 iso_pu_bacteria 2838694306 2838696335 130
288 iso_pu_bacteria 2838701080 2838706592 130
289 iso_pu_bacteria 2838707686 2838710426 130
290 iso_pu_bacteria 2838729681 2838729825 130
291 iso_pu_bacteria 2838742623 2838743160 130
292 iso_pu_bacteria 2841851746 2841852646 130
293 iso_pu_bacteria 2841864319 2841869948 130
294 iso_pu_bacteria 2842077413 2842078600 130
295 iso_pu_bacteria 2842110456 2842114827 130
296 iso_pu_bacteria 2842118031 2842118891 130
297 iso_pu_bacteria 2842146304 2842151327 130
298 iso_pu_bacteria 2842156927 2842157894 130
299 iso_pu_bacteria 2842163707 2842167560 130
300 iso_pu_bacteria 2842180545 2842181513 130
301 iso_pu_bacteria 2842192696 2842198425 130
302 iso_pu_bacteria 2842198810 2842204610 130
303 iso_pu_bacteria 2842205361 2842205641 130
304 iso_pu_bacteria 2842217011 2842217777 130
305 iso_pu_bacteria 2842229732 2842230436 130
306 iso_pu_bacteria 2842237096 2842239838 130
307 iso_pu_bacteria 2842243621 2842244338 130
308 iso_pu_bacteria 2842250916 2842256356 130
309 iso_pu_bacteria 2842257432 2842257576 130
310 iso_pu_bacteria 2842264693 2842265654 130
311 iso_pu_bacteria 2842271015 2842271259 130
312 iso_pu_bacteria 2842278818 2842279098 130
313 iso_pu_bacteria 2842285085 2842285760 130
314 iso_pu_bacteria 2842291075 2842292262 130
315 iso_pu_bacteria 2842304105 2842304885 130
316 iso_pu_bacteria 2842311132 2842315078 130
317 iso_pu_bacteria 2842317721 2842320548 130
318 iso_pu_bacteria 2842341865 2842346306 130
319 iso_pu_bacteria 2842363717 2842369819 130
320 iso_pu_bacteria 2842370503 2842372330 130
321 iso_pu_bacteria 2842377471 2842378659 130
322 iso_pu_bacteria 2842384541 2842385401 130
323 iso_pu_bacteria 2842395702 2842401919 130
324 iso_pu_bacteria 2842402390 2842403120 130
325 iso_pu_bacteria 2842409023 2842409507 130
326 iso_pu_bacteria 2842415677 2842416160 130
327 iso_pu_bacteria 2842422224 2842423926 130
328 iso_pu_bacteria 2842428310 2842429709 130
329 iso_pu_bacteria 2842434925 2842436322 130
330 iso_pu_bacteria 2842441272 2842442669 130
331 iso_pu_bacteria 2842447887 2842452943 130
332 iso_pu_bacteria 2842462802 2842464130 130
333 iso_pu_bacteria 2842469257 2842470651 130
334 iso_pu_bacteria 2842475841 2842476725 130
335 iso_pu_bacteria 2842482326 2842484735 130
336 iso_pu_bacteria 2842489311 2842490420 130
337 iso_pu_bacteria 2842495871 2842496988 130
338 iso_pu_bacteria 2842502639 2842503518 130
339 iso_pu_bacteria 2842509118 2842511323 130
340 iso_pu_bacteria 2842521101 2842522679 130
341 iso_pu_bacteria 2842922631 2842923967 130
342 iso_pu_bacteria 2844163670 2844167569 130
343 iso_pu_bacteria 2844454524 2844458569 130
344 iso_pu_bacteria 2847417321 2847419074 130
345 iso_pu_bacteria 2850079185 2850081148 130
346 iso_pu_bacteria 2852387548 2852390010 130
347 iso_pu_bacteria 2855825444 2855825978 130
348 iso_pu_bacteria 2855839649 2855841324 130
349 iso_pu_bacteria 2855872281 2855876750 130
350 iso_pu_bacteria 2856328259 2856331574 130
351 iso_pu_bacteria 2857516855 2857517590 130
352 iso_pu_bacteria 2858800743 2858802305 130
353 iso_pu_bacteria 2869249662 2869252784 130
354 iso_pu_bacteria 2869264136 2869265959 130
