F478647
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 269 | 742 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300035241|Ga0373961_0072285|Ga0373961_0072285_159_1049 |
| Length | 296 |
| Sequence | MGAEALASSSMNTILSAAEARGTEAQGNRMASTSASMEMNVEQPQEADGQFIRVIVADTQAIFRAGLRKIFALEDDIRVVGQSESLSQTLSAAKKFSADILIFEAALTQNPVDAISDLMRQTPGLRLVVVTQEPNQELTLELLRRGVHGIVSRDVEPELLVECLRKVSEGHPWLDSRGTQWVLEAYRTQGSRPTSPRPKVQLTPKESLIVSCVTQGMKNKEIALRVGTTEQVVKNYLRKVYDKLGVADRLELALFCLHNRVLDSNLKTPSAPVPSSGNGSAPDLAPASTETVTKPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 127 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 128 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.65 |
| Metatranscriptomes | 1.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.14 |
| Rhizosphere | 92.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_9625197 | 2162886012 | Bacteria | 2139 |
| 2 | LJNas_1000808 | 3300000546 | Bacteria | 5203 |
| 3 | JGI24738J21930_10017364 | 3300002075 | Bacteria | 1513 |
| 4 | JGI24749J21850_1008375 | 3300002076 | Unclassified | 1441 |
| 5 | JGI24034J26672_10004616 | 3300002239 | Unclassified | 1957 |
| 6 | JGI24751J29686_10008402 | 3300002459 | Bacteria | 2112 |
| 7 | rootH1_10349975 | 3300003323 | Unclassified | 1978 |
| 8 | Ga0058862_12671333 | 3300004803 | Bacteria | 2139 |
| 9 | Ga0065712_10012754 | 3300005290 | Bacteria | 2787 |
| 10 | Ga0065715_10110383 | 3300005293 | Bacteria | 2623 |
| 11 | Ga0065715_10115978 | 3300005293 | Bacteria | 2396 |
| 12 | Ga0070658_10100531 | 3300005327 | Bacteria | 2390 |
| 13 | Ga0070658_10222701 | 3300005327 | Unclassified | 1596 |
| 14 | Ga0070676_10086462 | 3300005328 | Unclassified | 1912 |
| 15 | Ga0070683_100079235 | 3300005329 | Bacteria | 3074 |
| 16 | Ga0070683_100092640 | 3300005329 | Bacteria | 2838 |
| 17 | Ga0070683_100360942 | 3300005329 | Bacteria | 1383 |
| 18 | Ga0070690_100005450 | 3300005330 | Bacteria | 7148 |
| 19 | Ga0070690_100183060 | 3300005330 | Bacteria | 1448 |
| 20 | Ga0070670_100140082 | 3300005331 | Bacteria | 2092 |
| 21 | Ga0070670_100140689 | 3300005331 | Bacteria | 2086 |
| 22 | Ga0070677_10006921 | 3300005333 | Bacteria | 3768 |
| 23 | Ga0068869_100005013 | 3300005334 | Bacteria | 8292 |
| 24 | Ga0068869_100028015 | 3300005334 | Bacteria | 3932 |
| 25 | Ga0068869_100101226 | 3300005334 | Bacteria | 2179 |
| 26 | Ga0070666_10042107 | 3300005335 | Bacteria | 3054 |
| 27 | Ga0070666_10045866 | 3300005335 | Bacteria | 2930 |
| 28 | Ga0070666_10054652 | 3300005335 | Bacteria | 2694 |
| 29 | Ga0070680_100101665 | 3300005336 | Bacteria | 2386 |
| 30 | Ga0070682_100002630 | 3300005337 | Bacteria | 9925 |
| 31 | Ga0070682_100189805 | 3300005337 | Unclassified | 1442 |
| 32 | Ga0068868_100047171 | 3300005338 | Bacteria | 3374 |
| 33 | Ga0068868_100084460 | 3300005338 | Bacteria | 2550 |
| 34 | Ga0068868_100128111 | 3300005338 | Bacteria | 2075 |
| 35 | Ga0068868_100145488 | 3300005338 | Bacteria | 1948 |
| 36 | Ga0068868_100219676 | 3300005338 | Bacteria | 1590 |
| 37 | Ga0070660_100039184 | 3300005339 | Bacteria | 3601 |
| 38 | Ga0070660_100131685 | 3300005339 | Bacteria | 2001 |
| 39 | Ga0070689_100040587 | 3300005340 | Unclassified | 3569 |
| 40 | Ga0070691_10272379 | 3300005341 | Unclassified | 915 |
| 41 | Ga0070687_100003791 | 3300005343 | Bacteria | 5929 |
| 42 | Ga0070687_100139984 | 3300005343 | Bacteria | 1408 |
| 43 | Ga0070661_100124528 | 3300005344 | Bacteria | 1933 |
| 44 | Ga0070692_10358368 | 3300005345 | Unclassified | 908 |
| 45 | Ga0070668_100005248 | 3300005347 | Bacteria | 9613 |
| 46 | Ga0070669_100066648 | 3300005353 | Bacteria | 2654 |
| 47 | Ga0070669_100071985 | 3300005353 | Bacteria | 2559 |
| 48 | Ga0070675_100017919 | 3300005354 | Bacteria | 5633 |
| 49 | Ga0070671_100086528 | 3300005355 | Bacteria | 2622 |
| 50 | Ga0070674_100069317 | 3300005356 | Bacteria | 2487 |
| 51 | Ga0070673_100069199 | 3300005364 | Bacteria | 2828 |
| 52 | Ga0070688_100071053 | 3300005365 | Bacteria | 2227 |
| 53 | Ga0070659_100068692 | 3300005366 | Bacteria | 2811 |
| 54 | Ga0070659_100097351 | 3300005366 | Bacteria | 2364 |
| 55 | Ga0070667_100045357 | 3300005367 | Bacteria | 3695 |
| 56 | Ga0070667_100072289 | 3300005367 | Bacteria | 2939 |
| 57 | Ga0070667_100152871 | 3300005367 | Unclassified | 2028 |
| 58 | Ga0070709_10000342 | 3300005434 | Bacteria | 29015 |
| 59 | Ga0070709_10004147 | 3300005434 | Bacteria | 7819 |
| 60 | Ga0070709_10008424 | 3300005434 | Bacteria | 5666 |
| 61 | Ga0070709_10028860 | 3300005434 | Unclassified | 3312 |
| 62 | Ga0070709_10121752 | 3300005434 | Bacteria | 1769 |
| 63 | Ga0070709_10166165 | 3300005434 | Unclassified | 1538 |
| 64 | Ga0070709_10169412 | 3300005434 | Bacteria | 1525 |
| 65 | Ga0070709_10174044 | 3300005434 | Bacteria | 1506 |
| 66 | Ga0070709_10230519 | 3300005434 | Bacteria | 1325 |
| 67 | Ga0070709_10412151 | 3300005434 | Bacteria | 1011 |
| 68 | Ga0070709_10501164 | 3300005434 | Unclassified | 922 |
| 69 | Ga0070714_100076929 | 3300005435 | Bacteria | 2898 |
| 70 | Ga0070714_100093450 | 3300005435 | Bacteria | 2637 |
| 71 | Ga0070714_100102883 | 3300005435 | Bacteria | 2519 |
| 72 | Ga0070714_100104432 | 3300005435 | Bacteria | 2500 |
| 73 | Ga0070714_100139733 | 3300005435 | Bacteria | 2172 |
| 74 | Ga0070714_100143587 | 3300005435 | Bacteria | 2145 |
| 75 | Ga0070714_100161464 | 3300005435 | Unclassified | 2028 |
| 76 | Ga0070714_100251381 | 3300005435 | Bacteria | 1634 |
| 77 | Ga0070714_100428047 | 3300005435 | Bacteria | 1255 |
| 78 | Ga0070713_100000349 | 3300005436 | Bacteria | 30061 |
| 79 | Ga0070713_100000464 | 3300005436 | Bacteria | 25883 |
| 80 | Ga0070713_100006167 | 3300005436 | Bacteria | 8286 |
| 81 | Ga0070713_100007744 | 3300005436 | Bacteria | 7563 |
| 82 | Ga0070713_100114870 | 3300005436 | Bacteria | 2352 |
| 83 | Ga0070713_100132471 | 3300005436 | Bacteria | 2200 |
| 84 | Ga0070713_100183271 | 3300005436 | Bacteria | 1882 |
| 85 | Ga0070713_100247965 | 3300005436 | Bacteria | 1623 |
| 86 | Ga0070713_100248899 | 3300005436 | Bacteria | 1620 |
| 87 | Ga0070713_100252971 | 3300005436 | Bacteria | 1608 |
| 88 | Ga0070713_100358377 | 3300005436 | Bacteria | 1354 |
| 89 | Ga0070713_100438125 | 3300005436 | Bacteria | 1225 |
| 90 | Ga0070710_10014713 | 3300005437 | Bacteria | 3942 |
| 91 | Ga0070710_10030400 | 3300005437 | Bacteria | 2905 |
| 92 | Ga0070710_10039878 | 3300005437 | Bacteria | 2585 |
| 93 | Ga0070710_10041368 | 3300005437 | Bacteria | 2545 |
| 94 | Ga0070710_10064638 | 3300005437 | Bacteria | 2093 |
| 95 | Ga0070710_10094328 | 3300005437 | Bacteria | 1770 |
| 96 | Ga0070711_100006200 | 3300005439 | Bacteria | 7192 |
| 97 | Ga0070711_100026283 | 3300005439 | Bacteria | 3814 |
| 98 | Ga0070711_100146958 | 3300005439 | Unclassified | 1774 |
| 99 | Ga0070711_100378128 | 3300005439 | Bacteria | 1144 |
| 100 | Ga0070711_100412841 | 3300005439 | Bacteria | 1098 |
| 101 | Ga0070700_100419361 | 3300005441 | Unclassified | 1011 |
| 102 | Ga0070694_100410831 | 3300005444 | Bacteria | 1062 |
| 103 | Ga0070708_100001971 | 3300005445 | Bacteria | 15827 |
| 104 | Ga0070708_100002311 | 3300005445 | Bacteria | 14761 |
| 105 | Ga0070708_100026409 | 3300005445 | Bacteria | 4970 |
| 106 | Ga0070708_100034096 | 3300005445 | Bacteria | 4427 |
| 107 | Ga0070708_100034268 | 3300005445 | Bacteria | 4416 |
| 108 | Ga0070708_100071788 | 3300005445 | Bacteria | 3117 |
| 109 | Ga0070708_100156735 | 3300005445 | Bacteria | 2120 |
| 110 | Ga0070708_100213945 | 3300005445 | Bacteria | 1806 |
| 111 | Ga0070708_100253501 | 3300005445 | Bacteria | 1653 |
| 112 | Ga0070708_100496587 | 3300005445 | Unclassified | 1151 |
| 113 | Ga0070708_100554934 | 3300005445 | Bacteria | 1083 |
| 114 | Ga0070663_100011290 | 3300005455 | Bacteria | 5600 |
| 115 | Ga0070678_100107019 | 3300005456 | Bacteria | 2180 |
| 116 | Ga0070678_100409109 | 3300005456 | Unclassified | 1180 |
| 117 | Ga0070662_100028429 | 3300005457 | Bacteria | 3890 |
| 118 | Ga0070662_100067835 | 3300005457 | Bacteria | 2620 |
| 119 | Ga0070681_10029824 | 3300005458 | Bacteria | 5475 |
| 120 | Ga0070681_10340082 | 3300005458 | Unclassified | 1411 |
| 121 | Ga0070681_10371698 | 3300005458 | Unclassified | 1340 |
| 122 | Ga0070681_10444857 | 3300005458 | Unclassified | 1208 |
| 123 | Ga0068867_100004171 | 3300005459 | Bacteria | 10169 |
| 124 | Ga0068867_100200660 | 3300005459 | Bacteria | 1597 |
| 125 | Ga0070685_10019163 | 3300005466 | Bacteria | 3689 |
| 126 | Ga0070706_100000173 | 3300005467 | Bacteria | 81500 |
| 127 | Ga0070706_100001330 | 3300005467 | Bacteria | 26281 |
| 128 | Ga0070706_100006446 | 3300005467 | Bacteria | 11078 |
| 129 | Ga0070706_100018145 | 3300005467 | Bacteria | 6491 |
| 130 | Ga0070706_100279323 | 3300005467 | Bacteria | 1558 |
| 131 | Ga0070706_100350143 | 3300005467 | Bacteria | 1377 |
| 132 | Ga0070706_100412696 | 3300005467 | Bacteria | 1257 |
| 133 | Ga0070706_100509317 | 3300005467 | Bacteria | 1120 |
| 134 | Ga0070707_100009403 | 3300005468 | Bacteria | 9072 |
| 135 | Ga0070707_100009720 | 3300005468 | Bacteria | 8938 |
| 136 | Ga0070707_100072582 | 3300005468 | Bacteria | 3317 |
| 137 | Ga0070707_100147384 | 3300005468 | Bacteria | 2291 |
| 138 | Ga0070707_100229201 | 3300005468 | Unclassified | 1809 |
| 139 | Ga0070707_100247308 | 3300005468 | Bacteria | 1735 |
| 140 | Ga0070698_100002711 | 3300005471 | Bacteria | 19475 |
| 141 | Ga0070698_100009217 | 3300005471 | Bacteria | 10592 |
| 142 | Ga0070698_100070545 | 3300005471 | Unclassified | 3506 |
| 143 | Ga0070698_100085199 | 3300005471 | Unclassified | 3147 |
| 144 | Ga0070698_100282882 | 3300005471 | Bacteria | 1590 |
| 145 | Ga0070699_100004975 | 3300005518 | Bacteria | 11715 |
| 146 | Ga0070699_100025429 | 3300005518 | Bacteria | 5103 |
| 147 | Ga0070699_100048432 | 3300005518 | Bacteria | 3678 |
| 148 | Ga0070699_100136793 | 3300005518 | Bacteria | 2161 |
| 149 | Ga0070679_100043848 | 3300005530 | Bacteria | 4454 |
| 150 | Ga0070679_100158480 | 3300005530 | Bacteria | 2238 |
| 151 | Ga0070679_100265840 | 3300005530 | Unclassified | 1670 |
| 152 | Ga0070679_100565861 | 3300005530 | Unclassified | 1080 |
| 153 | Ga0070684_100041470 | 3300005535 | Bacteria | 3968 |
| 154 | Ga0070684_100060175 | 3300005535 | Bacteria | 3321 |
| 155 | Ga0070684_100080931 | 3300005535 | Bacteria | 2874 |
| 156 | Ga0070697_100000015 | 3300005536 | Bacteria | 143397 |
| 157 | Ga0070697_100000389 | 3300005536 | Bacteria | 34237 |
| 158 | Ga0070697_100001978 | 3300005536 | Bacteria | 15681 |
| 159 | Ga0070697_100013157 | 3300005536 | Bacteria | 6488 |
| 160 | Ga0070697_100015949 | 3300005536 | Bacteria | 5905 |
| 161 | Ga0070697_100120348 | 3300005536 | Bacteria | 2195 |
| 162 | Ga0070697_100142468 | 3300005536 | Bacteria | 2016 |
| 163 | Ga0068853_100088646 | 3300005539 | Bacteria | 2716 |
| 164 | Ga0068853_100119350 | 3300005539 | Bacteria | 2350 |
| 165 | Ga0070672_100007893 | 3300005543 | Bacteria | 7266 |
| 166 | Ga0070686_100007812 | 3300005544 | Bacteria | 5978 |
| 167 | Ga0070686_100124596 | 3300005544 | Bacteria | 1773 |
| 168 | Ga0070695_100097819 | 3300005545 | Unclassified | 1971 |
| 169 | Ga0070695_100135571 | 3300005545 | Bacteria | 1701 |
| 170 | Ga0070696_100184200 | 3300005546 | Bacteria | 1550 |
| 171 | Ga0070693_100019577 | 3300005547 | Bacteria | 3551 |
| 172 | Ga0070693_100120149 | 3300005547 | Bacteria | 1628 |
| 173 | Ga0070665_100042008 | 3300005548 | Bacteria | 4596 |
| 174 | Ga0068855_100002122 | 3300005563 | Bacteria | 24539 |
| 175 | Ga0068855_100141018 | 3300005563 | Bacteria | 2747 |
| 176 | Ga0068855_100167179 | 3300005563 | Bacteria | 2492 |
| 177 | Ga0070664_100042196 | 3300005564 | Bacteria | 3851 |
| 178 | Ga0070664_100401155 | 3300005564 | Bacteria | 1254 |
| 179 | Ga0068857_100179694 | 3300005577 | Bacteria | 1925 |
| 180 | Ga0068857_100298295 | 3300005577 | Unclassified | 1485 |
| 181 | Ga0068857_100324320 | 3300005577 | Bacteria | 1423 |
| 182 | Ga0068854_100002075 | 3300005578 | Bacteria | 12287 |
| 183 | Ga0068854_100167452 | 3300005578 | Bacteria | 1707 |
| 184 | Ga0068856_100004490 | 3300005614 | Bacteria | 13876 |
| 185 | Ga0068856_100080672 | 3300005614 | Bacteria | 3227 |
| 186 | Ga0068856_100173176 | 3300005614 | Bacteria | 2170 |
| 187 | Ga0068856_100346291 | 3300005614 | Bacteria | 1505 |
| 188 | Ga0068856_100647396 | 3300005614 | Bacteria | 1077 |
| 189 | Ga0070702_100026990 | 3300005615 | Bacteria | 3093 |
| 190 | Ga0068852_100004761 | 3300005616 | Bacteria | 9638 |
| 191 | Ga0068859_100018009 | 3300005617 | Bacteria | 7097 |
| 192 | Ga0068859_100023995 | 3300005617 | Bacteria | 6121 |
| 193 | Ga0068859_100133591 | 3300005617 | Bacteria | 2553 |