355 iso_pu_bacteria 2869271264 2869274797 130
356 iso_pu_bacteria 2874131515 2874134014 130
357 iso_pu_bacteria 2874162495 2874166258 130
358 iso_pu_bacteria 2876399893 2876405306 130
359 iso_pu_bacteria 2876406927 2876407698 130
360 iso_pu_bacteria 2896384573 2896389947 130
361 iso_pu_bacteria 2906363423 2906369220 130
362 iso_pu_bacteria 2906370794 2906375266 130
363 iso_pu_bacteria 2906393657 2906396356 130
364 iso_pu_bacteria 2906408224 2906414177 130
365 iso_pu_bacteria 2913295892 2913300849 130
366 iso_pu_bacteria 2915980308 2915981913 130
367 iso_pu_bacteria 2915986958 2915991356 130
368 iso_pu_bacteria 2915993759 2915994374 130
369 iso_pu_bacteria 2916000859 2916002204 130
370 iso_pu_bacteria 2916007675 2916009174 130
371 iso_pu_bacteria 2916014648 2916018210 130
372 iso_pu_bacteria 2916021584 2916022729 130
373 iso_pu_bacteria 2916028427 2916029422 130
374 iso_pu_bacteria 2916035215 2916035990 130
375 iso_pu_bacteria 2916041962 2916042527 130
376 iso_pu_bacteria 2916048683 2916052267 130
377 iso_pu_bacteria 2916055098 2916061457 130
378 iso_pu_bacteria 2916061851 2916067599 130
379 iso_pu_bacteria 2916068649 2916074718 130
380 iso_pu_bacteria 2916076590 2916080854 130
381 iso_pu_bacteria 2917554339 2917557544 130
382 iso_pu_bacteria 2919408235 2919411590 130
383 iso_pu_bacteria 2920760137 2920766104 130
384 iso_pu_bacteria 2920822456 2920824709 130
385 iso_pu_bacteria 2921201388 2921201947 130
386 iso_pu_bacteria 2921208531 2921210486 130
387 iso_pu_bacteria 2921237296 2921238985 130
388 iso_pu_bacteria 2921244191 2921244571 130
389 iso_pu_bacteria 2921250672 2921251196 130
390 iso_pu_bacteria 2921257292 2921262483 130
391 iso_pu_bacteria 2921263974 2921270813 130
392 iso_pu_bacteria 2921282425 2921284312 130
393 iso_pu_bacteria 2921289301 2921291259 130
394 iso_pu_bacteria 2922151315 2922156364 130
395 iso_pu_bacteria 2922172374 2922172439 130
396 iso_pu_bacteria 2922178524 2922178905 130
397 iso_pu_bacteria 2924144063 2924144446 130
398 iso_pu_bacteria 2924150972 2924152326 130
399 iso_pu_bacteria 2924158325 2924160754 130
400 iso_pu_bacteria 2924165586 2924168708 130
401 iso_pu_bacteria 2924172951 2924173628 130
402 iso_pu_bacteria 2924179722 2924181189 130
403 iso_pu_bacteria 2924186466 2924187729 130
404 iso_pu_bacteria 2924193448 2924200438 130
405 iso_pu_bacteria 2924200457 2924206873 130
406 iso_pu_bacteria 2924207177 2924213963 130
407 iso_pu_bacteria 2924214083 2924214964 130
408 iso_pu_bacteria 2924221636 2924222977 130
409 iso_pu_bacteria 2924228884 2924229327 130
410 iso_pu_bacteria 2924748358 2924748451 130
411 iso_pu_bacteria 2929199973 2929205171 130
412 iso_pu_bacteria 2933570622 2933570693 130
413 iso_pu_bacteria 2933586486 2933591199 130
414 iso_pu_bacteria 2933599457 2933601117 130
415 iso_pu_bacteria 2935894831 2935900660 130
416 iso_pu_bacteria 2935901341 2935902109 130
417 iso_pu_bacteria 2936367885 2936372196 130
418 iso_pu_bacteria 2936375103 2936381000 130
419 iso_pu_bacteria 2936381700 2936386807 130
420 iso_pu_bacteria 2936996657 2937002090 130
421 iso_pu_bacteria 2937002841 2937003435 130
422 iso_pu_bacteria 2937009748 2937014128 130
423 iso_pu_bacteria 2937016420 2937018623 130
424 iso_pu_bacteria 2937023124 2937028957 130
425 iso_pu_bacteria 2937029754 2937033432 130
426 iso_pu_bacteria 2937036028 2937038607 130
427 iso_pu_bacteria 2937042894 2937044355 130
428 iso_pu_bacteria 2937049772 2937051075 130
429 iso_pu_bacteria 2937056579 2937062334 130
430 iso_pu_bacteria 2937063883 2937065239 130
431 iso_pu_bacteria 2937071275 2937072405 130
432 iso_pu_bacteria 2937078374 2937079775 130
433 iso_pu_bacteria 2937084907 2937088080 130
434 iso_pu_bacteria 2937091812 2937097579 130
435 iso_pu_bacteria 2937098957 2937099526 130
436 iso_pu_bacteria 2937113482 2937119015 130
437 iso_pu_bacteria 2937119839 2937126049 130
438 iso_pu_bacteria 2937126314 2937126846 130
439 iso_pu_bacteria 2941499720 2941504989 130
440 iso_pu_bacteria 2957375807 2957376560 130
441 iso_pu_bacteria 2957382221 2957388458 130
442 iso_pu_bacteria 2957388812 2957394835 130
443 iso_pu_bacteria 2957395598 2957398285 130
444 iso_pu_bacteria 2957402308 2957408796 130
445 iso_pu_bacteria 2957408893 2957414736 130
446 iso_pu_bacteria 2957415311 2957416009 130
447 iso_pu_bacteria 2957422303 2957424205 130
448 iso_pu_bacteria 2957430029 2957430985 130
449 iso_pu_bacteria 2957437181 2957441241 130
450 iso_pu_bacteria 2957443900 2957444979 130
451 iso_pu_bacteria 2957450854 2957451406 130
452 iso_pu_bacteria 2957457609 2957458668 130
453 iso_pu_bacteria 2957464669 2957471099 130
454 iso_pu_bacteria 2957471148 2957472066 130
455 iso_pu_bacteria 2957478035 2957484439 130
456 iso_pu_bacteria 2957484790 2957486190 130
457 iso_pu_bacteria 2957491536 2957492017 130
458 iso_pu_bacteria 2957498199 2957503699 130
459 iso_pu_bacteria 2957505466 2957507112 130
460 iso_pu_bacteria 2958137437 2958137449 130
461 iso_pu_bacteria 2958158011 2958164733 130
462 iso_pu_bacteria 2960584000 2960586185 130
463 iso_pu_bacteria 2960591022 2960592740 130
464 iso_pu_bacteria 2960597568 2960598007 130
465 iso_pu_bacteria 2960603979 2960604773 130
466 iso_pu_bacteria 2960610863 2960612411 130
467 iso_pu_bacteria 2960617483 2960620023 130
468 iso_pu_bacteria 2960624210 2960629237 130
469 iso_pu_bacteria 2960631154 2960632858 130
470 iso_pu_bacteria 2960637947 2960640059 130
471 iso_pu_bacteria 2960645483 2960647103 130
472 iso_pu_bacteria 2960652885 2960655291 130
473 iso_pu_bacteria 2960660292 2960660859 130
474 iso_pu_bacteria 2960667422 2960673779 130
475 iso_pu_bacteria 2960674078 2960675561 130
476 iso_pu_bacteria 2960680706 2960681836 130
477 iso_pu_bacteria 2960687367 2960688005 130
478 iso_pu_bacteria 2960693952 2960700552 130
479 iso_pu_bacteria 2961136820 2961139513 130
480 iso_pu_bacteria 2964607997 2964609706 130
481 iso_pu_bacteria 2964615318 2964616561 130
482 iso_pu_bacteria 2964621998 2964623730 130
483 iso_pu_bacteria 2964628898 2964629435 130
484 iso_pu_bacteria 2964636051 2964640937 130
485 iso_pu_bacteria 2964643177 2964649044 130
486 iso_pu_bacteria 2964649959 2964651796 130
487 iso_pu_bacteria 2964656573 2964661020 130
488 iso_pu_bacteria 2964663802 2964670791 130
489 iso_pu_bacteria 2964670856 2964673620 130
490 iso_pu_bacteria 2964678106 2964680026 130
491 iso_pu_bacteria 2964685014 2964686271 130