| 194 | Ga0068864_100272688 | 3300005618 | Unclassified | 1577 |
| 195 | Ga0068866_10011374 | 3300005718 | Bacteria | 3848 |
| 196 | Ga0068866_10025164 | 3300005718 | Bacteria | 2795 |
| 197 | Ga0068861_100290149 | 3300005719 | Unclassified | 1412 |
| 198 | Ga0068851_10008550 | 3300005834 | Bacteria | 4736 |
| 199 | Ga0068851_10028964 | 3300005834 | Bacteria | 2738 |
| 200 | Ga0068851_10094637 | 3300005834 | Bacteria | 1577 |
| 201 | Ga0068870_10015319 | 3300005840 | Bacteria | 3635 |
| 202 | Ga0068870_10050699 | 3300005840 | Bacteria | 2194 |
| 203 | Ga0068863_100083550 | 3300005841 | Bacteria | 3026 |
| 204 | Ga0068863_100254109 | 3300005841 | Bacteria | 1698 |
| 205 | Ga0068863_100392889 | 3300005841 | Bacteria | 1355 |
| 206 | Ga0068863_100513782 | 3300005841 | Bacteria | 1180 |
| 207 | Ga0068858_100003905 | 3300005842 | Bacteria | 14724 |
| 208 | Ga0068858_100029444 | 3300005842 | Bacteria | 5099 |
| 209 | Ga0068858_100320880 | 3300005842 | Unclassified | 1480 |
| 210 | Ga0068860_100011552 | 3300005843 | Bacteria | 8705 |
| 211 | Ga0068860_100054724 | 3300005843 | Bacteria | 3793 |
| 212 | Ga0068860_100123140 | 3300005843 | Bacteria | 2484 |
| 213 | Ga0068860_100153069 | 3300005843 | Bacteria | 2221 |
| 214 | Ga0068862_100008948 | 3300005844 | Bacteria | 8288 |
| 215 | Ga0068862_100096372 | 3300005844 | Bacteria | 2582 |
| 216 | Ga0068862_100160178 | 3300005844 | Bacteria | 2008 |
| 217 | Ga0068862_100184422 | 3300005844 | Bacteria | 1874 |
| 218 | Ga0081540_1021791 | 3300005983 | Bacteria | 3801 |
| 219 | Ga0070717_10001227 | 3300006028 | Bacteria | 17447 |
| 220 | Ga0070717_10005049 | 3300006028 | Bacteria | 9615 |
| 221 | Ga0070717_10006280 | 3300006028 | Bacteria | 8727 |
| 222 | Ga0070717_10006485 | 3300006028 | Bacteria | 8613 |
| 223 | Ga0070717_10012322 | 3300006028 | Bacteria | 6517 |
| 224 | Ga0070717_10053353 | 3300006028 | Bacteria | 3332 |
| 225 | Ga0070717_10085391 | 3300006028 | Unclassified | 2656 |
| 226 | Ga0070717_10104044 | 3300006028 | Bacteria | 2414 |
| 227 | Ga0070717_10256469 | 3300006028 | Bacteria | 1546 |
| 228 | Ga0070717_10305121 | 3300006028 | Bacteria | 1416 |
| 229 | Ga0070715_10013537 | 3300006163 | Bacteria | 2999 |
| 230 | Ga0070715_10017279 | 3300006163 | Bacteria | 2728 |
| 231 | Ga0070716_100010654 | 3300006173 | Bacteria | 4615 |
| 232 | Ga0070716_100059240 | 3300006173 | Bacteria | 2207 |
| 233 | Ga0070716_100066983 | 3300006173 | Bacteria | 2096 |
| 234 | Ga0070712_100000586 | 3300006175 | Bacteria | 21238 |
| 235 | Ga0070712_100003006 | 3300006175 | Bacteria | 10438 |
| 236 | Ga0070712_100044643 | 3300006175 | Bacteria | 3056 |
| 237 | Ga0070712_100053544 | 3300006175 | Bacteria | 2817 |
| 238 | Ga0070712_100147640 | 3300006175 | Bacteria | 1801 |
| 239 | Ga0070712_100150346 | 3300006175 | Bacteria | 1787 |
| 240 | Ga0070712_100175505 | 3300006175 | Bacteria | 1666 |
| 241 | Ga0070712_100479294 | 3300006175 | Bacteria | 1040 |
| 242 | Ga0097621_100005633 | 3300006237 | Bacteria | 8832 |
| 243 | Ga0097621_100081412 | 3300006237 | Bacteria | 2694 |
| 244 | Ga0097621_100258017 | 3300006237 | Bacteria | 1528 |
| 245 | Ga0097621_100367147 | 3300006237 | Bacteria | 1283 |
| 246 | Ga0068871_100002915 | 3300006358 | Bacteria | 11730 |
| 247 | Ga0068871_100010394 | 3300006358 | Bacteria | 6791 |
| 248 | Ga0068871_100309947 | 3300006358 | Unclassified | 1387 |
| 249 | Ga0075433_10018081 | 3300006852 | Bacteria | 5852 |
| 250 | Ga0075433_10020953 | 3300006852 | Bacteria | 5475 |
| 251 | Ga0075434_100000976 | 3300006871 | Bacteria | 23086 |
| 252 | Ga0075434_100006334 | 3300006871 | Bacteria | 10850 |
| 253 | Ga0075434_100263702 | 3300006871 | Unclassified | 1742 |
| 254 | Ga0068865_100065979 | 3300006881 | Bacteria | 2552 |
| 255 | Ga0068865_100068595 | 3300006881 | Bacteria | 2507 |
| 256 | Ga0068865_100124149 | 3300006881 | Bacteria | 1924 |
| 257 | Ga0075436_100001061 | 3300006914 | Bacteria | 18523 |
| 258 | Ga0075436_100033643 | 3300006914 | Bacteria | 3533 |
| 259 | Ga0075436_100083203 | 3300006914 | Bacteria | 2220 |
| 260 | Ga0097620_100018009 | 3300006931 | Bacteria | 7097 |
| 261 | Ga0097620_100023993 | 3300006931 | Bacteria | 6121 |
| 262 | Ga0097620_100133597 | 3300006931 | Bacteria | 2553 |
| 263 | Ga0075435_100001744 | 3300007076 | Bacteria | 14157 |
| 264 | Ga0075435_100116605 | 3300007076 | Bacteria | 2225 |
| 265 | Ga0075435_100218125 | 3300007076 | Bacteria | 1619 |
| 266 | Ga0075435_100415531 | 3300007076 | Bacteria | 1158 |
| 267 | Ga0105250_10044260 | 3300009092 | Bacteria | 1785 |
| 268 | Ga0105240_10032276 | 3300009093 | Bacteria | 6782 |
| 269 | Ga0105240_10033712 | 3300009093 | Bacteria | 6612 |
| 270 | Ga0105240_10034130 | 3300009093 | Bacteria | 6566 |
| 271 | Ga0105240_10166863 | 3300009093 | Bacteria | 2611 |
| 272 | Ga0105240_10253790 | 3300009093 | Bacteria | 2032 |
| 273 | Ga0105240_10296530 | 3300009093 | Bacteria | 1851 |
| 274 | Ga0105240_10461851 | 3300009093 | Bacteria | 1419 |
| 275 | Ga0105245_10011889 | 3300009098 | Bacteria | 7569 |
| 276 | Ga0105245_10017602 | 3300009098 | Bacteria | 6238 |
| 277 | Ga0105245_10039167 | 3300009098 | Bacteria | 4218 |
| 278 | Ga0105245_10136625 | 3300009098 | Bacteria | 2305 |
| 279 | Ga0105245_10194558 | 3300009098 | Bacteria | 1944 |
| 280 | Ga0105247_10022118 | 3300009101 | Bacteria | 3828 |
| 281 | Ga0105247_10025982 | 3300009101 | Bacteria | 3535 |
| 282 | Ga0105247_10040642 | 3300009101 | Bacteria | 2843 |
| 283 | Ga0105247_10222384 | 3300009101 | Viruses | 1278 |
| 284 | Ga0105247_10262041 | 3300009101 | Bacteria | 1186 |
| 285 | Ga0105247_10278239 | 3300009101 | Bacteria | 1154 |
| 286 | Ga0114129_10271973 | 3300009147 | Unclassified | 2266 |
| 287 | Ga0105241_10010779 | 3300009174 | Bacteria | 6706 |
| 288 | Ga0105241_10059045 | 3300009174 | Bacteria | 2948 |
| 289 | Ga0105241_10089749 | 3300009174 | Bacteria | 2422 |
| 290 | Ga0105242_10027658 | 3300009176 | Bacteria | 4507 |
| 291 | Ga0105242_10140130 | 3300009176 | Bacteria | 2098 |
| 292 | Ga0105242_10222624 | 3300009176 | Bacteria | 1687 |
| 293 | Ga0105248_10017692 | 3300009177 | Bacteria | 7861 |
| 294 | Ga0105248_10247172 | 3300009177 | Bacteria | 2008 |
| 295 | Ga0105248_10282060 | 3300009177 | Unclassified | 1870 |
| 296 | Ga0105248_10435967 | 3300009177 | Unclassified | 1476 |
| 297 | Ga0105237_10032309 | 3300009545 | Bacteria | 5299 |
| 298 | Ga0105237_10042776 | 3300009545 | Bacteria | 4566 |
| 299 | Ga0105237_10166196 | 3300009545 | Bacteria | 2205 |
| 300 | Ga0105237_10168145 | 3300009545 | Bacteria | 2192 |
| 301 | Ga0105237_10218829 | 3300009545 | Bacteria | 1904 |
| 302 | Ga0105238_10000570 | 3300009551 | Bacteria | 38677 |
| 303 | Ga0105238_10119189 | 3300009551 | Bacteria | 2619 |
| 304 | Ga0105238_10325517 | 3300009551 | Bacteria | 1523 |
| 305 | Ga0105238_10790659 | 3300009551 | Unclassified | 964 |
| 306 | Ga0105249_10009980 | 3300009553 | Bacteria | 8328 |
| 307 | Ga0105249_10037822 | 3300009553 | Bacteria | 4379 |
| 308 | Ga0105239_10006742 | 3300010375 | Bacteria | 13265 |
| 309 | Ga0105239_10032973 | 3300010375 | Bacteria | 5690 |
| 310 | Ga0105239_10047821 | 3300010375 | Bacteria | 4689 |
| 311 | Ga0105239_10090842 | 3300010375 | Bacteria | 3369 |
| 312 | Ga0105246_10121128 | 3300011119 | Bacteria | 1939 |
| 313 | Ga0157373_10062503 | 3300013100 | Bacteria | 2637 |
| 314 | Ga0157371_10021750 | 3300013102 | Bacteria | 4705 |
| 315 | Ga0157371_10049540 | 3300013102 | Bacteria | 2984 |
| 316 | Ga0157370_10162084 | 3300013104 | Bacteria | 2080 |
| 317 | Ga0157369_10000309 | 3300013105 | Bacteria | 65396 |
| 318 | Ga0157369_10031967 | 3300013105 | Bacteria | 5790 |
| 319 | Ga0157369_10050541 | 3300013105 | Bacteria | 4502 |
| 320 | Ga0157369_10074407 | 3300013105 | Bacteria | 3642 |
| 321 | Ga0157369_10183867 | 3300013105 | Bacteria | 2198 |
| 322 | Ga0157374_10001227 | 3300013296 | Bacteria | 21912 |
| 323 | Ga0157374_10002450 | 3300013296 | Bacteria | 15672 |
| 324 | Ga0157374_10062745 | 3300013296 | Bacteria | 3484 |
| 325 | Ga0157374_10077162 | 3300013296 | Bacteria | 3152 |
| 326 | Ga0157374_10129725 | 3300013296 | Bacteria | 2439 |
| 327 | Ga0157374_10157790 | 3300013296 | Bacteria | 2209 |
| 328 | Ga0157374_10168532 | 3300013296 | Unclassified | 2136 |
| 329 | Ga0157374_10181667 | 3300013296 | Bacteria | 2055 |
| 330 | Ga0157378_10003661 | 3300013297 | Bacteria | 13617 |
| 331 | Ga0157378_10012740 | 3300013297 | Bacteria | 7360 |
| 332 | Ga0157378_10080384 | 3300013297 | Bacteria | 2944 |
| 333 | Ga0157378_10082051 | 3300013297 | Bacteria | 2915 |
| 334 | Ga0157378_10143990 | 3300013297 | Bacteria | 2215 |
| 335 | Ga0157378_10230242 | 3300013297 | Bacteria | 1766 |
| 336 | Ga0163162_10001911 | 3300013306 | Bacteria | 19633 |
| 337 | Ga0163162_10031676 | 3300013306 | Bacteria | 5245 |
| 338 | Ga0163162_10069055 | 3300013306 | Bacteria | 3586 |
| 339 | Ga0163162_10144535 | 3300013306 | Bacteria | 2493 |
| 340 | Ga0163162_10394012 | 3300013306 | Bacteria | 1517 |
| 341 | Ga0157372_10000497 | 3300013307 | Bacteria | 43246 |
| 342 | Ga0157372_10004364 | 3300013307 | Bacteria | 15101 |
| 343 | Ga0157372_10012853 | 3300013307 | Bacteria | 8922 |
| 344 | Ga0157372_10050349 | 3300013307 | Bacteria | 4634 |
| 345 | Ga0157372_10108506 | 3300013307 | Bacteria | 3177 |
| 346 | Ga0157372_10164931 | 3300013307 | Bacteria | 2562 |
| 347 | Ga0157375_10191345 | 3300013308 | Bacteria | 2200 |
| 348 | Ga0157375_10351179 | 3300013308 | Bacteria | 1640 |
| 349 | Ga0157375_10694029 | 3300013308 | Bacteria | 1172 |
| 350 | Ga0163163_10020316 | 3300014325 | Bacteria | 6251 |
| 351 | Ga0163163_10034896 | 3300014325 | Bacteria | 4876 |
| 352 | Ga0163163_10077093 | 3300014325 | Bacteria | 3329 |
| 353 | Ga0163163_10232342 | 3300014325 | Bacteria | 1893 |
| 354 | Ga0157380_10083580 | 3300014326 | Bacteria | 2616 |
| 355 | Ga0182008_10054129 | 3300014497 | Bacteria | 1986 |
| 356 | Ga0157377_10017724 | 3300014745 | Bacteria | 3688 |
| 357 | Ga0157379_10004138 | 3300014968 | Bacteria | 12380 |
| 358 | Ga0157379_10080461 | 3300014968 | Bacteria | 2918 |
| 359 | Ga0157379_10125002 | 3300014968 | Bacteria | 2314 |
| 360 | Ga0157379_10146181 | 3300014968 | Bacteria | 2132 |
| 361 | Ga0157376_10038613 | 3300014969 | Bacteria | 3886 |
| 362 | Ga0157376_10110237 | 3300014969 | Bacteria | 2421 |
| 363 | Ga0157376_10157777 | 3300014969 | Bacteria | 2054 |
| 364 | Ga0157376_10410179 | 3300014969 | Bacteria | 1312 |
| 365 | Ga0157376_10873879 | 3300014969 | Unclassified | 916 |
| 366 | Ga0182005_1019017 | 3300015265 | Bacteria | 1896 |
| 367 | Ga0163161_10046137 | 3300017792 | Bacteria | 3143 |
| 368 | Ga0163161_10281715 | 3300017792 | Bacteria | 1304 |
| 369 | Ga0213874_10022180 | 3300021377 | Bacteria | 1759 |
| 370 | Ga0224569_102017 | 3300022732 | Bacteria | 1674 |
| 371 | Ga0224572_1007744 | 3300024225 | Bacteria | 1974 |
| 372 | Ga0228598_1003051 | 3300024227 | Bacteria | 3629 |
| 373 | Ga0228598_1004351 | 3300024227 | Bacteria | 2998 |
| 374 | Ga0228598_1005499 | 3300024227 | Bacteria | 2647 |
| 375 | Ga0228598_1008184 | 3300024227 | Bacteria | 2116 |
| 376 | Ga0207656_10015696 | 3300025321 | Bacteria | 2936 |
| 377 | Ga0207692_10007889 | 3300025898 | Bacteria | 4384 |
| 378 | Ga0207692_10015363 | 3300025898 | Bacteria | 3367 |
| 379 | Ga0207692_10022524 | 3300025898 | Bacteria | 2900 |
| 380 | Ga0207692_10039661 | 3300025898 | Bacteria | 2319 |
| 381 | Ga0207692_10060351 | 3300025898 | Unclassified | 1961 |
| 382 | Ga0207642_10049539 | 3300025899 | Bacteria | 1889 |
| 383 | Ga0207642_10125451 | 3300025899 | Bacteria | 1331 |
| 384 | Ga0207642_10171159 | 3300025899 | Bacteria | 1175 |
| 385 | Ga0207710_10026561 | 3300025900 | Bacteria | 2503 |
| 386 | Ga0207710_10054998 | 3300025900 | Bacteria | 1793 |
| 387 | Ga0207680_10031443 | 3300025903 | Bacteria | 3006 |
| 388 | Ga0207680_10198523 | 3300025903 | Bacteria | 1366 |
| 389 | Ga0207647_10000903 | 3300025904 | Bacteria | 22977 |
| 390 | Ga0207647_10010492 | 3300025904 | Bacteria | 6542 |
| 391 | Ga0207685_10013586 | 3300025905 | Bacteria | 2523 |
| 392 | Ga0207699_10003310 | 3300025906 | Bacteria | 7682 |
| 393 | Ga0207699_10006411 | 3300025906 | Bacteria | 5695 |
| 394 | Ga0207699_10014214 | 3300025906 | Bacteria | 4096 |
| 395 | Ga0207699_10019041 | 3300025906 | Bacteria | 3651 |
| 396 | Ga0207699_10062563 | 3300025906 | Bacteria | 2244 |
| 397 | Ga0207699_10167265 | 3300025906 | Bacteria | 1468 |
| 398 | Ga0207699_10187701 | 3300025906 | Bacteria | 1393 |
| 399 | Ga0207699_10212482 | 3300025906 | Bacteria | 1316 |
| 400 | Ga0207645_10035862 | 3300025907 | Bacteria | 3185 |