492 iso_pu_bacteria 2964691889 2964693090 130
493 iso_pu_bacteria 2964698721 2964699846 130
494 iso_pu_bacteria 2964705432 2964706095 130
495 iso_pu_bacteria 2964712639 2964713947 130
496 iso_pu_bacteria 2964719344 2964721502 130
497 iso_pu_bacteria 2965025482 2965028161 130
498 iso_pu_bacteria 2965047637 2965054130 130
499 iso_pu_bacteria 2965102966 2965104277 130
500 iso_pu_bacteria 2967664464 2967665510 130
501 iso_pu_bacteria 2967671571 2967671984 130
502 iso_pu_bacteria 2967678726 2967681866 130
503 iso_pu_bacteria 2967686174 2967691677 130
504 iso_pu_bacteria 2967693043 2967695264 130
505 iso_pu_bacteria 2967699805 2967701920 130
506 iso_pu_bacteria 2967706974 2967708229 130
507 iso_pu_bacteria 2967714385 2967716652 130
508 iso_pu_bacteria 2967721400 2967721653 130
509 iso_pu_bacteria 2967728569 2967734960 130
510 iso_pu_bacteria 2967735183 2967736851 130
511 iso_pu_bacteria 2967742019 2967744351 130
512 iso_pu_bacteria 2967748971 2967753308 130
513 iso_pu_bacteria 2967755722 2967758734 130
514 iso_pu_bacteria 2967762386 2967765370 130
515 iso_pu_bacteria 2967769361 2967770962 130
516 iso_pu_bacteria 2967775926 2967778382 130
517 iso_pu_bacteria 2970019648 2970026528 130
518 iso_pu_bacteria 2970026789 2970031035 130
519 iso_pu_bacteria 2970033650 2970039711 130
520 iso_pu_bacteria 2970040964 2970041319 130
521 iso_pu_bacteria 2970047711 2970053625 130
522 iso_pu_bacteria 2970054988 2970061207 130
523 iso_pu_bacteria 2970061556 2970063305 130
524 iso_pu_bacteria 2970068827 2970073010 130
525 iso_pu_bacteria 2970076120 2970082719 130
526 iso_pu_bacteria 2970082768 2970083731 130
527 iso_pu_bacteria 2970088815 2970089288 130
528 iso_pu_bacteria 2970095765 2970096771 130
529 iso_pu_bacteria 2970102677 2970107484 130
530 iso_pu_bacteria 2970109326 2970116093 130
531 iso_pu_bacteria 2970116247 2970122175 130
532 iso_pu_bacteria 2970122695 2970122957 130
533 iso_pu_bacteria 2970129317 2970131674 130
534 iso_pu_bacteria 2970136068 2970138874 130
535 iso_pu_bacteria 2970143518 2970144123 130
536 iso_pu_bacteria 2970149975 2970150819 130
537 iso_pu_bacteria 2970156795 2970161579 130
538 iso_pu_bacteria 2970164137 2970170383 130
539 iso_pu_bacteria 2970170962 2970172847 130
540 iso_pu_bacteria 2970177841 2970178386 130
541 iso_pu_bacteria 2970184632 2970186167 130
542 iso_pu_bacteria 2970191845 2970192269 130
543 iso_pu_bacteria 2970547951 2970547968 130
544 iso_pu_bacteria 2977516862 2977522412 130
545 iso_pu_bacteria 2977523885 2977524371 130
546 iso_pu_bacteria 2977530762 2977531646 130
547 iso_pu_bacteria 2977537788 2977544336 130
548 iso_pu_bacteria 2977544691 2977549061 130
549 iso_pu_bacteria 2977551784 2977554427 130
550 iso_pu_bacteria 2977558990 2977560896 130
551 iso_pu_bacteria 2977565890 2977572652 130
552 iso_pu_bacteria 2977572785 2977579608 130
553 iso_pu_bacteria 2977579622 2977580164 130
554 iso_pu_bacteria 2977915119 2977917383 130
555 iso_pu_bacteria 2977935797 2977941642 130
556 iso_pu_bacteria 2977950692 2977952045 130
557 iso_pu_bacteria 2987673487 2987676901 130
558 iso_pu_bacteria 2989349275 2989349407 130
559 iso_pu_bacteria 2996893221 2996898682 130
560 iso_pu_bacteria 3003930520 3003933769 130
561 iso_pu_bacteria 3004195979 3004198474 130
562 iso_pu_bacteria 3005409236 3005414989 130
563 iso_pu_bacteria 3005416602 3005420002 130
564 iso_pu_bacteria 3005452660 3005454346 130
565 iso_pu_bacteria 639633055 639649043 130
566 iso_pu_bacteria 643692032 643825960 130
567 iso_pu_bacteria 648276728 648741748 130
568 iso_pu_bacteria 8003992118 8003993833 130
569 iso_pu_bacteria 8003999396 8004001370 130
570 iso_pu_bacteria 8004361976 8004362183 130
571 iso_pu_bacteria 8004695233 8004701066 130
572 iso_pu_bacteria 8005275841 8005280973 130
573 iso_pu_bacteria 8005282627 8005285156 130
574 iso_pu_bacteria 8005289223 8005293480 130
575 iso_pu_bacteria 8005301065 8005302956 130
576 iso_pu_bacteria 8005307578 8005312679 130
577 iso_pu_bacteria 8005314921 8005316953 130
578 iso_pu_bacteria 8005376324 8005380770 130
579 iso_pu_bacteria 8005382845 8005386387 130
580 iso_pu_bacteria 8005395548 8005396286 130
581 iso_pu_bacteria 8005430974 8005434984 130
582 iso_pu_bacteria 8005460587 8005463512 130
583 iso_pu_bacteria 8005484373 8005485249 130
584 iso_pu_bacteria 8005497431 8005500723 130
585 iso_pu_bacteria 8005556819 8005557170 130
586 iso_pu_bacteria 8005563573 8005567834 130
587 iso_pu_bacteria 8005570704 8005573618 130
588 iso_pu_bacteria 8005619151 8005622099 130
589 iso_pu_bacteria 8005626139 8005632419 130
590 iso_pu_bacteria 8005645114 8005649766 130
591 iso_pu_bacteria 8005668836 8005672142 130
592 iso_pu_bacteria 8005682033 8005683083 130
593 iso_pu_bacteria 8005688590 8005692275 130
594 iso_pu_bacteria 8005695170 8005696437 130
595 iso_pu_bacteria 8018127388 8018133920 130
596 iso_pu_bacteria 8018163183 8018166250 130
597 iso_pu_bacteria 8018176218 8018181479 130
598 iso_pu_bacteria 8023680758 8023683323 130
599 iso_pu_bacteria 8024479707 8024483022 130
600 iso_pu_bacteria 8024501048 8024503910 130
601 iso_pu_bacteria 8046767195 8046770429 130
602 iso_pu_bacteria 8049293176 8049294948 130
603 iso_pu_bacteria 8054558443 8054560248 130
604 iso_pu_bacteria 8054563764 8054566606 130
605 iso_pu_bacteria 8055909800 8055915140 130
606 iso_pu_bacteria 8056375014 8056378845 130
607 iso_pu_bacteria 8056382006 8056386563 130
608 iso_pu_bacteria 8057575449 8057575934 130
609 iso_pu_bacteria 8057874678 8057877397 130
610 3300002773 JGI25152J39213_1011653 JGI25152J39213_10116532 131
611 3300003187 JGI25151J46595_10007278 JGI25151J46595_100072785 131
612 3300003215 JGI25153J46596_10007402 JGI25153J46596_100074022 131
613 3300003215 JGI25153J46596_10023064 JGI25153J46596_100230641 131
614 3300003354 JGI25160J50197_1004135 JGI25160J50197_10041355 131
615 3300003771 Ga0055526_1007248 Ga0055526_10072484 131
616 3300003775 Ga0055524_1000368 Ga0055524_10003681 131
617 3300003775 Ga0055524_1008288 Ga0055524_10082885 131
618 3300003790 Ga0055528_1000276 Ga0055528_100027641 131
619 3300003792 Ga0055540_1013928 Ga0055540_10139282 131
620 3300004625 Ga0055543_1003714 Ga0055543_10037142 131
621 3300005262 Ga0065165_1041522 Ga0065165_10415221 131
622 3300006038 Ga0075365_10004578 Ga0075365_100045785 131
623 3300006177 Ga0075362_10058624 Ga0075362_100586242 131