| 401 | Ga0207645_10057670 | 3300025907 | Bacteria | 2479 |
| 402 | Ga0207643_10004784 | 3300025908 | Bacteria | 7253 |
| 403 | Ga0207705_10149758 | 3300025909 | Unclassified | 1748 |
| 404 | Ga0207705_10239633 | 3300025909 | Bacteria | 1381 |
| 405 | Ga0207684_10000267 | 3300025910 | Bacteria | 77172 |
| 406 | Ga0207684_10001492 | 3300025910 | Bacteria | 25166 |
| 407 | Ga0207684_10016631 | 3300025910 | Bacteria | 6315 |
| 408 | Ga0207684_10022758 | 3300025910 | Bacteria | 5350 |
| 409 | Ga0207684_10057475 | 3300025910 | Bacteria | 3301 |
| 410 | Ga0207684_10107579 | 3300025910 | Unclassified | 2386 |
| 411 | Ga0207684_10212703 | 3300025910 | Bacteria | 1668 |
| 412 | Ga0207684_10216174 | 3300025910 | Bacteria | 1654 |
| 413 | Ga0207654_10113749 | 3300025911 | Bacteria | 1688 |
| 414 | Ga0207654_10374505 | 3300025911 | Bacteria | 985 |
| 415 | Ga0207707_10000878 | 3300025912 | Bacteria | 29399 |
| 416 | Ga0207707_10054116 | 3300025912 | Bacteria | 3494 |
| 417 | Ga0207707_10080808 | 3300025912 | Unclassified | 2838 |
| 418 | Ga0207707_10263706 | 3300025912 | Unclassified | 1494 |
| 419 | Ga0207695_10012611 | 3300025913 | Bacteria | 10128 |
| 420 | Ga0207695_10021580 | 3300025913 | Bacteria | 7344 |
| 421 | Ga0207695_10041995 | 3300025913 | Bacteria | 4889 |
| 422 | Ga0207695_10098609 | 3300025913 | Unclassified | 2921 |
| 423 | Ga0207695_10235230 | 3300025913 | Bacteria | 1735 |
| 424 | Ga0207671_10124011 | 3300025914 | Unclassified | 1977 |
| 425 | Ga0207671_10200641 | 3300025914 | Bacteria | 1558 |
| 426 | Ga0207693_10000142 | 3300025915 | Bacteria | 65780 |
| 427 | Ga0207693_10002184 | 3300025915 | Bacteria | 17057 |
| 428 | Ga0207693_10140916 | 3300025915 | Bacteria | 1896 |
| 429 | Ga0207693_10168345 | 3300025915 | Bacteria | 1725 |
| 430 | Ga0207693_10200397 | 3300025915 | Unclassified | 1570 |
| 431 | Ga0207693_10220546 | 3300025915 | Bacteria | 1490 |
| 432 | Ga0207693_10357030 | 3300025915 | Bacteria | 1143 |
| 433 | Ga0207663_10020803 | 3300025916 | Bacteria | 3723 |
| 434 | Ga0207663_10088829 | 3300025916 | Unclassified | 2045 |
| 435 | Ga0207663_10218874 | 3300025916 | Bacteria | 1384 |
| 436 | Ga0207662_10002927 | 3300025918 | Bacteria | 8666 |
| 437 | Ga0207657_10007959 | 3300025919 | Bacteria | 10809 |
| 438 | Ga0207657_10028691 | 3300025919 | Bacteria | 5072 |
| 439 | Ga0207657_10153539 | 3300025919 | Bacteria | 1874 |
| 440 | Ga0207649_10009110 | 3300025920 | Bacteria | 5427 |
| 441 | Ga0207652_10022743 | 3300025921 | Bacteria | 5190 |
| 442 | Ga0207652_10386872 | 3300025921 | Bacteria | 1262 |
| 443 | Ga0207646_10001228 | 3300025922 | Bacteria | 32199 |
| 444 | Ga0207646_10009914 | 3300025922 | Bacteria | 9370 |
| 445 | Ga0207646_10059625 | 3300025922 | Bacteria | 3408 |
| 446 | Ga0207646_10105166 | 3300025922 | Unclassified | 2531 |
| 447 | Ga0207646_10190908 | 3300025922 | Bacteria | 1850 |
| 448 | Ga0207646_10292427 | 3300025922 | Bacteria | 1472 |
| 449 | Ga0207646_10449438 | 3300025922 | Bacteria | 1163 |
| 450 | Ga0207681_10068171 | 3300025923 | Bacteria | 2470 |
| 451 | Ga0207681_10076561 | 3300025923 | Bacteria | 2349 |
| 452 | Ga0207694_10001825 | 3300025924 | Bacteria | 17733 |
| 453 | Ga0207694_10209105 | 3300025924 | Bacteria | 1589 |
| 454 | Ga0207650_10000442 | 3300025925 | Bacteria | 35606 |
| 455 | Ga0207659_10085844 | 3300025926 | Bacteria | 2339 |
| 456 | Ga0207687_10000653 | 3300025927 | Bacteria | 23344 |
| 457 | Ga0207687_10031084 | 3300025927 | Bacteria | 3607 |
| 458 | Ga0207687_10040180 | 3300025927 | Bacteria | 3205 |
| 459 | Ga0207687_10136622 | 3300025927 | Bacteria | 1855 |
| 460 | Ga0207700_10000200 | 3300025928 | Bacteria | 35788 |
| 461 | Ga0207700_10005255 | 3300025928 | Bacteria | 7717 |
| 462 | Ga0207700_10005553 | 3300025928 | Bacteria | 7567 |
| 463 | Ga0207700_10009464 | 3300025928 | Bacteria | 6089 |
| 464 | Ga0207700_10012034 | 3300025928 | Bacteria | 5556 |
| 465 | Ga0207700_10062156 | 3300025928 | Bacteria | 2836 |
| 466 | Ga0207700_10128012 | 3300025928 | Unclassified | 2069 |
| 467 | Ga0207700_10194733 | 3300025928 | Bacteria | 1705 |
| 468 | Ga0207700_10231339 | 3300025928 | Bacteria | 1572 |
| 469 | Ga0207700_10251319 | 3300025928 | Bacteria | 1510 |
| 470 | Ga0207664_10000033 | 3300025929 | Bacteria | 176549 |
| 471 | Ga0207664_10019718 | 3300025929 | Bacteria | 4990 |
| 472 | Ga0207664_10101560 | 3300025929 | Bacteria | 2377 |
| 473 | Ga0207664_10120028 | 3300025929 | Bacteria | 2199 |
| 474 | Ga0207664_10137666 | 3300025929 | Bacteria | 2062 |
| 475 | Ga0207664_10148802 | 3300025929 | Bacteria | 1988 |
| 476 | Ga0207664_10150295 | 3300025929 | Bacteria | 1978 |
| 477 | Ga0207664_10179778 | 3300025929 | Bacteria | 1815 |
| 478 | Ga0207644_10063031 | 3300025931 | Bacteria | 2690 |
| 479 | Ga0207690_10031811 | 3300025932 | Bacteria | 3380 |
| 480 | Ga0207690_10095894 | 3300025932 | Unclassified | 2108 |
| 481 | Ga0207706_10000102 | 3300025933 | Bacteria | 89878 |
| 482 | Ga0207706_10000651 | 3300025933 | Bacteria | 36655 |
| 483 | Ga0207706_10087946 | 3300025933 | Bacteria | 2732 |
| 484 | Ga0207686_10124688 | 3300025934 | Bacteria | 1758 |
| 485 | Ga0207686_10177896 | 3300025934 | Bacteria | 1506 |
| 486 | Ga0207670_10022758 | 3300025936 | Bacteria | 3889 |
| 487 | Ga0207669_10060309 | 3300025937 | Bacteria | 2325 |
| 488 | Ga0207704_10005477 | 3300025938 | Bacteria | 5852 |
| 489 | Ga0207665_10000313 | 3300025939 | Bacteria | 33592 |
| 490 | Ga0207665_10063717 | 3300025939 | Bacteria | 2504 |
| 491 | Ga0207665_10074992 | 3300025939 | Bacteria | 2316 |
| 492 | Ga0207665_10142770 | 3300025939 | Bacteria | 1709 |
| 493 | Ga0207665_10185846 | 3300025939 | Bacteria | 1507 |
| 494 | Ga0207665_10249084 | 3300025939 | Bacteria | 1312 |
| 495 | Ga0207665_10347106 | 3300025939 | Bacteria | 1120 |
| 496 | Ga0207691_10005111 | 3300025940 | Bacteria | 12662 |
| 497 | Ga0207711_10002678 | 3300025941 | Bacteria | 15751 |
| 498 | Ga0207711_10074835 | 3300025941 | Bacteria | 2946 |
| 499 | Ga0207689_10000788 | 3300025942 | Bacteria | 30435 |
| 500 | Ga0207689_10008927 | 3300025942 | Bacteria | 8691 |
| 501 | Ga0207689_10026073 | 3300025942 | Bacteria | 4894 |
| 502 | Ga0207689_10106656 | 3300025942 | Bacteria | 2302 |
| 503 | Ga0207661_10000213 | 3300025944 | Bacteria | 37493 |
| 504 | Ga0207661_10118293 | 3300025944 | Bacteria | 2252 |
| 505 | Ga0207679_10000080 | 3300025945 | Bacteria | 84997 |
| 506 | Ga0207679_10043673 | 3300025945 | Bacteria | 3229 |
| 507 | Ga0207679_10066596 | 3300025945 | Bacteria | 2699 |
| 508 | Ga0207667_10000708 | 3300025949 | Bacteria | 43198 |
| 509 | Ga0207667_10005798 | 3300025949 | Bacteria | 15067 |
| 510 | Ga0207667_10166549 | 3300025949 | Bacteria | 2266 |
| 511 | Ga0207651_10071799 | 3300025960 | Bacteria | 2455 |
| 512 | Ga0207668_10029002 | 3300025972 | Bacteria | 3624 |
| 513 | Ga0207640_10035589 | 3300025981 | Bacteria | 3117 |
| 514 | Ga0207640_10248866 | 3300025981 | Bacteria | 1378 |
| 515 | Ga0207640_10568507 | 3300025981 | Unclassified | 955 |
| 516 | Ga0207658_10046413 | 3300025986 | Bacteria | 3172 |
| 517 | Ga0207658_10165243 | 3300025986 | Bacteria | 1817 |
| 518 | Ga0207658_10313711 | 3300025986 | Unclassified | 1355 |
| 519 | Ga0207677_10004059 | 3300026023 | Bacteria | 7822 |
| 520 | Ga0207677_10009387 | 3300026023 | Bacteria | 5506 |
| 521 | Ga0207677_10014783 | 3300026023 | Bacteria | 4570 |
| 522 | Ga0207677_10014999 | 3300026023 | Bacteria | 4543 |
| 523 | Ga0207677_10031822 | 3300026023 | Bacteria | 3383 |
| 524 | Ga0207703_10005982 | 3300026035 | Bacteria | 9747 |
| 525 | Ga0207703_10057247 | 3300026035 | Bacteria | 3178 |
| 526 | Ga0207703_10165382 | 3300026035 | Bacteria | 1941 |
| 527 | Ga0207639_10181844 | 3300026041 | Bacteria | 1789 |
| 528 | Ga0207639_10192197 | 3300026041 | Bacteria | 1744 |
| 529 | Ga0207639_10205210 | 3300026041 | Unclassified | 1693 |
| 530 | Ga0207639_10255826 | 3300026041 | Bacteria | 1529 |
| 531 | Ga0207678_10005273 | 3300026067 | Bacteria | 11577 |
| 532 | Ga0207678_10024713 | 3300026067 | Bacteria | 5246 |
| 533 | Ga0207708_10447663 | 3300026075 | Bacteria | 1075 |
| 534 | Ga0207702_10000490 | 3300026078 | Bacteria | 44511 |
| 535 | Ga0207702_10149489 | 3300026078 | Bacteria | 2123 |
| 536 | Ga0207641_10000432 | 3300026088 | Bacteria | 48190 |
| 537 | Ga0207641_10029359 | 3300026088 | Bacteria | 4547 |
| 538 | Ga0207641_10149681 | 3300026088 | Bacteria | 2113 |
| 539 | Ga0207641_10248327 | 3300026088 | Bacteria | 1661 |
| 540 | Ga0207641_10271849 | 3300026088 | Bacteria | 1590 |
| 541 | Ga0207648_10001706 | 3300026089 | Bacteria | 24036 |
| 542 | Ga0207648_10016467 | 3300026089 | Bacteria | 6752 |
| 543 | Ga0207648_10103008 | 3300026089 | Bacteria | 2503 |
| 544 | Ga0207676_10000586 | 3300026095 | Bacteria | 29950 |
| 545 | Ga0207676_10166498 | 3300026095 | Unclassified | 1916 |
| 546 | Ga0207676_10572049 | 3300026095 | Unclassified | 1082 |
| 547 | Ga0207674_10001107 | 3300026116 | Bacteria | 35021 |
| 548 | Ga0207674_10002982 | 3300026116 | Bacteria | 20997 |
| 549 | Ga0207674_10010514 | 3300026116 | Bacteria | 10474 |
| 550 | Ga0207674_10133203 | 3300026116 | Bacteria | 2448 |
| 551 | Ga0207675_100093618 | 3300026118 | Bacteria | 2826 |
| 552 | Ga0207683_10004817 | 3300026121 | Bacteria | 11622 |
| 553 | Ga0207683_10165202 | 3300026121 | Bacteria | 2003 |
| 554 | Ga0207683_10226056 | 3300026121 | Unclassified | 1706 |
| 555 | Ga0265356_1000078 | 3300028017 | Bacteria | 16086 |
| 556 | Ga0265356_1002791 | 3300028017 | Bacteria | 2262 |
| 557 | Ga0265356_1005028 | 3300028017 | Bacteria | 1593 |
| 558 | Ga0268266_10122619 | 3300028379 | Bacteria | 2314 |
| 559 | Ga0268266_10613426 | 3300028379 | Bacteria | 1045 |
| 560 | Ga0268265_10006060 | 3300028380 | Bacteria | 8213 |
| 561 | Ga0268265_10531415 | 3300028380 | Bacteria | 1113 |
| 562 | Ga0268264_10051570 | 3300028381 | Bacteria | 3428 |
| 563 | Ga0268264_10084884 | 3300028381 | Bacteria | 2716 |
| 564 | Ga0268264_10097039 | 3300028381 | Bacteria | 2554 |
| 565 | Ga0265338_10002910 | 3300028800 | Bacteria | 24891 |
| 566 | Ga0265338_10035271 | 3300028800 | Bacteria | 4814 |
| 567 | Ga0265338_10079871 | 3300028800 | Bacteria | 2750 |
| 568 | Ga0265338_10145770 | 3300028800 | Bacteria | 1847 |
| 569 | Ga0265762_1000283 | 3300030760 | Bacteria | 8455 |
| 570 | Ga0265762_1001988 | 3300030760 | Bacteria | 3719 |
| 571 | Ga0265762_1012207 | 3300030760 | Bacteria | 1539 |
| 572 | Ga0265765_1002398 | 3300030879 | Bacteria | 1811 |
| 573 | Ga0265760_10000599 | 3300031090 | Bacteria | 10250 |
| 574 | Ga0265760_10001517 | 3300031090 | Bacteria | 6839 |
| 575 | Ga0265760_10003165 | 3300031090 | Bacteria | 4814 |
| 576 | Ga0265760_10015386 | 3300031090 | Bacteria | 2192 |
| 577 | Ga0265760_10020798 | 3300031090 | Bacteria | 1896 |
| 578 | Ga0265330_10008062 | 3300031235 | Bacteria | 5094 |
| 579 | Ga0265325_10037851 | 3300031241 | Bacteria | 2549 |
| 580 | Ga0265325_10103160 | 3300031241 | Unclassified | 1394 |
| 581 | Ga0265340_10038313 | 3300031247 | Unclassified | 2372 |
| 582 | Ga0265340_10063336 | 3300031247 | Bacteria | 1765 |
| 583 | Ga0265339_10003284 | 3300031249 | Bacteria | 11322 |
| 584 | Ga0265339_10008695 | 3300031249 | Bacteria | 6443 |
| 585 | Ga0265339_10061810 | 3300031249 | Bacteria | 2014 |
| 586 | Ga0265316_10001490 | 3300031344 | Bacteria | 25094 |
| 587 | Ga0265316_10013551 | 3300031344 | Bacteria | 7235 |
| 588 | Ga0265316_10038118 | 3300031344 | Bacteria | 3876 |
| 589 | Ga0265316_10355891 | 3300031344 | Unclassified | 1059 |
| 590 | Ga0265314_10021008 | 3300031711 | Bacteria | 5031 |
| 591 | Ga0265314_10075352 | 3300031711 | Bacteria | 2245 |
| 592 | Ga0265342_10125352 | 3300031712 | Viruses | 1443 |
| 593 | Ga0373929_0002552 | 3300035085 | Bacteria | 3346 |
| 594 | Ga0373934_0053286 | 3300035086 | Bacteria | 1604 |
| 595 | Ga0373923_0056568 | 3300035111 | Bacteria | 1656 |
| 596 | Ga0373936_0045026 | 3300035113 | Bacteria | 1776 |
| 597 | Ga0373945_0018990 | 3300035116 | Bacteria | 2343 |
| 598 | Ga0373954_0098001 | 3300035118 | Bacteria | 1413 |
| 599 | Ga0373956_0097099 | 3300035119 | Bacteria | 1363 |
| 600 | Ga0373943_0001752 | 3300035170 | Bacteria | 9835 |
| 601 | Ga0373943_0171757 | 3300035170 | Bacteria | 1187 |
| 602 | Ga0373946_0059159 | 3300035171 | Bacteria | 1625 |
| 603 | Ga0373961_0072285 | 3300035241 | Unclassified | 1069 |
| 604 | Ga0373962_0039798 | 3300035242 | Bacteria | 1321 |
| 605 | Ga0373924_0011344 | 3300035410 | Bacteria | 3308 |
| 606 | Ga0373931_0042332 | 3300035691 | Bacteria | 2395 |
| 607 | Ga0373931_0068945 | 3300035691 | Bacteria | 1926 |
| 608 | Ga0373931_0408276 | 3300035691 | Bacteria | 861 |