624 3300006178 Ga0075367_10000761 Ga0075367_100007618 131
625 3300006186 Ga0075369_10000891 Ga0075369_1000089112 131
626 3300006353 Ga0075370_10007766 Ga0075370_100077662 131
627 3300025245 Ga0207425_1001768 Ga0207425_10017685 131
628 3300025258 Ga0209129_1002408 Ga0209129_10024085 131
629 3300025273 Ga0209673_1000800 Ga0209673_100080037 131
630 3300025294 Ga0209025_1000058 Ga0209025_1000058189 131
631 3300025295 Ga0209564_1000458 Ga0209564_100045815 131
632 3300025297 Ga0209758_1000398 Ga0209758_100039869 131
633 3300025299 Ga0209256_1000705 Ga0209256_100070511 131
634 3300025302 Ga0207426_1000147 Ga0207426_10001475 131
635 3300025303 Ga0209051_1002923 Ga0209051_10029238 131
636 3300050489 nmdc:mga03683_2318_c1 nmdc:mga03683_2318_c1_3790_4320 131
637 3300050492 nmdc:mga0yw44_15986_c1 nmdc:mga0yw44_15986_c1_2892_3422 131
638 3300050493 nmdc:mga0k408_4212_c1 nmdc:mga0k408_4212_c1_4550_5080 131
639 3300050494 nmdc:mga06z11_817_c1 nmdc:mga06z11_817_c1_6145_6675 131
640 3300050496 nmdc:mga07m45_928_c1 nmdc:mga07m45_928_c1_9113_9643 131
641 3300050516 nmdc:mga0sz30_708_c1 nmdc:mga0sz30_708_c1_8972_9502 131
642 3300006881 Ga0068865_100577563 Ga0068865_1005775632 132
643 3300011119 Ga0105246_10145092 Ga0105246_101450922 132
644 3300014326 Ga0157380_10010005 Ga0157380_100100056 132
645 3300025938 Ga0207704_10354274 Ga0207704_103542742 132
646 3300037471 Ga0395905_0300532 Ga0395905_0300532_429_959 132
647 3300046492 Ga0495585_0063793 Ga0495585_0063793_756_1286 132
648 3300046524 Ga0495648_0214975 Ga0495648_0214975_231_761 132
649 3300046558 Ga0495633_0169189 Ga0495633_0169189_252_782 132
650 3300046691 Ga0495670_0082427 Ga0495670_0082427_1024_1554 132
651 3300049568 Ga0501031_0067853 Ga0501031_0067853_580_1113 132
652 3300049569 Ga0501032_0232288 Ga0501032_0232288_62_586 132
653 3300049571 Ga0501034_0067418 Ga0501034_0067418_1010_1534 132
654 3300049574 Ga0501038_0041980 Ga0501038_0041980_2242_2766 132
655 3300049575 Ga0501039_0074244 Ga0501039_0074244_1262_1786 132
656 3300049575 Ga0501039_0323824 Ga0501039_0323824_43_576 132
657 3300049580 Ga0501046_0267307 Ga0501046_0267307_705_1229 132
658 3300049581 Ga0501047_0098625 Ga0501047_0098625_807_1331 132
659 3300049582 Ga0501048_0245404 Ga0501048_0245404_31_555 132
660 3300049584 Ga0501068_0345057 Ga0501068_0345057_354_878 132
661 3300049586 Ga0501070_0074835 Ga0501070_0074835_1222_1746 132
662 3300049588 Ga0501072_0115047 Ga0501072_0115047_796_1320 132
663 3300049589 Ga0501073_0234504 Ga0501073_0234504_625_1149 132
664 3300049590 Ga0501074_0024172 Ga0501074_0024172_967_1491 132
665 3300049744 Ga0501083_0730532 Ga0501083_0730532_49_573 132
666 3300049766 Ga0501269_013449 Ga0501269_013449_279_815 132
667 3300049822 Ga0501035_0251018 Ga0501035_0251018_183_707 132
668 3300049823 Ga0501044_0016126 Ga0501044_0016126_6515_7039 132
669 3300003215 JGI25153J46596_10001820 JGI25153J46596_100018207 133
670 3300005262 Ga0065165_1005533 Ga0065165_10055337 133
671 3300025297 Ga0209758_1002319 Ga0209758_10023197 133
672 3300046471 Ga0495650_0072316 Ga0495650_0072316_53_583 133
673 3300046474 Ga0495605_0106471 Ga0495605_0106471_281_811 133