| 609 | Ga0373935_0005301 | 3300035692 | Bacteria | 7589 |
| 610 | Ga0373935_0040938 | 3300035692 | Bacteria | 2909 |
| 611 | Ga0373935_0047719 | 3300035692 | Bacteria | 2709 |
| 612 | Ga0373935_0280923 | 3300035692 | Bacteria | 1172 |
| 613 | Ga0373927_0000229 | 3300035695 | Bacteria | 44230 |
| 614 | Ga0373927_0044440 | 3300035695 | Bacteria | 2874 |
| 615 | Ga0373927_0073103 | 3300035695 | Bacteria | 2220 |
| 616 | Ga0373927_0201130 | 3300035695 | Unclassified | 1308 |
| 617 | Ga0373933_0028769 | 3300035724 | Bacteria | 3208 |
| 618 | Ga0373933_0189851 | 3300035724 | Bacteria | 1312 |
| 619 | Ga0373947_0009478 | 3300035725 | Bacteria | 5592 |
| 620 | Ga0373947_0077103 | 3300035725 | Bacteria | 2055 |
| 621 | Ga0373947_0125667 | 3300035725 | Bacteria | 1633 |
| 622 | Ga0373947_0185149 | 3300035725 | Bacteria | 1357 |
| 623 | Ga0373947_0236526 | 3300035725 | Bacteria | 1204 |
| 624 | Ga0373947_0331233 | 3300035725 | Bacteria | 1019 |
| 625 | Ga0373937_0027681 | 3300036401 | Bacteria | 5128 |
| 626 | Ga0373937_0069620 | 3300036401 | Bacteria | 3244 |
| 627 | Ga0373937_0074227 | 3300036401 | Bacteria | 3138 |
| 628 | Ga0373937_0093206 | 3300036401 | Bacteria | 2792 |
| 629 | Ga0373937_0236070 | 3300036401 | Bacteria | 1722 |
| 630 | Ga0373937_0672213 | 3300036401 | Bacteria | 981 |
| 631 | Ga0373925_0166154 | 3300037068 | Unclassified | 1740 |
| 632 | Ga0373925_0292113 | 3300037068 | Bacteria | 1314 |
| 633 | Ga0373925_0487649 | 3300037068 | Bacteria | 1011 |
| 634 | Ga0436364_0935288 | 3300037853 | Bacteria | 1350 |
| 635 | Ga0436365_0109293 | 3300039437 | Bacteria | 2048 |
| 636 | Ga0436360_0657632 | 3300039438 | Unclassified | 1892 |
| 637 | Ga0436363_1637340 | 3300039450 | Bacteria | 1751 |
| 638 | Ga0436362_1207079 | 3300039453 | Bacteria | 2489 |
| 639 | Ga0466966_0034801 | 3300044684 | Bacteria | 3257 |
| 640 | Ga0466968_0149246 | 3300044735 | Bacteria | 1074 |
| 641 | Ga0451576_0312849 | 3300045051 | Bacteria | 1643 |
| 642 | Ga0495629_0056413 | 3300046459 | Bacteria | 2747 |
| 643 | Ga0495580_0005055 | 3300046472 | Bacteria | 10994 |
| 644 | Ga0495580_0006797 | 3300046472 | Bacteria | 9269 |
| 645 | Ga0495580_0010833 | 3300046472 | Bacteria | 7075 |
| 646 | Ga0495580_0019702 | 3300046472 | Bacteria | 5009 |
| 647 | Ga0495580_0044298 | 3300046472 | Bacteria | 3165 |
| 648 | Ga0495580_0084543 | 3300046472 | Bacteria | 2210 |
| 649 | Ga0495580_0134094 | 3300046472 | Bacteria | 1717 |
| 650 | Ga0495580_0195561 | 3300046472 | Bacteria | 1394 |
| 651 | Ga0495580_0253457 | 3300046472 | Bacteria | 1204 |
| 652 | Ga0495580_0281597 | 3300046472 | Bacteria | 1134 |
| 653 | Ga0495582_0238905 | 3300046473 | Bacteria | 1041 |
| 654 | Ga0495664_0208564 | 3300046477 | Bacteria | 1183 |
| 655 | Ga0495608_0270674 | 3300046511 | Bacteria | 1056 |
| 656 | Ga0495628_0064803 | 3300046516 | Bacteria | 2860 |
| 657 | Ga0495628_0267525 | 3300046516 | Unclassified | 1272 |
| 658 | Ga0495630_0356637 | 3300046517 | Unclassified | 1119 |
| 659 | Ga0495586_0291208 | 3300046535 | Unclassified | 935 |
| 660 | Ga0495645_0127644 | 3300046543 | Unclassified | 1786 |
| 661 | Ga0495669_0155469 | 3300046684 | Unclassified | 1084 |
| 662 | Ga0495624_0056773 | 3300046690 | Bacteria | 2463 |
| 663 | Ga0495604_0152281 | 3300047317 | Bacteria | 1642 |
| 664 | Ga0495674_0022349 | 3300047319 | Bacteria | 5834 |
| 665 | Ga0495674_0046114 | 3300047319 | Bacteria | 3869 |
| 666 | Ga0495674_0081276 | 3300047319 | Bacteria | 2780 |
| 667 | Ga0495674_0119590 | 3300047319 | Bacteria | 2226 |
| 668 | Ga0495674_0294909 | 3300047319 | Bacteria | 1325 |
| 669 | Ga0495676_0409325 | 3300047321 | Bacteria | 899 |
| 670 | Ga0495680_0172176 | 3300047322 | Bacteria | 1567 |
| 671 | Ga0495675_0096528 | 3300047444 | Bacteria | 1853 |
| 672 | Ga0495684_0063476 | 3300047471 | Bacteria | 2808 |
| 673 | Ga0495602_0279395 | 3300048088 | Unclassified | 1231 |
| 674 | Ga0496101_0066564 | 3300048904 | Bacteria | 2628 |
| 675 | Ga0496101_0089877 | 3300048904 | Bacteria | 2283 |
| 676 | Ga0496101_0226494 | 3300048904 | Unclassified | 1452 |
| 677 | Ga0496101_0235719 | 3300048904 | Bacteria | 1423 |
| 678 | Ga0496102_0015404 | 3300048905 | Bacteria | 6658 |
| 679 | Ga0496102_0067241 | 3300048905 | Bacteria | 3286 |
| 680 | Ga0496102_0083537 | 3300048905 | Unclassified | 2947 |
| 681 | Ga0496102_0100333 | 3300048905 | Bacteria | 2688 |
| 682 | Ga0496102_0210163 | 3300048905 | Bacteria | 1835 |
| 683 | Ga0496102_0309607 | 3300048905 | Unclassified | 1488 |
| 684 | Ga0496102_0323029 | 3300048905 | Bacteria | 1454 |
| 685 | Ga0496102_0401704 | 3300048905 | Viruses | 1288 |
| 686 | Ga0496103_0014109 | 3300048906 | Bacteria | 4743 |
| 687 | Ga0496103_0079682 | 3300048906 | Bacteria | 2058 |
| 688 | Ga0496103_0129954 | 3300048906 | Unclassified | 1608 |
| 689 | Ga0496104_0014057 | 3300048907 | Bacteria | 7226 |
| 690 | Ga0496104_0028582 | 3300048907 | Bacteria | 5168 |
| 691 | Ga0496104_0077313 | 3300048907 | Unclassified | 3171 |
| 692 | Ga0496104_0086818 | 3300048907 | Bacteria | 2987 |
| 693 | Ga0496105_0099931 | 3300048908 | Bacteria | 2396 |
| 694 | Ga0496105_0379352 | 3300048908 | Bacteria | 1125 |
| 695 | Ga0496106_0035779 | 3300048909 | Bacteria | 3713 |
| 696 | Ga0496106_0095340 | 3300048909 | Bacteria | 2301 |
| 697 | Ga0496106_0263429 | 3300048909 | Bacteria | 1379 |
| 698 | Ga0496107_0079258 | 3300048910 | Bacteria | 2394 |
| 699 | Ga0496107_0117036 | 3300048910 | Bacteria | 1962 |
| 700 | Ga0496108_0000228 | 3300048911 | Bacteria | 50279 |
| 701 | Ga0496108_0121361 | 3300048911 | Bacteria | 2242 |
| 702 | Ga0496108_0231790 | 3300048911 | Bacteria | 1606 |
| 703 | Ga0496109_0000362 | 3300048912 | Bacteria | 42175 |
| 704 | Ga0496109_0075613 | 3300048912 | Bacteria | 3097 |
| 705 | Ga0496109_0158738 | 3300048912 | Bacteria | 2118 |
| 706 | Ga0496110_0001221 | 3300048913 | Bacteria | 18300 |
| 707 | Ga0496110_0106280 | 3300048913 | Bacteria | 2518 |
| 708 | Ga0496111_0031062 | 3300048914 | Bacteria | 3803 |
| 709 | Ga0496111_0062347 | 3300048914 | Bacteria | 2704 |
| 710 | Ga0496111_0358550 | 3300048914 | Bacteria | 1079 |
| 711 | Ga0496112_0000034 | 3300048915 | Bacteria | 107237 |
| 712 | Ga0496112_0001689 | 3300048915 | Bacteria | 17199 |
| 713 | Ga0496112_0001953 | 3300048915 | Bacteria | 16282 |
| 714 | Ga0496112_0484329 | 3300048915 | Bacteria | 1173 |
| 715 | Ga0496112_0591966 | 3300048915 | Bacteria | 1041 |
| 716 | Ga0496113_0019265 | 3300048916 | Bacteria | 4770 |
| 717 | Ga0496113_0222868 | 3300048916 | Bacteria | 1503 |
| 718 | Ga0496113_0248108 | 3300048916 | Bacteria | 1421 |
| 719 | Ga0496113_0315149 | 3300048916 | Bacteria | 1253 |
| 720 | Ga0496114_0106115 | 3300048917 | Bacteria | 2403 |
| 721 | Ga0496114_0461611 | 3300048917 | Bacteria | 1124 |
| 722 | Ga0496115_0032038 | 3300048918 | Unclassified | 4146 |
| 723 | Ga0496115_0091842 | 3300048918 | Bacteria | 2481 |
| 724 | Ga0496115_0105049 | 3300048918 | Bacteria | 2318 |
| 725 | Ga0496115_0105540 | 3300048918 | Bacteria | 2312 |
| 726 | Ga0496115_0155860 | 3300048918 | Bacteria | 1887 |
| 727 | nmdc:mga05p37_314944_c1 | 3300050507 | Bacteria | 1854 |
| 728 | nmdc:mga0n895_1952_c1 | 3300050512 | Bacteria | 15821 |
| 729 | nmdc:mga0n895_204554_c1 | 3300050512 | Bacteria | 2005 |
| 730 | nmdc:mga0n895_4619_c1 | 3300050512 | Bacteria | 11353 |
| 731 | nmdc:mga0rr50_139752_c1 | 3300050513 | Bacteria | 1947 |
| 732 | nmdc:mga0rr50_19062_c1 | 3300050513 | Bacteria | 4622 |
| 733 | nmdc:mga0rr50_19451_c1 | 3300050513 | Bacteria | 4584 |
| 734 | nmdc:mga0rr50_265403_c1 | 3300050513 | Bacteria | 1429 |
| 735 | nmdc:mga0rr50_432027_c1 | 3300050513 | Bacteria | 1115 |
| 736 | nmdc:mga08x19_12762_c1 | 3300050514 | Bacteria | 5068 |
| 737 | nmdc:mga08x19_1517_c1 | 3300050514 | Bacteria | 14391 |
| 738 | nmdc:mga08x19_8058_c1 | 3300050514 | Bacteria | 6260 |
| 739 | nmdc:mga08x19_96474_c1 | 3300050514 | Bacteria | 1957 |
| 740 | nmdc:mga0a205_23451_c1 | 3300050515 | Bacteria | 5854 |
| 741 | nmdc:mga0a205_25965_c1 | 3300050515 | Bacteria | 5581 |
| 742 | Ga0495619_0102108 | 3300053085 | Unclassified | 1953 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0231790 | Ga0496108_0231790_628_1407 | 227 |
| 2 | 3300037853 | Ga0436364_0935288 | Ga0436364_0935288_495_1304 | 229 |
| 3 | 3300028800 | Ga0265338_10079871 | Ga0265338_100798712 | 230 |
| 4 | 3300031249 | Ga0265339_10003284 | Ga0265339_1000328410 | 230 |
| 5 | 3300031344 | Ga0265316_10013551 | Ga0265316_100135515 | 230 |
| 6 | 3300031711 | Ga0265314_10075352 | Ga0265314_100753522 | 230 |
| 7 | 3300005436 | Ga0070713_100358377 | Ga0070713_1003583771 | 232 |
| 8 | 3300006028 | Ga0070717_10012322 | Ga0070717_100123225 | 232 |
| 9 | 3300046473 | Ga0495582_0238905 | Ga0495582_0238905_52_831 | 232 |
| 10 | 3300048917 | Ga0496114_0106115 | Ga0496114_0106115_76_855 | 232 |
| 11 | 3300005338 | Ga0068868_100145488 | Ga0068868_1001454881 | 233 |
| 12 | 3300005445 | Ga0070708_100253501 | Ga0070708_1002535012 | 233 |
| 13 | 3300005536 | Ga0070697_100142468 | Ga0070697_1001424684 | 233 |
| 14 | 3300005841 | Ga0068863_100392889 | Ga0068863_1003928893 | 233 |
| 15 | 3300009098 | Ga0105245_10194558 | Ga0105245_101945582 | 233 |
| 16 | 3300013296 | Ga0157374_10077162 | Ga0157374_100771624 | 233 |
| 17 | 3300014325 | Ga0163163_10077093 | Ga0163163_100770932 | 233 |
| 18 | 3300025927 | Ga0207687_10136622 | Ga0207687_101366223 | 233 |
| 19 | 3300025928 | Ga0207700_10009464 | Ga0207700_100094646 | 233 |
| 20 | 3300026088 | Ga0207641_10271849 | Ga0207641_102718492 | 233 |
| 21 | 3300035695 | Ga0373927_0073103 | Ga0373927_0073103_971_1783 | 233 |
| 22 | 3300046472 | Ga0495580_0019702 | Ga0495580_0019702_904_1716 | 233 |
| 23 | 3300005445 | Ga0070708_100002311 | Ga0070708_10000231114 | 234 |
| 24 | 3300006871 | Ga0075434_100263702 | Ga0075434_1002637023 | 234 |
| 25 | 3300009101 | Ga0105247_10222384 | Ga0105247_102223842 | 234 |
| 26 | 3300009545 | Ga0105237_10166196 | Ga0105237_101661962 | 234 |
| 27 | 3300009551 | Ga0105238_10790659 | Ga0105238_107906592 | 234 |
| 28 | 3300013105 | Ga0157369_10074407 | Ga0157369_100744074 | 234 |
| 29 | 3300013307 | Ga0157372_10000497 | Ga0157372_1000049723 | 234 |
| 30 | 3300013307 | Ga0157372_10012853 | Ga0157372_100128537 | 234 |
| 31 | 3300024227 | Ga0228598_1008184 | Ga0228598_10081841 | 234 |
| 32 | 3300035113 | Ga0373936_0045026 | Ga0373936_0045026_397_1155 | 234 |
| 33 | 3300035118 | Ga0373954_0098001 | Ga0373954_0098001_40_807 | 234 |
| 34 | 3300035691 | Ga0373931_0408276 | Ga0373931_0408276_11_793 | 234 |
| 35 | 3300035725 | Ga0373947_0077103 | Ga0373947_0077103_1034_1792 | 234 |
| 36 | 3300036401 | Ga0373937_0069620 | Ga0373937_0069620_1432_2199 | 234 |
| 37 | 3300036401 | Ga0373937_0074227 | Ga0373937_0074227_2061_2816 | 234 |
| 38 | 3300039438 | Ga0436360_0657632 | Ga0436360_0657632_95_922 | 234 |
| 39 | 3300046511 | Ga0495608_0270674 | Ga0495608_0270674_195_962 | 234 |
| 40 | 3300047444 | Ga0495675_0096528 | Ga0495675_0096528_425_1192 | 234 |
| 41 | 3300048088 | Ga0495602_0279395 | Ga0495602_0279395_448_1203 | 234 |
| 42 | 3300050512 | nmdc:mga0n895_204554_c1 | nmdc:mga0n895_204554_c1_130_888 | 234 |
| 43 | 3300050513 | nmdc:mga0rr50_19451_c1 | nmdc:mga0rr50_19451_c1_1679_2437 | 234 |
| 44 | 3300050514 | nmdc:mga08x19_96474_c1 | nmdc:mga08x19_96474_c1_542_1300 | 234 |
| 45 | 3300025939 | Ga0207665_10142770 | Ga0207665_101427702 | 235 |
| 46 | 3300044684 | Ga0466966_0034801 | Ga0466966_0034801_401_1177 | 235 |
| 47 | 3300025910 | Ga0207684_10212703 | Ga0207684_102127033 | 236 |
| 48 | 3300031247 | Ga0265340_10038313 | Ga0265340_100383133 | 236 |
| 49 | 3300031344 | Ga0265316_10001490 | Ga0265316_1000149012 | 236 |
| 50 | 3300047471 | Ga0495684_0063476 | Ga0495684_0063476_992_1759 | 236 |
| 51 | 3300003323 | rootH1_10349975 | rootH1_103499752 | 237 |
| 52 | 3300036401 | Ga0373937_0672213 | Ga0373937_0672213_119_952 | 237 |
| 53 | 3300005436 | Ga0070713_100438125 | Ga0070713_1004381251 | 238 |
| 54 | 3300005468 | Ga0070707_100072582 | Ga0070707_1000725823 | 238 |
| 55 | 3300005563 | Ga0068855_100002122 | Ga0068855_10000212214 | 238 |
| 56 | 3300006237 | Ga0097621_100258017 | Ga0097621_1002580171 | 238 |
| 57 | 3300006358 | Ga0068871_100010394 | Ga0068871_1000103944 | 238 |
| 58 | 3300009093 | Ga0105240_10032276 | Ga0105240_100322769 | 238 |
| 59 | 3300009093 | Ga0105240_10296530 | Ga0105240_102965302 | 238 |
| 60 | 3300009101 | Ga0105247_10278239 | Ga0105247_102782392 | 238 |
| 61 | 3300009174 | Ga0105241_10010779 | Ga0105241_100107796 | 238 |
| 62 | 3300009551 | Ga0105238_10000570 | Ga0105238_1000057029 | 238 |
| 63 | 3300009551 | Ga0105238_10119189 | Ga0105238_101191892 | 238 |
| 64 | 3300010375 | Ga0105239_10006742 | Ga0105239_1000674215 | 238 |
| 65 | 3300013105 | Ga0157369_10000309 | Ga0157369_1000030926 | 238 |
| 66 | 3300013296 | Ga0157374_10001227 | Ga0157374_1000122715 | 238 |
| 67 | 3300013297 | Ga0157378_10003661 | Ga0157378_100036612 | 238 |
| 68 | 3300013297 | Ga0157378_10082051 | Ga0157378_100820512 | 238 |
| 69 | 3300013306 | Ga0163162_10394012 | Ga0163162_103940122 | 238 |
| 70 | 3300013307 | Ga0157372_10004364 | Ga0157372_100043644 | 238 |
| 71 | 3300013308 | Ga0157375_10694029 | Ga0157375_106940292 | 238 |
| 72 | 3300014969 | Ga0157376_10410179 | Ga0157376_104101792 | 238 |
| 73 | 3300025912 | Ga0207707_10000878 | Ga0207707_1000087825 | 238 |
| 74 | 3300025913 | Ga0207695_10041995 | Ga0207695_100419954 | 238 |
| 75 | 3300025913 | Ga0207695_10235230 | Ga0207695_102352302 | 238 |
| 76 | 3300025921 | Ga0207652_10022743 | Ga0207652_100227434 | 238 |
| 77 | 3300025924 | Ga0207694_10001825 | Ga0207694_100018255 | 238 |
| 78 | 3300026035 | Ga0207703_10057247 | Ga0207703_100572474 | 238 |
| 79 | 3300026078 | Ga0207702_10000490 | Ga0207702_100004905 | 238 |
| 80 | 3300026116 | Ga0207674_10002982 | Ga0207674_1000298210 | 238 |
| 81 | 3300031249 | Ga0265339_10008695 | Ga0265339_100086951 | 238 |
| 82 | 3300031711 | Ga0265314_10021008 | Ga0265314_100210083 | 238 |
| 83 | 3300035692 | Ga0373935_0047719 | Ga0373935_0047719_1464_2261 | 238 |
| 84 | 3300035695 | Ga0373927_0044440 | Ga0373927_0044440_251_1036 | 238 |
| 85 | 3300035725 | Ga0373947_0236526 | Ga0373947_0236526_162_947 | 238 |
| 86 | 3300035725 | Ga0373947_0331233 | Ga0373947_0331233_140_937 | 238 |
| 87 | 3300037068 | Ga0373925_0166154 | Ga0373925_0166154_58_843 | 238 |
| 88 | 3300037068 | Ga0373925_0487649 | Ga0373925_0487649_29_826 | 238 |
| 89 | 3300045051 | Ga0451576_0312849 | Ga0451576_0312849_181_960 | 238 |
| 90 | 3300046459 | Ga0495629_0056413 | Ga0495629_0056413_1051_1848 | 238 |
| 91 | 3300046516 | Ga0495628_0267525 | Ga0495628_0267525_71_868 | 238 |
| 92 | 3300046535 | Ga0495586_0291208 | Ga0495586_0291208_135_920 | 238 |
| 93 | 3300047319 | Ga0495674_0294909 | Ga0495674_0294909_341_1138 | 238 |
| 94 | 3300047321 | Ga0495676_0409325 | Ga0495676_0409325_81_878 | 238 |
| 95 | 3300048904 | Ga0496101_0066564 | Ga0496101_0066564_282_1079 | 238 |
| 96 | 3300048905 | Ga0496102_0401704 | Ga0496102_0401704_372_1148 | 238 |
| 97 | 3300048907 | Ga0496104_0028582 | Ga0496104_0028582_2135_2911 | 238 |
| 98 | 3300048908 | Ga0496105_0099931 | Ga0496105_0099931_1246_2022 | 238 |
| 99 | 3300048910 | Ga0496107_0079258 | Ga0496107_0079258_1186_1983 | 238 |
| 100 | 3300048915 | Ga0496112_0001689 | Ga0496112_0001689_11876_12652 | 238 |
| 101 | 3300048916 | Ga0496113_0222868 | Ga0496113_0222868_181_957 | 238 |
| 102 | 3300048918 | Ga0496115_0105049 | Ga0496115_0105049_294_1070 | 238 |
| 103 | 3300048918 | Ga0496115_0105540 | Ga0496115_0105540_1371_2168 | 238 |
| 104 | 3300053085 | Ga0495619_0102108 | Ga0495619_0102108_1126_1923 | 238 |
| 105 | 3300025915 | Ga0207693_10220546 | Ga0207693_102205462 | 239 |
| 106 | 3300005445 | Ga0070708_100554934 | Ga0070708_1005549341 | 240 |
| 107 | 3300005468 | Ga0070707_100147384 | Ga0070707_1001473842 | 240 |
| 108 | 3300006028 | Ga0070717_10006280 | Ga0070717_100062807 | 240 |
| 109 | 3300014497 | Ga0182008_10054129 | Ga0182008_100541292 | 240 |
| 110 | 3300025922 | Ga0207646_10190908 | Ga0207646_101909082 | 240 |
| 111 | 3300025939 | Ga0207665_10185846 | Ga0207665_101858462 | 240 |
| 112 | 3300005536 | Ga0070697_100000015 | Ga0070697_10000001565 | 241 |
| 113 | 3300005545 | Ga0070695_100135571 | Ga0070695_1001355712 | 241 |
| 114 | 3300013307 | Ga0157372_10164931 | Ga0157372_101649313 | 241 |
| 115 | 3300025912 | Ga0207707_10080808 | Ga0207707_100808084 | 241 |
| 116 | 3300026116 | Ga0207674_10010514 | Ga0207674_100105147 | 241 |
| 117 | 3300005434 | Ga0070709_10004147 | Ga0070709_100041475 | 242 |
| 118 | 3300005435 | Ga0070714_100104432 | Ga0070714_1001044322 | 242 |
| 119 | 3300005436 | Ga0070713_100006167 | Ga0070713_1000061676 | 242 |
| 120 | 3300005437 | Ga0070710_10014713 | Ga0070710_100147131 | 242 |
| 121 | 3300005439 | Ga0070711_100146958 | Ga0070711_1001469581 | 242 |
| 122 | 3300005471 | Ga0070698_100282882 | Ga0070698_1002828822 | 242 |
| 123 | 3300005841 | Ga0068863_100254109 | Ga0068863_1002541093 | 242 |
| 124 | 3300005983 | Ga0081540_1021791 | Ga0081540_10217913 | 242 |
| 125 | 3300026088 | Ga0207641_10029359 | Ga0207641_100293592 | 242 |
| 126 | 3300028017 | Ga0265356_1005028 | Ga0265356_10050282 | 242 |
| 127 | 3300030760 | Ga0265762_1000283 | Ga0265762_10002834 | 242 |
| 128 | 3300005335 | Ga0070666_10054652 | Ga0070666_100546522 | 243 |
| 129 | 3300005338 | Ga0068868_100128111 | Ga0068868_1001281111 | 243 |
| 130 | 3300005367 | Ga0070667_100152871 | Ga0070667_1001528713 | 243 |
| 131 | 3300005434 | Ga0070709_10000342 | Ga0070709_1000034221 | 243 |
| 132 | 3300005436 | Ga0070713_100000464 | Ga0070713_10000046415 | 243 |
| 133 | 3300005437 | Ga0070710_10041368 | Ga0070710_100413681 | 243 |
| 134 | 3300005439 | Ga0070711_100026283 | Ga0070711_1000262834 | 243 |
| 135 | 3300005445 | Ga0070708_100496587 | Ga0070708_1004965872 | 243 |
| 136 | 3300005456 | Ga0070678_100107019 | Ga0070678_1001070193 | 243 |
| 137 | 3300005458 | Ga0070681_10029824 | Ga0070681_100298242 | 243 |
| 138 | 3300005614 | Ga0068856_100004490 | Ga0068856_1000044903 | 243 |
| 139 | 3300005843 | Ga0068860_100054724 | Ga0068860_1000547243 | 243 |
| 140 | 3300006028 | Ga0070717_10085391 | Ga0070717_100853915 | 243 |
| 141 | 3300006163 | Ga0070715_10013537 | Ga0070715_100135373 | 243 |
| 142 | 3300006175 | Ga0070712_100003006 | Ga0070712_10000300610 | 243 |
| 143 | 3300006237 | Ga0097621_100005633 | Ga0097621_1000056334 | 243 |
| 144 | 3300006358 | Ga0068871_100002915 | Ga0068871_10000291512 | 243 |
| 145 | 3300009093 | Ga0105240_10033712 | Ga0105240_100337121 | 243 |
| 146 | 3300009098 | Ga0105245_10017602 | Ga0105245_100176023 | 243 |
| 147 | 3300009176 | Ga0105242_10027658 | Ga0105242_100276584 | 243 |
| 148 | 3300009177 | Ga0105248_10282060 | Ga0105248_102820603 | 243 |
| 149 | 3300013296 | Ga0157374_10181667 | Ga0157374_101816673 | 243 |
| 150 | 3300013297 | Ga0157378_10012740 | Ga0157378_100127408 | 243 |
| 151 | 3300014969 | Ga0157376_10157777 | Ga0157376_101577772 | 243 |
| 152 | 3300025898 | Ga0207692_10022524 | Ga0207692_100225242 | 243 |
| 153 | 3300025898 | Ga0207692_10060351 | Ga0207692_100603511 | 243 |
| 154 | 3300025903 | Ga0207680_10198523 | Ga0207680_101985232 | 243 |
| 155 | 3300025906 | Ga0207699_10003310 | Ga0207699_100033102 | 243 |
| 156 | 3300025906 | Ga0207699_10014214 | Ga0207699_100142144 | 243 |
| 157 | 3300025912 | Ga0207707_10054116 | Ga0207707_100541166 | 243 |
| 158 | 3300025915 | Ga0207693_10002184 | Ga0207693_1000218418 | 243 |
| 159 | 3300025927 | Ga0207687_10040180 | Ga0207687_100401803 | 243 |
| 160 | 3300025928 | Ga0207700_10005255 | Ga0207700_100052552 | 243 |
| 161 | 3300025928 | Ga0207700_10012034 | Ga0207700_100120345 | 243 |
| 162 | 3300025929 | Ga0207664_10019718 | Ga0207664_100197185 | 243 |
| 163 | 3300025934 | Ga0207686_10124688 | Ga0207686_101246882 | 243 |
| 164 | 3300025949 | Ga0207667_10000708 | Ga0207667_100007085 | 243 |
| 165 | 3300025986 | Ga0207658_10313711 | Ga0207658_103137112 | 243 |
| 166 | 3300026023 | Ga0207677_10009387 | Ga0207677_100093873 | 243 |
| 167 | 3300026121 | Ga0207683_10165202 | Ga0207683_101652023 | 243 |
| 168 | 3300028381 | Ga0268264_10084884 | Ga0268264_100848843 | 243 |
| 169 | 3300030760 | Ga0265762_1012207 | Ga0265762_10122072 | 243 |
| 170 | 3300000546 | LJNas_1000808 | LJNas_10008084 | 244 |
| 171 | 3300005434 | Ga0070709_10121752 | Ga0070709_101217522 | 244 |
| 172 | 3300005435 | Ga0070714_100139733 | Ga0070714_1001397332 | 244 |
| 173 | 3300005436 | Ga0070713_100114870 | Ga0070713_1001148703 | 244 |
| 174 | 3300005436 | Ga0070713_100252971 | Ga0070713_1002529711 | 244 |
| 175 | 3300005458 | Ga0070681_10371698 | Ga0070681_103716982 | 244 |
| 176 | 3300005458 | Ga0070681_10444857 | Ga0070681_104448571 | 244 |
| 177 | 3300005530 | Ga0070679_100265840 | Ga0070679_1002658402 | 244 |
| 178 | 3300005530 | Ga0070679_100565861 | Ga0070679_1005658611 | 244 |
| 179 | 3300005545 | Ga0070695_100097819 | Ga0070695_1000978192 | 244 |
| 180 | 3300006028 | Ga0070717_10305121 | Ga0070717_103051212 | 244 |
| 181 | 3300006914 | Ga0075436_100001061 | Ga0075436_1000010617 | 244 |
| 182 | 3300009093 | Ga0105240_10034130 | Ga0105240_100341304 | 244 |
| 183 | 3300025906 | Ga0207699_10212482 | Ga0207699_102124822 | 244 |
| 184 | 3300025911 | Ga0207654_10374505 | Ga0207654_103745051 | 244 |
| 185 | 3300025912 | Ga0207707_10263706 | Ga0207707_102637061 | 244 |
| 186 | 3300025913 | Ga0207695_10098609 | Ga0207695_100986093 | 244 |
| 187 | 3300025928 | Ga0207700_10194733 | Ga0207700_101947331 | 244 |
| 188 | 3300025929 | Ga0207664_10148802 | Ga0207664_101488023 | 244 |
| 189 | 3300028800 | Ga0265338_10002910 | Ga0265338_100029101 | 244 |
| 190 | 3300031344 | Ga0265316_10355891 | Ga0265316_103558911 | 244 |
| 191 | 3300031712 | Ga0265342_10125352 | Ga0265342_101253522 | 244 |
| 192 | 3300035086 | Ga0373934_0053286 | Ga0373934_0053286_238_1098 | 244 |
| 193 | 3300035111 | Ga0373923_0056568 | Ga0373923_0056568_508_1368 | 244 |
| 194 | 3300035119 | Ga0373956_0097099 | Ga0373956_0097099_322_1182 | 244 |
| 195 | 3300035170 | Ga0373943_0001752 | Ga0373943_0001752_8696_9556 | 244 |
| 196 | 3300035171 | Ga0373946_0059159 | Ga0373946_0059159_674_1534 | 244 |
| 197 | 3300035410 | Ga0373924_0011344 | Ga0373924_0011344_282_1142 | 244 |
| 198 | 3300035692 | Ga0373935_0005301 | Ga0373935_0005301_2419_3279 | 244 |
| 199 | 3300035695 | Ga0373927_0000229 | Ga0373927_0000229_33379_34239 | 244 |
| 200 | 3300035725 | Ga0373947_0009478 | Ga0373947_0009478_391_1251 | 244 |
| 201 | 3300036401 | Ga0373937_0027681 | Ga0373937_0027681_3468_4328 | 244 |
| 202 | 3300037068 | Ga0373925_0292113 | Ga0373925_0292113_254_1114 | 244 |
| 203 | 3300046472 | Ga0495580_0195561 | Ga0495580_0195561_316_1176 | 244 |
| 204 | 3300046477 | Ga0495664_0208564 | Ga0495664_0208564_226_1086 | 244 |
| 205 | 3300046516 | Ga0495628_0064803 | Ga0495628_0064803_255_1115 | 244 |
| 206 | 3300046690 | Ga0495624_0056773 | Ga0495624_0056773_1389_2249 | 244 |
| 207 | 3300047317 | Ga0495604_0152281 | Ga0495604_0152281_83_943 | 244 |
| 208 | 3300047319 | Ga0495674_0119590 | Ga0495674_0119590_929_1789 | 244 |
| 209 | 3300047322 | Ga0495680_0172176 | Ga0495680_0172176_131_991 | 244 |
| 210 | 3300048905 | Ga0496102_0083537 | Ga0496102_0083537_623_1453 | 244 |
| 211 | 3300050514 | nmdc:mga08x19_1517_c1 | nmdc:mga08x19_1517_c1_11877_12698 | 244 |
| 212 | 3300050514 | nmdc:mga08x19_8058_c1 | nmdc:mga08x19_8058_c1_108_938 | 244 |
| 213 | 3300005435 | Ga0070714_100161464 | Ga0070714_1001614641 | 245 |
| 214 | 3300005445 | Ga0070708_100034268 | Ga0070708_1000342684 | 245 |
| 215 | 3300005467 | Ga0070706_100018145 | Ga0070706_1000181454 | 245 |
| 216 | 3300005468 | Ga0070707_100229201 | Ga0070707_1002292012 | 245 |
| 217 | 3300005471 | Ga0070698_100070545 | Ga0070698_1000705453 | 245 |
| 218 | 3300006852 | Ga0075433_10020953 | Ga0075433_100209537 | 245 |
| 219 | 3300006871 | Ga0075434_100000976 | Ga0075434_10000097611 | 245 |
| 220 | 3300006914 | Ga0075436_100033643 | Ga0075436_1000336436 | 245 |
| 221 | 3300007076 | Ga0075435_100001744 | Ga0075435_10000174411 | 245 |
| 222 | 3300009147 | Ga0114129_10271973 | Ga0114129_102719733 | 245 |
| 223 | 3300022732 | Ga0224569_102017 | Ga0224569_1020171 | 245 |
| 224 | 3300025910 | Ga0207684_10016631 | Ga0207684_100166314 | 245 |
| 225 | 3300025922 | Ga0207646_10105166 | Ga0207646_101051662 | 245 |
| 226 | 3300025928 | Ga0207700_10251319 | Ga0207700_102513192 | 245 |
| 227 | 3300028017 | Ga0265356_1000078 | Ga0265356_100007818 | 245 |
| 228 | 3300031090 | Ga0265760_10001517 | Ga0265760_100015175 | 245 |
| 229 | 3300044735 | Ga0466968_0149246 | Ga0466968_0149246_167_988 | 245 |
| 230 | 3300046472 | Ga0495580_0044298 | Ga0495580_0044298_2216_2995 | 245 |
| 231 | 3300005435 | Ga0070714_100251381 | Ga0070714_1002513812 | 246 |
| 232 | 3300005436 | Ga0070713_100000349 | Ga0070713_10000034922 | 246 |
| 233 | 3300005437 | Ga0070710_10094328 | Ga0070710_100943282 | 246 |
| 234 | 3300005439 | Ga0070711_100006200 | Ga0070711_1000062004 | 246 |
| 235 | 3300005439 | Ga0070711_100378128 | Ga0070711_1003781281 | 246 |
| 236 | 3300006028 | Ga0070717_10001227 | Ga0070717_1000122715 | 246 |
| 237 | 3300006173 | Ga0070716_100066983 | Ga0070716_1000669832 | 246 |
| 238 | 3300006175 | Ga0070712_100000586 | Ga0070712_10000058616 | 246 |