674 3300046512 Ga0495610_0034282 Ga0495610_0034282_458_988 133
675 3300046518 Ga0495631_0222813 Ga0495631_0222813_14_544 133
676 3300046660 Ga0495625_0006095 Ga0495625_0006095_4734_5264 133
677 3300046692 Ga0495671_0222166 Ga0495671_0222166_236_766 133
678 3300046810 Ga0495660_0004700 Ga0495660_0004700_1949_2479 133
679 3300053083 Ga0495655_0108319 Ga0495655_0108319_74_604 133
680 3300053086 Ga0500578_0228446 Ga0500578_0228446_543_1073 133
681 3300053158 Ga0500627_0040435 Ga0500627_0040435_1338_1868 133
682 3300002773 JGI25152J39213_1002558 JGI25152J39213_10025583 134
683 3300003215 JGI25153J46596_10005206 JGI25153J46596_100052063 134
684 3300003790 Ga0055528_1006908 Ga0055528_10069085 134
685 3300003792 Ga0055540_1000109 Ga0055540_10001094 134
686 3300005445 Ga0070708_100050471 Ga0070708_1000504713 134
687 3300005937 Ga0081455_10376311 Ga0081455_103763112 134
688 3300006048 Ga0075363_100042125 Ga0075363_1000421252 134
689 3300006847 Ga0075431_100610314 Ga0075431_1006103142 134
690 3300006871 Ga0075434_100016837 Ga0075434_10001683710 134
691 3300007076 Ga0075435_100053272 Ga0075435_1000532725 134
692 3300009147 Ga0114129_10033328 Ga0114129_100333282 134
693 3300025245 Ga0207425_1001756 Ga0207425_10017563 134
694 3300025258 Ga0209129_1003537 Ga0209129_10035377 134
695 3300025273 Ga0209673_1001640 Ga0209673_100164016 134
696 3300025273 Ga0209673_1014858 Ga0209673_10148584 134
697 3300025294 Ga0209025_1010902 Ga0209025_10109025 134
698 3300025295 Ga0209564_1042434 Ga0209564_10424342 134
699 3300025297 Ga0209758_1003828 Ga0209758_100382812 134
700 3300025303 Ga0209051_1000224 Ga0209051_10002244 134
701 3300025304 Ga0209257_1001240 Ga0209257_100124031 134
702 3300028794 Ga0307515_10082850 Ga0307515_100828502 134
703 3300031548 Ga0307408_100093545 Ga0307408_1000935452 134
704 3300031731 Ga0307405_10041549 Ga0307405_100415493 134
705 3300031824 Ga0307413_10062107 Ga0307413_100621073 134
706 3300031852 Ga0307410_10123805 Ga0307410_101238052 134
707 3300031901 Ga0307406_10087127 Ga0307406_100871273 134
708 3300031903 Ga0307407_10054399 Ga0307407_100543993 134
709 3300031995 Ga0307409_100013850 Ga0307409_1000138504 134
710 3300032002 Ga0307416_100299444 Ga0307416_1002994443 134
711 3300032004 Ga0307414_10176596 Ga0307414_101765963 134
712 3300032004 Ga0307414_10402775 Ga0307414_104027752 134
713 3300032005 Ga0307411_10049782 Ga0307411_100497822 134
714 3300032126 Ga0307415_100085236 Ga0307415_1000852362 134
715 3300041406 Ga0439439_0079733 Ga0439439_0079733_94_624 134
716 3300041413 Ga0439465_0050271 Ga0439465_0050271_209_739 134
717 3300041413 Ga0439465_0217877 Ga0439465_0217877_11_541 134
718 3300041441 Ga0451787_476991 Ga0451787_476991_106_636 134
719 3300041494 Ga0451837_1803467 Ga0451837_1803467_530_1060 134
720 3300041496 Ga0451839_0288950 Ga0451839_0288950_110_640 134
721 3300041498 Ga0451841_0107823 Ga0451841_0107823_359_889 134
722 3300041501 Ga0451845_0557307 Ga0451845_0557307_110_640 134
723 3300041503 Ga0451847_0009481 Ga0451847_0009481_323_853 134
724 3300041512 Ga0451853_1978418 Ga0451853_1978418_128_658 134
725 3300042007 Ga0439449_0034371 Ga0439449_0034371_918_1448 134
726 3300044901 Ga0466960_0054234 Ga0466960_0054234_60_590 134
727 3300046501 Ga0495607_0144386 Ga0495607_0144386_252_782 134
728 3300046507 Ga0495606_0011221 Ga0495606_0011221_5664_6194 134
729 3300046515 Ga0495620_0160237 Ga0495620_0160237_260_790 134
730 3300046522 Ga0495643_0016673 Ga0495643_0016673_2845_3375 134
731 3300049569 Ga0501032_0070391 Ga0501032_0070391_1363_1893 134
732 3300049571 Ga0501034_0092734 Ga0501034_0092734_2341_2871 134
733 3300049579 Ga0501043_0175928 Ga0501043_0175928_298_828 134
734 3300049581 Ga0501047_0114963 Ga0501047_0114963_1118_1669 134
735 3300049583 Ga0501067_0077292 Ga0501067_0077292_1119_1649 134
736 3300049742 Ga0501080_0782973 Ga0501080_0782973_53_583 134
737 3300049744 Ga0501083_0124571 Ga0501083_0124571_978_1508 134
738 3300049822 Ga0501035_0671566 Ga0501035_0671566_29_559 134
739 3300050493 nmdc:mga0k408_677368_c1 nmdc:mga0k408_677368_c1_65_595 134
740 3300050496 nmdc:mga07m45_187668_c1 nmdc:mga07m45_187668_c1_169_699 134
741 3300050507 nmdc:mga05p37_24117_c1 nmdc:mga05p37_24117_c1_6574_7104 134
742 3300050512 nmdc:mga0n895_119455_c1 nmdc:mga0n895_119455_c1_1231_1761 134
743 3300050513 nmdc:mga0rr50_208314_c1 nmdc:mga0rr50_208314_c1_278_808 134
744 3300050515 nmdc:mga0a205_97554_c1 nmdc:mga0a205_97554_c1_2022_2552 134
745 3300053134 Ga0500658_0000945 Ga0500658_0000945_11145_11675 134
746 3300053153 Ga0500616_0024755 Ga0500616_0024755_1197_1727 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

86

121

0.96

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

69

103

0.96

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

104

131

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qrl-assembly1.cif.gz_A a closer look at the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila 0.9143 10 91
7o4z-assembly1.cif.gz_A crystal structure of the carbonic anhydrase-like domain of ccmm from synechococcus elongatus (strain pcc 7942) 0.9115 11 91
4n27-assembly1.cif.gz_C x-ray structure of brucella abortus rica 0.8944 1 133
3kwd-assembly1.cif.gz_A inactive truncation of the beta-carboxysomal gamma-carbonic anhydrase, ccmm, form 1 0.8892 9 91
2fko-assembly1.cif.gz_A structure of ph1591 from pyrococcus horikoshii ot3 0.8889 1 133
ID Description Score Start End Superfamily
1qrfA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9111 10 91 2.160.10.10
4n27D00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8933 1 133 2.160.10.10
3kweA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8893 9 91 2.160.10.10
af_Q58501_210_397_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8866 2 89 2.160.10.10
1v67A00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8838 3 133 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A7C2XLM4-F1-model_v4 Gamma carbonic anhydrase family protein 0.9957 18 90
AF-A0A7W0XHL9-F1-model_v4 Gamma carbonic anhydrase family protein 0.9953 3 90
AF-A0A661AH03-F1-model_v4 Gamma carbonic anhydrase family protein 0.9947 19 90
AF-A0A7V9H4Y8-F1-model_v4 Gamma carbonic anhydrase family protein 0.9902 3 90
AF-A0A3M1VMG6-F1-model_v4 deleted 0.9902 9 90

Feature Viewer

pLDDT pTM Quality
90.61 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map