| 239 | 3300021377 | Ga0213874_10022180 | Ga0213874_100221802 | 246 |
| 240 | 3300025898 | Ga0207692_10007889 | Ga0207692_100078892 | 246 |
| 241 | 3300025915 | Ga0207693_10000142 | Ga0207693_100001423 | 246 |
| 242 | 3300025928 | Ga0207700_10000200 | Ga0207700_100002002 | 246 |
| 243 | 3300025929 | Ga0207664_10000033 | Ga0207664_10000033132 | 246 |
| 244 | 3300025929 | Ga0207664_10137666 | Ga0207664_101376662 | 246 |
| 245 | 3300025939 | Ga0207665_10074992 | Ga0207665_100749922 | 246 |
| 246 | 3300031090 | Ga0265760_10015386 | Ga0265760_100153863 | 246 |
| 247 | 3300031090 | Ga0265760_10020798 | Ga0265760_100207983 | 246 |
| 248 | 3300035116 | Ga0373945_0018990 | Ga0373945_0018990_1241_2101 | 246 |
| 249 | 3300039450 | Ga0436363_1637340 | Ga0436363_1637340_631_1479 | 246 |
| 250 | 3300046684 | Ga0495669_0155469 | Ga0495669_0155469_58_915 | 246 |
| 251 | 3300048907 | Ga0496104_0077313 | Ga0496104_0077313_2283_3143 | 246 |
| 252 | 3300048908 | Ga0496105_0379352 | Ga0496105_0379352_38_898 | 246 |
| 253 | 3300048917 | Ga0496114_0461611 | Ga0496114_0461611_210_1070 | 246 |
| 254 | 3300048918 | Ga0496115_0032038 | Ga0496115_0032038_90_950 | 246 |
| 255 | 3300050507 | nmdc:mga05p37_314944_c1 | nmdc:mga05p37_314944_c1_314_1126 | 246 |
| 256 | 3300050512 | nmdc:mga0n895_1952_c1 | nmdc:mga0n895_1952_c1_14420_15232 | 246 |
| 257 | 3300050513 | nmdc:mga0rr50_19062_c1 | nmdc:mga0rr50_19062_c1_706_1518 | 246 |
| 258 | 3300050514 | nmdc:mga08x19_12762_c1 | nmdc:mga08x19_12762_c1_2146_2958 | 246 |
| 259 | 3300050515 | nmdc:mga0a205_25965_c1 | nmdc:mga0a205_25965_c1_1796_2608 | 246 |
| 260 | 3300005329 | Ga0070683_100360942 | Ga0070683_1003609421 | 247 |
| 261 | 3300005353 | Ga0070669_100071985 | Ga0070669_1000719853 | 247 |
| 262 | 3300005434 | Ga0070709_10174044 | Ga0070709_101740441 | 247 |
| 263 | 3300005435 | Ga0070714_100102883 | Ga0070714_1001028833 | 247 |
| 264 | 3300005436 | Ga0070713_100007744 | Ga0070713_1000077447 | 247 |
| 265 | 3300005436 | Ga0070713_100248899 | Ga0070713_1002488991 | 247 |
| 266 | 3300005437 | Ga0070710_10039878 | Ga0070710_100398782 | 247 |
| 267 | 3300005444 | Ga0070694_100410831 | Ga0070694_1004108312 | 247 |
| 268 | 3300005530 | Ga0070679_100043848 | Ga0070679_1000438484 | 247 |
| 269 | 3300005544 | Ga0070686_100124596 | Ga0070686_1001245962 | 247 |
| 270 | 3300005577 | Ga0068857_100324320 | Ga0068857_1003243201 | 247 |
| 271 | 3300005614 | Ga0068856_100346291 | Ga0068856_1003462911 | 247 |
| 272 | 3300005840 | Ga0068870_10050699 | Ga0068870_100506991 | 247 |
| 273 | 3300005842 | Ga0068858_100029444 | Ga0068858_1000294442 | 247 |
| 274 | 3300006175 | Ga0070712_100053544 | Ga0070712_1000535442 | 247 |
| 275 | 3300006175 | Ga0070712_100147640 | Ga0070712_1001476402 | 247 |
| 276 | 3300006237 | Ga0097621_100081412 | Ga0097621_1000814122 | 247 |
| 277 | 3300007076 | Ga0075435_100415531 | Ga0075435_1004155312 | 247 |
| 278 | 3300009101 | Ga0105247_10040642 | Ga0105247_100406422 | 247 |
| 279 | 3300009174 | Ga0105241_10059045 | Ga0105241_100590453 | 247 |
| 280 | 3300009177 | Ga0105248_10017692 | Ga0105248_100176922 | 247 |
| 281 | 3300013308 | Ga0157375_10351179 | Ga0157375_103511793 | 247 |
| 282 | 3300014968 | Ga0157379_10004138 | Ga0157379_100041385 | 247 |
| 283 | 3300017792 | Ga0163161_10281715 | Ga0163161_102817152 | 247 |
| 284 | 3300025898 | Ga0207692_10015363 | Ga0207692_100153633 | 247 |
| 285 | 3300025899 | Ga0207642_10171159 | Ga0207642_101711592 | 247 |
| 286 | 3300025906 | Ga0207699_10187701 | Ga0207699_101877012 | 247 |
| 287 | 3300025915 | Ga0207693_10140916 | Ga0207693_101409162 | 247 |
| 288 | 3300025923 | Ga0207681_10068171 | Ga0207681_100681713 | 247 |
| 289 | 3300025924 | Ga0207694_10209105 | Ga0207694_102091053 | 247 |
| 290 | 3300025928 | Ga0207700_10005553 | Ga0207700_100055538 | 247 |
| 291 | 3300025929 | Ga0207664_10120028 | Ga0207664_101200283 | 247 |
| 292 | 3300025934 | Ga0207686_10177896 | Ga0207686_101778962 | 247 |
| 293 | 3300025939 | Ga0207665_10063717 | Ga0207665_100637172 | 247 |
| 294 | 3300025942 | Ga0207689_10026073 | Ga0207689_100260735 | 247 |
| 295 | 3300025944 | Ga0207661_10118293 | Ga0207661_101182934 | 247 |
| 296 | 3300025945 | Ga0207679_10043673 | Ga0207679_100436734 | 247 |
| 297 | 3300025981 | Ga0207640_10248866 | Ga0207640_102488662 | 247 |
| 298 | 3300025986 | Ga0207658_10165243 | Ga0207658_101652433 | 247 |
| 299 | 3300026035 | Ga0207703_10165382 | Ga0207703_101653823 | 247 |
| 300 | 3300026041 | Ga0207639_10255826 | Ga0207639_102558263 | 247 |
| 301 | 3300028379 | Ga0268266_10613426 | Ga0268266_106134262 | 247 |
| 302 | 3300030760 | Ga0265762_1001988 | Ga0265762_10019884 | 247 |
| 303 | 3300035170 | Ga0373943_0171757 | Ga0373943_0171757_174_1007 | 247 |
| 304 | 3300035692 | Ga0373935_0040938 | Ga0373935_0040938_1260_2120 | 247 |
| 305 | 3300035692 | Ga0373935_0280923 | Ga0373935_0280923_263_1111 | 247 |
| 306 | 3300035724 | Ga0373933_0028769 | Ga0373933_0028769_300_1145 | 247 |
| 307 | 3300035724 | Ga0373933_0189851 | Ga0373933_0189851_211_1059 | 247 |
| 308 | 3300036401 | Ga0373937_0093206 | Ga0373937_0093206_1621_2466 | 247 |
| 309 | 3300036401 | Ga0373937_0236070 | Ga0373937_0236070_540_1400 | 247 |
| 310 | 3300046517 | Ga0495630_0356637 | Ga0495630_0356637_134_994 | 247 |
| 311 | 3300046543 | Ga0495645_0127644 | Ga0495645_0127644_816_1676 | 247 |
| 312 | 3300047319 | Ga0495674_0022349 | Ga0495674_0022349_271_1119 | 247 |
| 313 | 3300047319 | Ga0495674_0046114 | Ga0495674_0046114_2713_3573 | 247 |
| 314 | 3300048905 | Ga0496102_0015404 | Ga0496102_0015404_3519_4301 | 247 |
| 315 | 3300048906 | Ga0496103_0014109 | Ga0496103_0014109_1025_1807 | 247 |
| 316 | 3300048907 | Ga0496104_0014057 | Ga0496104_0014057_2007_2789 | 247 |
| 317 | 3300048909 | Ga0496106_0035779 | Ga0496106_0035779_454_1236 | 247 |
| 318 | 3300048910 | Ga0496107_0117036 | Ga0496107_0117036_55_837 | 247 |
| 319 | 3300048916 | Ga0496113_0248108 | Ga0496113_0248108_582_1364 | 247 |
| 320 | 3300050513 | nmdc:mga0rr50_432027_c1 | nmdc:mga0rr50_432027_c1_27_869 | 247 |
| 321 | 3300005334 | Ga0068869_100005013 | Ga0068869_1000050137 | 248 |
| 322 | 3300005338 | Ga0068868_100084460 | Ga0068868_1000844603 | 248 |
| 323 | 3300005441 | Ga0070700_100419361 | Ga0070700_1004193611 | 248 |
| 324 | 3300005445 | Ga0070708_100071788 | Ga0070708_1000717883 | 248 |
| 325 | 3300005459 | Ga0068867_100200660 | Ga0068867_1002006601 | 248 |
| 326 | 3300005467 | Ga0070706_100279323 | Ga0070706_1002793232 | 248 |
| 327 | 3300005617 | Ga0068859_100018009 | Ga0068859_1000180092 | 248 |
| 328 | 3300005842 | Ga0068858_100003905 | Ga0068858_1000039052 | 248 |
| 329 | 3300005844 | Ga0068862_100096372 | Ga0068862_1000963722 | 248 |
| 330 | 3300006175 | Ga0070712_100150346 | Ga0070712_1001503462 | 248 |
| 331 | 3300006881 | Ga0068865_100065979 | Ga0068865_1000659793 | 248 |
| 332 | 3300006931 | Ga0097620_100018009 | Ga0097620_1000180092 | 248 |
| 333 | 3300009098 | Ga0105245_10136625 | Ga0105245_101366253 | 248 |
| 334 | 3300009545 | Ga0105237_10032309 | Ga0105237_100323096 | 248 |
| 335 | 3300010375 | Ga0105239_10032973 | Ga0105239_100329732 | 248 |
| 336 | 3300013296 | Ga0157374_10002450 | Ga0157374_100024504 | 248 |
| 337 | 3300013306 | Ga0163162_10031676 | Ga0163162_100316765 | 248 |
| 338 | 3300014968 | Ga0157379_10146181 | Ga0157379_101461813 | 248 |
| 339 | 3300025899 | Ga0207642_10125451 | Ga0207642_101254512 | 248 |
| 340 | 3300025910 | Ga0207684_10216174 | Ga0207684_102161743 | 248 |
| 341 | 3300025915 | Ga0207693_10200397 | Ga0207693_102003973 | 248 |
| 342 | 3300025915 | Ga0207693_10357030 | Ga0207693_103570302 | 248 |
| 343 | 3300025929 | Ga0207664_10150295 | Ga0207664_101502952 | 248 |
| 344 | 3300025942 | Ga0207689_10000788 | Ga0207689_1000078817 | 248 |
| 345 | 3300026023 | Ga0207677_10031822 | Ga0207677_100318221 | 248 |
| 346 | 3300026035 | Ga0207703_10005982 | Ga0207703_100059824 | 248 |
| 347 | 3300026041 | Ga0207639_10181844 | Ga0207639_101818443 | 248 |
| 348 | 3300026075 | Ga0207708_10447663 | Ga0207708_104476632 | 248 |
| 349 | 3300028380 | Ga0268265_10531415 | Ga0268265_105314151 | 248 |
| 350 | 3300028381 | Ga0268264_10051570 | Ga0268264_100515702 | 248 |
| 351 | 3300031249 | Ga0265339_10061810 | Ga0265339_100618103 | 248 |
| 352 | 3300035695 | Ga0373927_0201130 | Ga0373927_0201130_345_1202 | 248 |
| 353 | 3300035725 | Ga0373947_0125667 | Ga0373947_0125667_193_1050 | 248 |
| 354 | 3300046472 | Ga0495580_0005055 | Ga0495580_0005055_8135_8950 | 248 |
| 355 | 3300046472 | Ga0495580_0010833 | Ga0495580_0010833_4177_5034 | 248 |
| 356 | 3300048914 | Ga0496111_0358550 | Ga0496111_0358550_211_1014 | 248 |
| 357 | 3300048915 | Ga0496112_0001953 | Ga0496112_0001953_13221_14024 | 248 |
| 358 | 3300005434 | Ga0070709_10028860 | Ga0070709_100288604 | 249 |
| 359 | 3300005436 | Ga0070713_100247965 | Ga0070713_1002479653 | 249 |
| 360 | 3300005445 | Ga0070708_100034096 | Ga0070708_1000340962 | 249 |
| 361 | 3300005518 | Ga0070699_100025429 | Ga0070699_1000254294 | 249 |
| 362 | 3300005614 | Ga0068856_100647396 | Ga0068856_1006473961 | 249 |
| 363 | 3300006028 | Ga0070717_10006485 | Ga0070717_100064855 | 249 |
| 364 | 3300009101 | Ga0105247_10262041 | Ga0105247_102620412 | 249 |
| 365 | 3300014968 | Ga0157379_10125002 | Ga0157379_101250023 | 249 |
| 366 | 3300025928 | Ga0207700_10128012 | Ga0207700_101280122 | 249 |
| 367 | 3300026078 | Ga0207702_10149489 | Ga0207702_101494893 | 249 |
| 368 | 3300031090 | Ga0265760_10000599 | Ga0265760_100005995 | 249 |
| 369 | 3300031247 | Ga0265340_10063336 | Ga0265340_100633362 | 249 |
| 370 | 3300031344 | Ga0265316_10038118 | Ga0265316_100381184 | 249 |
| 371 | 3300035725 | Ga0373947_0185149 | Ga0373947_0185149_295_1152 | 249 |
| 372 | 3300046472 | Ga0495580_0006797 | Ga0495580_0006797_381_1238 | 249 |
| 373 | 3300005434 | Ga0070709_10230519 | Ga0070709_102305192 | 250 |
| 374 | 3300005434 | Ga0070709_10501164 | Ga0070709_105011641 | 250 |
| 375 | 3300005437 | Ga0070710_10030400 | Ga0070710_100304003 | 250 |
| 376 | 3300005471 | Ga0070698_100085199 | Ga0070698_1000851993 | 250 |
| 377 | 3300006028 | Ga0070717_10104044 | Ga0070717_101040443 | 250 |
| 378 | 3300006852 | Ga0075433_10018081 | Ga0075433_100180811 | 250 |
| 379 | 3300006871 | Ga0075434_100006334 | Ga0075434_1000063347 | 250 |
| 380 | 3300007076 | Ga0075435_100218125 | Ga0075435_1002181252 | 250 |
| 381 | 3300025906 | Ga0207699_10167265 | Ga0207699_101672652 | 250 |
| 382 | 3300025910 | Ga0207684_10057475 | Ga0207684_100574752 | 250 |
| 383 | 3300026023 | Ga0207677_10014999 | Ga0207677_100149993 | 250 |
| 384 | 3300030879 | Ga0265765_1002398 | Ga0265765_10023982 | 250 |
| 385 | 3300046472 | Ga0495580_0084543 | Ga0495580_0084543_1061_1876 | 250 |
| 386 | 3300046472 | Ga0495580_0134094 | Ga0495580_0134094_877_1689 | 250 |
| 387 | 3300046472 | Ga0495580_0281597 | Ga0495580_0281597_73_912 | 250 |
| 388 | 3300050512 | nmdc:mga0n895_4619_c1 | nmdc:mga0n895_4619_c1_3883_4704 | 250 |
| 389 | 3300050513 | nmdc:mga0rr50_139752_c1 | nmdc:mga0rr50_139752_c1_464_1285 | 250 |
| 390 | 3300050515 | nmdc:mga0a205_23451_c1 | nmdc:mga0a205_23451_c1_4342_5163 | 250 |
| 391 | 3300005434 | Ga0070709_10169412 | Ga0070709_101694121 | 251 |
| 392 | 3300005435 | Ga0070714_100093450 | Ga0070714_1000934502 | 251 |
| 393 | 3300005435 | Ga0070714_100428047 | Ga0070714_1004280471 | 251 |
| 394 | 3300005445 | Ga0070708_100156735 | Ga0070708_1001567353 | 251 |
| 395 | 3300005467 | Ga0070706_100350143 | Ga0070706_1003501432 | 251 |
| 396 | 3300005468 | Ga0070707_100247308 | Ga0070707_1002473084 | 251 |
| 397 | 3300006175 | Ga0070712_100044643 | Ga0070712_1000446434 | 251 |
| 398 | 3300006914 | Ga0075436_100083203 | Ga0075436_1000832032 | 251 |
| 399 | 3300014969 | Ga0157376_10873879 | Ga0157376_108738791 | 251 |
| 400 | 3300024225 | Ga0224572_1007744 | Ga0224572_10077442 | 251 |
| 401 | 3300024227 | Ga0228598_1005499 | Ga0228598_10054992 | 251 |
| 402 | 3300025906 | Ga0207699_10062563 | Ga0207699_100625631 | 251 |
| 403 | 3300025910 | Ga0207684_10107579 | Ga0207684_101075793 | 251 |
| 404 | 3300025913 | Ga0207695_10012611 | Ga0207695_100126118 | 251 |
| 405 | 3300025928 | Ga0207700_10231339 | Ga0207700_102313392 | 251 |
| 406 | 3300025929 | Ga0207664_10101560 | Ga0207664_101015603 | 251 |
| 407 | 3300028800 | Ga0265338_10145770 | Ga0265338_101457703 | 251 |
| 408 | 3300031235 | Ga0265330_10008062 | Ga0265330_100080624 | 251 |
| 409 | 3300031241 | Ga0265325_10037851 | Ga0265325_100378513 | 251 |
| 410 | 3300047319 | Ga0495674_0081276 | Ga0495674_0081276_213_1070 | 251 |
| 411 | 3300005290 | Ga0065712_10012754 | Ga0065712_100127545 | 252 |
| 412 | 3300005327 | Ga0070658_10222701 | Ga0070658_102227011 | 252 |
| 413 | 3300005331 | Ga0070670_100140082 | Ga0070670_1001400822 | 252 |
| 414 | 3300005337 | Ga0070682_100189805 | Ga0070682_1001898051 | 252 |
| 415 | 3300005339 | Ga0070660_100039184 | Ga0070660_1000391844 | 252 |
| 416 | 3300005344 | Ga0070661_100124528 | Ga0070661_1001245281 | 252 |
| 417 | 3300005345 | Ga0070692_10358368 | Ga0070692_103583681 | 252 |
| 418 | 3300005366 | Ga0070659_100097351 | Ga0070659_1000973513 | 252 |
| 419 | 3300005434 | Ga0070709_10166165 | Ga0070709_101661651 | 252 |
| 420 | 3300005457 | Ga0070662_100028429 | Ga0070662_1000284295 | 252 |
| 421 | 3300005458 | Ga0070681_10340082 | Ga0070681_103400821 | 252 |
| 422 | 3300005530 | Ga0070679_100158480 | Ga0070679_1001584802 | 252 |
| 423 | 3300005535 | Ga0070684_100080931 | Ga0070684_1000809312 | 252 |
| 424 | 3300005539 | Ga0068853_100119350 | Ga0068853_1001193503 | 252 |
| 425 | 3300005563 | Ga0068855_100167179 | Ga0068855_1001671792 | 252 |
| 426 | 3300005564 | Ga0070664_100042196 | Ga0070664_1000421964 | 252 |
| 427 | 3300005577 | Ga0068857_100179694 | Ga0068857_1001796941 | 252 |
| 428 | 3300005578 | Ga0068854_100167452 | Ga0068854_1001674522 | 252 |
| 429 | 3300005614 | Ga0068856_100173176 | Ga0068856_1001731762 | 252 |
| 430 | 3300005618 | Ga0068864_100272688 | Ga0068864_1002726882 | 252 |
| 431 | 3300005834 | Ga0068851_10028964 | Ga0068851_100289644 | 252 |
| 432 | 3300005841 | Ga0068863_100083550 | Ga0068863_1000835505 | 252 |
| 433 | 3300006028 | Ga0070717_10256469 | Ga0070717_102564692 | 252 |
| 434 | 3300009093 | Ga0105240_10166863 | Ga0105240_101668632 | 252 |
| 435 | 3300009093 | Ga0105240_10253790 | Ga0105240_102537902 | 252 |
| 436 | 3300009545 | Ga0105237_10042776 | Ga0105237_100427764 | 252 |
| 437 | 3300010375 | Ga0105239_10090842 | Ga0105239_100908423 | 252 |
| 438 | 3300013105 | Ga0157369_10183867 | Ga0157369_101838671 | 252 |
| 439 | 3300013296 | Ga0157374_10129725 | Ga0157374_101297252 | 252 |
| 440 | 3300013297 | Ga0157378_10080384 | Ga0157378_100803842 | 252 |
| 441 | 3300013297 | Ga0157378_10230242 | Ga0157378_102302422 | 252 |
| 442 | 3300013307 | Ga0157372_10108506 | Ga0157372_101085063 | 252 |
| 443 | 3300015265 | Ga0182005_1019017 | Ga0182005_10190172 | 252 |
| 444 | 3300024227 | Ga0228598_1004351 | Ga0228598_10043513 | 252 |
| 445 | 3300025321 | Ga0207656_10015696 | Ga0207656_100156963 | 252 |
| 446 | 3300025904 | Ga0207647_10000903 | Ga0207647_1000090320 | 252 |
| 447 | 3300025909 | Ga0207705_10239633 | Ga0207705_102396332 | 252 |
| 448 | 3300025919 | Ga0207657_10028691 | Ga0207657_100286914 | 252 |
| 449 | 3300025922 | Ga0207646_10292427 | Ga0207646_102924272 | 252 |
| 450 | 3300025932 | Ga0207690_10031811 | Ga0207690_100318112 | 252 |
| 451 | 3300025933 | Ga0207706_10087946 | Ga0207706_100879463 | 252 |
| 452 | 3300025939 | Ga0207665_10347106 | Ga0207665_103471062 | 252 |
| 453 | 3300025945 | Ga0207679_10066596 | Ga0207679_100665964 | 252 |
| 454 | 3300025981 | Ga0207640_10035589 | Ga0207640_100355892 | 252 |
| 455 | 3300026041 | Ga0207639_10192197 | Ga0207639_101921972 | 252 |
| 456 | 3300026088 | Ga0207641_10149681 | Ga0207641_101496812 | 252 |
| 457 | 3300026089 | Ga0207648_10016467 | Ga0207648_100164671 | 252 |
| 458 | 3300026095 | Ga0207676_10166498 | Ga0207676_101664982 | 252 |
| 459 | 3300026116 | Ga0207674_10133203 | Ga0207674_101332034 | 252 |
| 460 | 3300026118 | Ga0207675_100093618 | Ga0207675_1000936181 | 252 |
| 461 | 3300028800 | Ga0265338_10035271 | Ga0265338_100352715 | 252 |
| 462 | 3300039437 | Ga0436365_0109293 | Ga0436365_0109293_425_1243 | 252 |
| 463 | 3300039453 | Ga0436362_1207079 | Ga0436362_1207079_944_1762 | 252 |
| 464 | 3300048904 | Ga0496101_0089877 | Ga0496101_0089877_1142_1957 | 252 |
| 465 | 3300048905 | Ga0496102_0100333 | Ga0496102_0100333_850_1665 | 252 |
| 466 | 3300048906 | Ga0496103_0079682 | Ga0496103_0079682_682_1497 | 252 |
| 467 | 3300048909 | Ga0496106_0263429 | Ga0496106_0263429_358_1173 | 252 |
| 468 | 3300048912 | Ga0496109_0158738 | Ga0496109_0158738_1092_1907 | 252 |
| 469 | 3300048913 | Ga0496110_0106280 | Ga0496110_0106280_938_1753 | 252 |
| 470 | 3300048914 | Ga0496111_0031062 | Ga0496111_0031062_1836_2651 | 252 |
| 471 | 3300048915 | Ga0496112_0591966 | Ga0496112_0591966_219_1016 | 252 |
| 472 | 3300048916 | Ga0496113_0315149 | Ga0496113_0315149_27_842 | 252 |
| 473 | 3300005436 | Ga0070713_100132471 | Ga0070713_1001324713 | 253 |
| 474 | 3300005445 | Ga0070708_100001971 | Ga0070708_1000019717 | 253 |
| 475 | 3300005445 | Ga0070708_100213945 | Ga0070708_1002139452 | 253 |
| 476 | 3300005467 | Ga0070706_100000173 | Ga0070706_10000017373 | 253 |
| 477 | 3300005467 | Ga0070706_100006446 | Ga0070706_10000644612 | 253 |
| 478 | 3300005468 | Ga0070707_100009403 | Ga0070707_1000094032 | 253 |
| 479 | 3300005468 | Ga0070707_100009720 | Ga0070707_1000097209 | 253 |
| 480 | 3300005471 | Ga0070698_100002711 | Ga0070698_10000271111 | 253 |
| 481 | 3300005471 | Ga0070698_100009217 | Ga0070698_1000092172 | 253 |
| 482 | 3300005518 | Ga0070699_100004975 | Ga0070699_1000049752 | 253 |
| 483 | 3300005518 | Ga0070699_100048432 | Ga0070699_1000484324 | 253 |
| 484 | 3300005536 | Ga0070697_100001978 | Ga0070697_1000019782 | 253 |
| 485 | 3300005536 | Ga0070697_100013157 | Ga0070697_1000131573 | 253 |
| 486 | 3300005536 | Ga0070697_100015949 | Ga0070697_1000159496 | 253 |
| 487 | 3300005841 | Ga0068863_100513782 | Ga0068863_1005137821 | 253 |
| 488 | 3300005843 | Ga0068860_100153069 | Ga0068860_1001530694 | 253 |
| 489 | 3300006028 | Ga0070717_10053353 | Ga0070717_100533534 | 253 |
| 490 | 3300009092 | Ga0105250_10044260 | Ga0105250_100442602 | 253 |
| 491 | 3300009177 | Ga0105248_10435967 | Ga0105248_104359671 | 253 |
| 492 | 3300013306 | Ga0163162_10069055 | Ga0163162_100690551 | 253 |
| 493 | 3300025910 | Ga0207684_10000267 | Ga0207684_1000026765 | 253 |
| 494 | 3300025910 | Ga0207684_10001492 | Ga0207684_1000149221 | 253 |
| 495 | 3300025916 | Ga0207663_10088829 | Ga0207663_100888292 | 253 |
| 496 | 3300025922 | Ga0207646_10001228 | Ga0207646_100012287 | 253 |
| 497 | 3300025922 | Ga0207646_10009914 | Ga0207646_100099148 | 253 |
| 498 | 3300025928 | Ga0207700_10062156 | Ga0207700_100621563 | 253 |
| 499 | 3300026088 | Ga0207641_10248327 | Ga0207641_102483272 | 253 |
| 500 | 3300026095 | Ga0207676_10572049 | Ga0207676_105720491 | 253 |
| 501 | 3300048905 | Ga0496102_0323029 | Ga0496102_0323029_250_1050 | 253 |
| 502 | 3300005293 | Ga0065715_10110383 | Ga0065715_101103833 | 254 |
| 503 | 3300005329 | Ga0070683_100079235 | Ga0070683_1000792353 | 254 |
| 504 | 3300005330 | Ga0070690_100183060 | Ga0070690_1001830602 | 254 |
| 505 | 3300005335 | Ga0070666_10042107 | Ga0070666_100421072 | 254 |
| 506 | 3300005336 | Ga0070680_100101665 | Ga0070680_1001016652 | 254 |
| 507 | 3300005337 | Ga0070682_100002630 | Ga0070682_1000026309 | 254 |
| 508 | 3300005338 | Ga0068868_100219676 | Ga0068868_1002196761 | 254 |
| 509 | 3300005343 | Ga0070687_100139984 | Ga0070687_1001399842 | 254 |
| 510 | 3300005367 | Ga0070667_100072289 | Ga0070667_1000722893 | 254 |
| 511 | 3300005434 | Ga0070709_10008424 | Ga0070709_100084242 | 254 |
| 512 | 3300005434 | Ga0070709_10412151 | Ga0070709_104121512 | 254 |
| 513 | 3300005435 | Ga0070714_100143587 | Ga0070714_1001435872 | 254 |
| 514 | 3300005437 | Ga0070710_10064638 | Ga0070710_100646382 | 254 |
| 515 | 3300005439 | Ga0070711_100412841 | Ga0070711_1004128411 | 254 |
| 516 | 3300005467 | Ga0070706_100001330 | Ga0070706_10000133021 | 254 |
| 517 | 3300005535 | Ga0070684_100041470 | Ga0070684_1000414706 | 254 |
| 518 | 3300005536 | Ga0070697_100000389 | Ga0070697_10000038924 | 254 |
| 519 | 3300005546 | Ga0070696_100184200 | Ga0070696_1001842001 | 254 |
| 520 | 3300005547 | Ga0070693_100019577 | Ga0070693_1000195773 | 254 |
| 521 | 3300005547 | Ga0070693_100120149 | Ga0070693_1001201492 | 254 |
| 522 | 3300005548 | Ga0070665_100042008 | Ga0070665_1000420083 | 254 |
| 523 | 3300005578 | Ga0068854_100002075 | Ga0068854_10000207511 | 254 |
| 524 | 3300005617 | Ga0068859_100023995 | Ga0068859_1000239955 | 254 |
| 525 | 3300005718 | Ga0068866_10011374 | Ga0068866_100113744 | 254 |
| 526 | 3300005834 | Ga0068851_10008550 | Ga0068851_100085501 | 254 |
| 527 | 3300005843 | Ga0068860_100011552 | Ga0068860_1000115527 | 254 |
| 528 | 3300005844 | Ga0068862_100008948 | Ga0068862_1000089482 | 254 |
| 529 | 3300005844 | Ga0068862_100184422 | Ga0068862_1001844223 | 254 |
| 530 | 3300006163 | Ga0070715_10017279 | Ga0070715_100172793 | 254 |
| 531 | 3300006173 | Ga0070716_100010654 | Ga0070716_1000106544 | 254 |
| 532 | 3300006173 | Ga0070716_100059240 | Ga0070716_1000592401 | 254 |
| 533 | 3300006175 | Ga0070712_100479294 | Ga0070712_1004792942 | 254 |
| 534 | 3300006881 | Ga0068865_100124149 | Ga0068865_1001241492 | 254 |
| 535 | 3300006931 | Ga0097620_100023993 | Ga0097620_1000239935 | 254 |
| 536 | 3300009093 | Ga0105240_10461851 | Ga0105240_104618512 | 254 |
| 537 | 3300009098 | Ga0105245_10011889 | Ga0105245_100118893 | 254 |
| 538 | 3300009101 | Ga0105247_10022118 | Ga0105247_100221184 | 254 |
| 539 | 3300009176 | Ga0105242_10222624 | Ga0105242_102226241 | 254 |
| 540 | 3300009545 | Ga0105237_10218829 | Ga0105237_102188293 | 254 |
| 541 | 3300009551 | Ga0105238_10325517 | Ga0105238_103255172 | 254 |
| 542 | 3300009553 | Ga0105249_10009980 | Ga0105249_100099807 | 254 |
| 543 | 3300013102 | Ga0157371_10021750 | Ga0157371_100217503 | 254 |
| 544 | 3300013104 | Ga0157370_10162084 | Ga0157370_101620843 | 254 |
| 545 | 3300013105 | Ga0157369_10050541 | Ga0157369_100505414 | 254 |
| 546 | 3300013296 | Ga0157374_10062745 | Ga0157374_100627452 | 254 |
| 547 | 3300013306 | Ga0163162_10001911 | Ga0163162_1000191111 | 254 |
| 548 | 3300014325 | Ga0163163_10020316 | Ga0163163_100203163 | 254 |
| 549 | 3300014969 | Ga0157376_10038613 | Ga0157376_100386133 | 254 |
| 550 | 3300025898 | Ga0207692_10039661 | Ga0207692_100396612 | 254 |
| 551 | 3300025900 | Ga0207710_10054998 | Ga0207710_100549983 | 254 |
| 552 | 3300025905 | Ga0207685_10013586 | Ga0207685_100135863 | 254 |
| 553 | 3300025906 | Ga0207699_10006411 | Ga0207699_100064112 | 254 |
| 554 | 3300025906 | Ga0207699_10019041 | Ga0207699_100190412 | 254 |
| 555 | 3300025907 | Ga0207645_10035862 | Ga0207645_100358623 | 254 |
| 556 | 3300025910 | Ga0207684_10022758 | Ga0207684_100227584 | 254 |
| 557 | 3300025913 | Ga0207695_10021580 | Ga0207695_100215802 | 254 |
| 558 | 3300025916 | Ga0207663_10020803 | Ga0207663_100208035 | 254 |
| 559 | 3300025916 | Ga0207663_10218874 | Ga0207663_102188741 | 254 |
| 560 | 3300025919 | Ga0207657_10007959 | Ga0207657_100079599 | 254 |
| 561 | 3300025921 | Ga0207652_10386872 | Ga0207652_103868722 | 254 |
| 562 | 3300025922 | Ga0207646_10449438 | Ga0207646_104494381 | 254 |
| 563 | 3300025927 | Ga0207687_10000653 | Ga0207687_100006533 | 254 |
| 564 | 3300025933 | Ga0207706_10000102 | Ga0207706_1000010212 | 254 |
| 565 | 3300025939 | Ga0207665_10000313 | Ga0207665_1000031322 | 254 |
| 566 | 3300025941 | Ga0207711_10002678 | Ga0207711_1000267812 | 254 |
| 567 | 3300025949 | Ga0207667_10005798 | Ga0207667_100057988 | 254 |
| 568 | 3300025972 | Ga0207668_10029002 | Ga0207668_100290023 | 254 |
| 569 | 3300026023 | Ga0207677_10004059 | Ga0207677_100040593 | 254 |
| 570 | 3300026067 | Ga0207678_10005273 | Ga0207678_100052738 | 254 |
| 571 | 3300026089 | Ga0207648_10103008 | Ga0207648_101030084 | 254 |
| 572 | 3300028017 | Ga0265356_1002791 | Ga0265356_10027912 | 254 |
| 573 | 3300031241 | Ga0265325_10103160 | Ga0265325_101031602 | 254 |
| 574 | 3300035085 | Ga0373929_0002552 | Ga0373929_0002552_1370_2230 | 254 |
| 575 | 3300035241 | Ga0373961_0072285 | Ga0373961_0072285_159_1049 | 254 |
| 576 | 3300035242 | Ga0373962_0039798 | Ga0373962_0039798_10_870 | 254 |
| 577 | 3300035691 | Ga0373931_0042332 | Ga0373931_0042332_750_1610 | 254 |
| 578 | 3300046472 | Ga0495580_0253457 | Ga0495580_0253457_76_888 | 254 |
| 579 | 3300048904 | Ga0496101_0235719 | Ga0496101_0235719_403_1293 | 254 |
| 580 | 3300048905 | Ga0496102_0067241 | Ga0496102_0067241_469_1329 | 254 |
| 581 | 3300048905 | Ga0496102_0210163 | Ga0496102_0210163_969_1787 | 254 |
| 582 | 3300048906 | Ga0496103_0129954 | Ga0496103_0129954_664_1554 | 254 |
| 583 | 3300048911 | Ga0496108_0121361 | Ga0496108_0121361_1008_1898 | 254 |
| 584 | 3300048912 | Ga0496109_0075613 | Ga0496109_0075613_275_1165 | 254 |
| 585 | 3300048915 | Ga0496112_0484329 | Ga0496112_0484329_313_1125 | 254 |
| 586 | 3300004803 | Ga0058862_12671333 | Ga0058862_126713332 | 255 |
| 587 | 3300005331 | Ga0070670_100140689 | Ga0070670_1001406892 | 255 |
| 588 | 3300005334 | Ga0068869_100101226 | Ga0068869_1001012262 | 255 |
| 589 | 3300005435 | Ga0070714_100076929 | Ga0070714_1000769294 | 255 |
| 590 | 3300005436 | Ga0070713_100183271 | Ga0070713_1001832712 | 255 |
| 591 | 3300005445 | Ga0070708_100026409 | Ga0070708_1000264091 | 255 |
| 592 | 3300005456 | Ga0070678_100409109 | Ga0070678_1004091092 | 255 |
| 593 | 3300005467 | Ga0070706_100412696 | Ga0070706_1004126962 | 255 |
| 594 | 3300005518 | Ga0070699_100136793 | Ga0070699_1001367932 | 255 |
| 595 | 3300005536 | Ga0070697_100120348 | Ga0070697_1001203482 | 255 |
| 596 | 3300005564 | Ga0070664_100401155 | Ga0070664_1004011553 | 255 |
| 597 | 3300006028 | Ga0070717_10005049 | Ga0070717_100050495 | 255 |
| 598 | 3300006175 | Ga0070712_100175505 | Ga0070712_1001755052 | 255 |
| 599 | 3300006237 | Ga0097621_100367147 | Ga0097621_1003671472 | 255 |
| 600 | 3300007076 | Ga0075435_100116605 | Ga0075435_1001166052 | 255 |
| 601 | 3300013296 | Ga0157374_10168532 | Ga0157374_101685321 | 255 |
| 602 | 3300014325 | Ga0163163_10232342 | Ga0163163_102323422 | 255 |
| 603 | 3300024227 | Ga0228598_1003051 | Ga0228598_10030514 | 255 |
| 604 | 3300025911 | Ga0207654_10113749 | Ga0207654_101137491 | 255 |
| 605 | 3300025914 | Ga0207671_10124011 | Ga0207671_101240113 | 255 |
| 606 | 3300025915 | Ga0207693_10168345 | Ga0207693_101683452 | 255 |
| 607 | 3300025922 | Ga0207646_10059625 | Ga0207646_100596255 | 255 |
| 608 | 3300025929 | Ga0207664_10179778 | Ga0207664_101797783 | 255 |
| 609 | 3300025939 | Ga0207665_10249084 | Ga0207665_102490843 | 255 |
| 610 | 3300025942 | Ga0207689_10106656 | Ga0207689_101066563 | 255 |
| 611 | 3300025981 | Ga0207640_10568507 | Ga0207640_105685071 | 255 |
| 612 | 3300026121 | Ga0207683_10226056 | Ga0207683_102260563 | 255 |
| 613 | 3300035691 | Ga0373931_0068945 | Ga0373931_0068945_646_1503 | 255 |
| 614 | 3300048918 | Ga0496115_0155860 | Ga0496115_0155860_386_1210 | 255 |
| 615 | 3300050513 | nmdc:mga0rr50_265403_c1 | nmdc:mga0rr50_265403_c1_327_1139 | 255 |
| 616 | 2162886012 | MBSR1b_contig_9625197 | MBSR1b_0921.00002720 | 256 |
| 617 | 3300002075 | JGI24738J21930_10017364 | JGI24738J21930_100173642 | 256 |
| 618 | 3300002076 | JGI24749J21850_1008375 | JGI24749J21850_10083751 | 256 |
| 619 | 3300002239 | JGI24034J26672_10004616 | JGI24034J26672_100046161 | 256 |
| 620 | 3300002459 | JGI24751J29686_10008402 | JGI24751J29686_100084023 | 256 |
| 621 | 3300005293 | Ga0065715_10115978 | Ga0065715_101159783 | 256 |
| 622 | 3300005327 | Ga0070658_10100531 | Ga0070658_101005313 | 256 |
| 623 | 3300005328 | Ga0070676_10086462 | Ga0070676_100864621 | 256 |
| 624 | 3300005329 | Ga0070683_100092640 | Ga0070683_1000926403 | 256 |
| 625 | 3300005330 | Ga0070690_100005450 | Ga0070690_1000054504 | 256 |
| 626 | 3300005333 | Ga0070677_10006921 | Ga0070677_100069213 | 256 |
| 627 | 3300005334 | Ga0068869_100028015 | Ga0068869_1000280154 | 256 |
| 628 | 3300005335 | Ga0070666_10045866 | Ga0070666_100458662 | 256 |
| 629 | 3300005338 | Ga0068868_100047171 | Ga0068868_1000471714 | 256 |
| 630 | 3300005339 | Ga0070660_100131685 | Ga0070660_1001316852 | 256 |
| 631 | 3300005340 | Ga0070689_100040587 | Ga0070689_1000405871 | 256 |
| 632 | 3300005341 | Ga0070691_10272379 | Ga0070691_102723791 | 256 |
| 633 | 3300005343 | Ga0070687_100003791 | Ga0070687_1000037915 | 256 |
| 634 | 3300005347 | Ga0070668_100005248 | Ga0070668_1000052488 | 256 |
| 635 | 3300005353 | Ga0070669_100066648 | Ga0070669_1000666483 | 256 |
| 636 | 3300005354 | Ga0070675_100017919 | Ga0070675_1000179192 | 256 |
| 637 | 3300005355 | Ga0070671_100086528 | Ga0070671_1000865282 | 256 |
| 638 | 3300005356 | Ga0070674_100069317 | Ga0070674_1000693173 | 256 |
| 639 | 3300005364 | Ga0070673_100069199 | Ga0070673_1000691993 | 256 |
| 640 | 3300005365 | Ga0070688_100071053 | Ga0070688_1000710533 | 256 |
| 641 | 3300005366 | Ga0070659_100068692 | Ga0070659_1000686923 | 256 |
| 642 | 3300005367 | Ga0070667_100045357 | Ga0070667_1000453572 | 256 |
| 643 | 3300005455 | Ga0070663_100011290 | Ga0070663_1000112905 | 256 |
| 644 | 3300005457 | Ga0070662_100067835 | Ga0070662_1000678353 | 256 |
| 645 | 3300005459 | Ga0068867_100004171 | Ga0068867_1000041718 | 256 |
| 646 | 3300005466 | Ga0070685_10019163 | Ga0070685_100191634 | 256 |
| 647 | 3300005467 | Ga0070706_100509317 | Ga0070706_1005093172 | 256 |
| 648 | 3300005535 | Ga0070684_100060175 | Ga0070684_1000601753 | 256 |
| 649 | 3300005539 | Ga0068853_100088646 | Ga0068853_1000886463 | 256 |
| 650 | 3300005543 | Ga0070672_100007893 | Ga0070672_1000078934 | 256 |
| 651 | 3300005544 | Ga0070686_100007812 | Ga0070686_1000078124 | 256 |
| 652 | 3300005563 | Ga0068855_100141018 | Ga0068855_1001410183 | 256 |
| 653 | 3300005577 | Ga0068857_100298295 | Ga0068857_1002982951 | 256 |
| 654 | 3300005614 | Ga0068856_100080672 | Ga0068856_1000806723 | 256 |
| 655 | 3300005615 | Ga0070702_100026990 | Ga0070702_1000269904 | 256 |
| 656 | 3300005616 | Ga0068852_100004761 | Ga0068852_1000047613 | 256 |
| 657 | 3300005617 | Ga0068859_100133591 | Ga0068859_1001335912 | 256 |
| 658 | 3300005718 | Ga0068866_10025164 | Ga0068866_100251643 | 256 |
| 659 | 3300005719 | Ga0068861_100290149 | Ga0068861_1002901492 | 256 |
| 660 | 3300005834 | Ga0068851_10094637 | Ga0068851_100946372 | 256 |
| 661 | 3300005840 | Ga0068870_10015319 | Ga0068870_100153194 | 256 |
| 662 | 3300005842 | Ga0068858_100320880 | Ga0068858_1003208801 | 256 |
| 663 | 3300005843 | Ga0068860_100123140 | Ga0068860_1001231403 | 256 |
| 664 | 3300005844 | Ga0068862_100160178 | Ga0068862_1001601782 | 256 |
| 665 | 3300006358 | Ga0068871_100309947 | Ga0068871_1003099471 | 256 |
| 666 | 3300006881 | Ga0068865_100068595 | Ga0068865_1000685953 | 256 |
| 667 | 3300006931 | Ga0097620_100133597 | Ga0097620_1001335972 | 256 |
| 668 | 3300009098 | Ga0105245_10039167 | Ga0105245_100391675 | 256 |
| 669 | 3300009101 | Ga0105247_10025982 | Ga0105247_100259824 | 256 |
| 670 | 3300009174 | Ga0105241_10089749 | Ga0105241_100897493 | 256 |
| 671 | 3300009176 | Ga0105242_10140130 | Ga0105242_101401302 | 256 |
| 672 | 3300009177 | Ga0105248_10247172 | Ga0105248_102471722 | 256 |
| 673 | 3300009545 | Ga0105237_10168145 | Ga0105237_101681452 | 256 |
| 674 | 3300009553 | Ga0105249_10037822 | Ga0105249_100378224 | 256 |
| 675 | 3300010375 | Ga0105239_10047821 | Ga0105239_100478215 | 256 |
| 676 | 3300011119 | Ga0105246_10121128 | Ga0105246_101211282 | 256 |
| 677 | 3300013100 | Ga0157373_10062503 | Ga0157373_100625033 | 256 |
| 678 | 3300013102 | Ga0157371_10049540 | Ga0157371_100495403 | 256 |
| 679 | 3300013105 | Ga0157369_10031967 | Ga0157369_100319673 | 256 |
| 680 | 3300013296 | Ga0157374_10157790 | Ga0157374_101577903 | 256 |
| 681 | 3300013297 | Ga0157378_10143990 | Ga0157378_101439902 | 256 |
| 682 | 3300013306 | Ga0163162_10144535 | Ga0163162_101445353 | 256 |
| 683 | 3300013307 | Ga0157372_10050349 | Ga0157372_100503494 | 256 |
| 684 | 3300013308 | Ga0157375_10191345 | Ga0157375_101913453 | 256 |
| 685 | 3300014325 | Ga0163163_10034896 | Ga0163163_100348964 | 256 |
| 686 | 3300014326 | Ga0157380_10083580 | Ga0157380_100835803 | 256 |
| 687 | 3300014745 | Ga0157377_10017724 | Ga0157377_100177244 | 256 |
| 688 | 3300014968 | Ga0157379_10080461 | Ga0157379_100804613 | 256 |
| 689 | 3300014969 | Ga0157376_10110237 | Ga0157376_101102372 | 256 |
| 690 | 3300017792 | Ga0163161_10046137 | Ga0163161_100461373 | 256 |
| 691 | 3300025899 | Ga0207642_10049539 | Ga0207642_100495393 | 256 |
| 692 | 3300025900 | Ga0207710_10026561 | Ga0207710_100265611 | 256 |
| 693 | 3300025903 | Ga0207680_10031443 | Ga0207680_100314434 | 256 |
| 694 | 3300025904 | Ga0207647_10010492 | Ga0207647_100104923 | 256 |
| 695 | 3300025907 | Ga0207645_10057670 | Ga0207645_100576703 | 256 |
| 696 | 3300025908 | Ga0207643_10004784 | Ga0207643_100047844 | 256 |
| 697 | 3300025909 | Ga0207705_10149758 | Ga0207705_101497582 | 256 |
| 698 | 3300025914 | Ga0207671_10200641 | Ga0207671_102006412 | 256 |
| 699 | 3300025918 | Ga0207662_10002927 | Ga0207662_100029274 | 256 |
| 700 | 3300025919 | Ga0207657_10153539 | Ga0207657_101535392 | 256 |
| 701 | 3300025920 | Ga0207649_10009110 | Ga0207649_100091105 | 256 |
| 702 | 3300025923 | Ga0207681_10076561 | Ga0207681_100765612 | 256 |
| 703 | 3300025925 | Ga0207650_10000442 | Ga0207650_1000044211 | 256 |
| 704 | 3300025926 | Ga0207659_10085844 | Ga0207659_100858442 | 256 |
| 705 | 3300025927 | Ga0207687_10031084 | Ga0207687_100310844 | 256 |
| 706 | 3300025931 | Ga0207644_10063031 | Ga0207644_100630313 | 256 |
| 707 | 3300025932 | Ga0207690_10095894 | Ga0207690_100958941 | 256 |
| 708 | 3300025933 | Ga0207706_10000651 | Ga0207706_1000065120 | 256 |
| 709 | 3300025936 | Ga0207670_10022758 | Ga0207670_100227584 | 256 |
| 710 | 3300025937 | Ga0207669_10060309 | Ga0207669_100603092 | 256 |
| 711 | 3300025938 | Ga0207704_10005477 | Ga0207704_100054776 | 256 |
| 712 | 3300025940 | Ga0207691_10005111 | Ga0207691_100051113 | 256 |
| 713 | 3300025941 | Ga0207711_10074835 | Ga0207711_100748354 | 256 |
| 714 | 3300025942 | Ga0207689_10008927 | Ga0207689_100089278 | 256 |
| 715 | 3300025944 | Ga0207661_10000213 | Ga0207661_1000021328 | 256 |
| 716 | 3300025945 | Ga0207679_10000080 | Ga0207679_1000008070 | 256 |
| 717 | 3300025949 | Ga0207667_10166549 | Ga0207667_101665492 | 256 |
| 718 | 3300025960 | Ga0207651_10071799 | Ga0207651_100717992 | 256 |
| 719 | 3300025986 | Ga0207658_10046413 | Ga0207658_100464133 | 256 |
| 720 | 3300026023 | Ga0207677_10014783 | Ga0207677_100147831 | 256 |
| 721 | 3300026041 | Ga0207639_10205210 | Ga0207639_102052101 | 256 |
| 722 | 3300026067 | Ga0207678_10024713 | Ga0207678_100247132 | 256 |
| 723 | 3300026088 | Ga0207641_10000432 | Ga0207641_1000043211 | 256 |
| 724 | 3300026089 | Ga0207648_10001706 | Ga0207648_100017064 | 256 |
| 725 | 3300026095 | Ga0207676_10000586 | Ga0207676_100005865 | 256 |
| 726 | 3300026116 | Ga0207674_10001107 | Ga0207674_1000110722 | 256 |
| 727 | 3300026121 | Ga0207683_10004817 | Ga0207683_100048173 | 256 |
| 728 | 3300028379 | Ga0268266_10122619 | Ga0268266_101226193 | 256 |
| 729 | 3300028380 | Ga0268265_10006060 | Ga0268265_100060608 | 256 |
| 730 | 3300028381 | Ga0268264_10097039 | Ga0268264_100970392 | 256 |
| 731 | 3300031090 | Ga0265760_10003165 | Ga0265760_100031655 | 256 |
| 732 | 3300048904 | Ga0496101_0226494 | Ga0496101_0226494_79_879 | 256 |
| 733 | 3300048905 | Ga0496102_0309607 | Ga0496102_0309607_648_1448 | 256 |
| 734 | 3300048907 | Ga0496104_0086818 | Ga0496104_0086818_895_1695 | 256 |
| 735 | 3300048909 | Ga0496106_0095340 | Ga0496106_0095340_823_1623 | 256 |
| 736 | 3300048911 | Ga0496108_0000228 | Ga0496108_0000228_856_1656 | 256 |
| 737 | 3300048912 | Ga0496109_0000362 | Ga0496109_0000362_1739_2539 | 256 |
| 738 | 3300048913 | Ga0496110_0001221 | Ga0496110_0001221_2714_3514 | 256 |
| 739 | 3300048914 | Ga0496111_0062347 | Ga0496111_0062347_1888_2688 | 256 |
| 740 | 3300048915 | Ga0496112_0000034 | Ga0496112_0000034_102010_102810 | 256 |
| 741 | 3300048916 | Ga0496113_0019265 | Ga0496113_0019265_1567_2367 | 256 |
| 742 | 3300048918 | Ga0496115_0091842 | Ga0496115_0091842_866_1666 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ulq-assembly1.cif.gz_B | crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain | 0.9687 | 174 | 230 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9615 | 175 | 235 |
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9537 | 174 | 234 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.953 | 174 | 234 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9515 | 174 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9729 | 175 | 230 | 1.10.10.10 |
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9687 | 174 | 230 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9535 | 174 | 227 | 1.10.10.10 |
| 4if4C02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9517 | 175 | 235 | 1.10.10.10 |
| 3cloC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.946 | 175 | 230 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F9DBB4-F1-model_v4 | Response regulatory domain-containing protein | 0.9111 | 24 | 151 |
GO:0000160
|
| AF-A0A7V6FDJ7-F1-model_v4 | Response regulator transcription factor | 0.9035 | 22 | 144 |
GO:0000160
|
| AF-A0A7W0GWP8-F1-model_v4 | Response regulator transcription factor | 0.9031 | 21 | 143 |
GO:0000160
|
| AF-A0A356A557-F1-model_v4 | DNA-binding response regulator | 0.8993 | 23 | 161 |
GO:0000160
GO:0003677 |
| AF-G9WXZ7-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.8842 | 25 | 163 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar