F478647

General Info

Members Datasets Scaffolds Average Seq Length
742 269 742 259

Family's Representative Sequence

Representative Sequence 3300035241|Ga0373961_0072285|Ga0373961_0072285_159_1049
Length 296
Sequence MGAEALASSSMNTILSAAEARGTEAQGNRMASTSASMEMNVEQPQEADGQFIRVIVADTQAIFRAGLRKIFALEDDIRVVGQSESLSQTLSAAKKFSADILIFEAALTQNPVDAISDLMRQTPGLRLVVVTQEPNQELTLELLRRGVHGIVSRDVEPELLVECLRKVSEGHPWLDSRGTQWVLEAYRTQGSRPTSPRPKVQLTPKESLIVSCVTQGMKNKEIALRVGTTEQVVKNYLRKVYDKLGVADRLELALFCLHNRVLDSNLKTPSAPVPSSGNGSAPDLAPASTETVTKPS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
127 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
128 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.14
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9625197 2162886012 Bacteria 2139
2 LJNas_1000808 3300000546 Bacteria 5203
3 JGI24738J21930_10017364 3300002075 Bacteria 1513
4 JGI24749J21850_1008375 3300002076 Unclassified 1441
5 JGI24034J26672_10004616 3300002239 Unclassified 1957
6 JGI24751J29686_10008402 3300002459 Bacteria 2112
7 rootH1_10349975 3300003323 Unclassified 1978
8 Ga0058862_12671333 3300004803 Bacteria 2139
9 Ga0065712_10012754 3300005290 Bacteria 2787
10 Ga0065715_10110383 3300005293 Bacteria 2623
11 Ga0065715_10115978 3300005293 Bacteria 2396
12 Ga0070658_10100531 3300005327 Bacteria 2390
13 Ga0070658_10222701 3300005327 Unclassified 1596
14 Ga0070676_10086462 3300005328 Unclassified 1912
15 Ga0070683_100079235 3300005329 Bacteria 3074
16 Ga0070683_100092640 3300005329 Bacteria 2838
17 Ga0070683_100360942 3300005329 Bacteria 1383
18 Ga0070690_100005450 3300005330 Bacteria 7148
19 Ga0070690_100183060 3300005330 Bacteria 1448
20 Ga0070670_100140082 3300005331 Bacteria 2092
21 Ga0070670_100140689 3300005331 Bacteria 2086
22 Ga0070677_10006921 3300005333 Bacteria 3768
23 Ga0068869_100005013 3300005334 Bacteria 8292
24 Ga0068869_100028015 3300005334 Bacteria 3932
25 Ga0068869_100101226 3300005334 Bacteria 2179
26 Ga0070666_10042107 3300005335 Bacteria 3054
27 Ga0070666_10045866 3300005335 Bacteria 2930
28 Ga0070666_10054652 3300005335 Bacteria 2694
29 Ga0070680_100101665 3300005336 Bacteria 2386
30 Ga0070682_100002630 3300005337 Bacteria 9925
31 Ga0070682_100189805 3300005337 Unclassified 1442
32 Ga0068868_100047171 3300005338 Bacteria 3374
33 Ga0068868_100084460 3300005338 Bacteria 2550
34 Ga0068868_100128111 3300005338 Bacteria 2075
35 Ga0068868_100145488 3300005338 Bacteria 1948
36 Ga0068868_100219676 3300005338 Bacteria 1590
37 Ga0070660_100039184 3300005339 Bacteria 3601
38 Ga0070660_100131685 3300005339 Bacteria 2001
39 Ga0070689_100040587 3300005340 Unclassified 3569
40 Ga0070691_10272379 3300005341 Unclassified 915
41 Ga0070687_100003791 3300005343 Bacteria 5929
42 Ga0070687_100139984 3300005343 Bacteria 1408
43 Ga0070661_100124528 3300005344 Bacteria 1933
44 Ga0070692_10358368 3300005345 Unclassified 908
45 Ga0070668_100005248 3300005347 Bacteria 9613
46 Ga0070669_100066648 3300005353 Bacteria 2654
47 Ga0070669_100071985 3300005353 Bacteria 2559
48 Ga0070675_100017919 3300005354 Bacteria 5633
49 Ga0070671_100086528 3300005355 Bacteria 2622
50 Ga0070674_100069317 3300005356 Bacteria 2487
51 Ga0070673_100069199 3300005364 Bacteria 2828
52 Ga0070688_100071053 3300005365 Bacteria 2227
53 Ga0070659_100068692 3300005366 Bacteria 2811
54 Ga0070659_100097351 3300005366 Bacteria 2364
55 Ga0070667_100045357 3300005367 Bacteria 3695
56 Ga0070667_100072289 3300005367 Bacteria 2939
57 Ga0070667_100152871 3300005367 Unclassified 2028
58 Ga0070709_10000342 3300005434 Bacteria 29015
59 Ga0070709_10004147 3300005434 Bacteria 7819
60 Ga0070709_10008424 3300005434 Bacteria 5666
61 Ga0070709_10028860 3300005434 Unclassified 3312
62 Ga0070709_10121752 3300005434 Bacteria 1769
63 Ga0070709_10166165 3300005434 Unclassified 1538
64 Ga0070709_10169412 3300005434 Bacteria 1525
65 Ga0070709_10174044 3300005434 Bacteria 1506
66 Ga0070709_10230519 3300005434 Bacteria 1325
67 Ga0070709_10412151 3300005434 Bacteria 1011
68 Ga0070709_10501164 3300005434 Unclassified 922
69 Ga0070714_100076929 3300005435 Bacteria 2898
70 Ga0070714_100093450 3300005435 Bacteria 2637
71 Ga0070714_100102883 3300005435 Bacteria 2519
72 Ga0070714_100104432 3300005435 Bacteria 2500
73 Ga0070714_100139733 3300005435 Bacteria 2172
74 Ga0070714_100143587 3300005435 Bacteria 2145
75 Ga0070714_100161464 3300005435 Unclassified 2028
76 Ga0070714_100251381 3300005435 Bacteria 1634
77 Ga0070714_100428047 3300005435 Bacteria 1255
78 Ga0070713_100000349 3300005436 Bacteria 30061
79 Ga0070713_100000464 3300005436 Bacteria 25883
80 Ga0070713_100006167 3300005436 Bacteria 8286
81 Ga0070713_100007744 3300005436 Bacteria 7563
82 Ga0070713_100114870 3300005436 Bacteria 2352
83 Ga0070713_100132471 3300005436 Bacteria 2200
84 Ga0070713_100183271 3300005436 Bacteria 1882
85 Ga0070713_100247965 3300005436 Bacteria 1623
86 Ga0070713_100248899 3300005436 Bacteria 1620
87 Ga0070713_100252971 3300005436 Bacteria 1608
88 Ga0070713_100358377 3300005436 Bacteria 1354
89 Ga0070713_100438125 3300005436 Bacteria 1225
90 Ga0070710_10014713 3300005437 Bacteria 3942
91 Ga0070710_10030400 3300005437 Bacteria 2905
92 Ga0070710_10039878 3300005437 Bacteria 2585
93 Ga0070710_10041368 3300005437 Bacteria 2545
94 Ga0070710_10064638 3300005437 Bacteria 2093
95 Ga0070710_10094328 3300005437 Bacteria 1770
96 Ga0070711_100006200 3300005439 Bacteria 7192
97 Ga0070711_100026283 3300005439 Bacteria 3814
98 Ga0070711_100146958 3300005439 Unclassified 1774
99 Ga0070711_100378128 3300005439 Bacteria 1144
100 Ga0070711_100412841 3300005439 Bacteria 1098
101 Ga0070700_100419361 3300005441 Unclassified 1011
102 Ga0070694_100410831 3300005444 Bacteria 1062
103 Ga0070708_100001971 3300005445 Bacteria 15827
104 Ga0070708_100002311 3300005445 Bacteria 14761
105 Ga0070708_100026409 3300005445 Bacteria 4970
106 Ga0070708_100034096 3300005445 Bacteria 4427
107 Ga0070708_100034268 3300005445 Bacteria 4416
108 Ga0070708_100071788 3300005445 Bacteria 3117
109 Ga0070708_100156735 3300005445 Bacteria 2120
110 Ga0070708_100213945 3300005445 Bacteria 1806
111 Ga0070708_100253501 3300005445 Bacteria 1653
112 Ga0070708_100496587 3300005445 Unclassified 1151
113 Ga0070708_100554934 3300005445 Bacteria 1083
114 Ga0070663_100011290 3300005455 Bacteria 5600
115 Ga0070678_100107019 3300005456 Bacteria 2180
116 Ga0070678_100409109 3300005456 Unclassified 1180
117 Ga0070662_100028429 3300005457 Bacteria 3890
118 Ga0070662_100067835 3300005457 Bacteria 2620
119 Ga0070681_10029824 3300005458 Bacteria 5475
120 Ga0070681_10340082 3300005458 Unclassified 1411
121 Ga0070681_10371698 3300005458 Unclassified 1340
122 Ga0070681_10444857 3300005458 Unclassified 1208
123 Ga0068867_100004171 3300005459 Bacteria 10169
124 Ga0068867_100200660 3300005459 Bacteria 1597
125 Ga0070685_10019163 3300005466 Bacteria 3689
126 Ga0070706_100000173 3300005467 Bacteria 81500
127 Ga0070706_100001330 3300005467 Bacteria 26281
128 Ga0070706_100006446 3300005467 Bacteria 11078
129 Ga0070706_100018145 3300005467 Bacteria 6491
130 Ga0070706_100279323 3300005467 Bacteria 1558
131 Ga0070706_100350143 3300005467 Bacteria 1377
132 Ga0070706_100412696 3300005467 Bacteria 1257
133 Ga0070706_100509317 3300005467 Bacteria 1120
134 Ga0070707_100009403 3300005468 Bacteria 9072
135 Ga0070707_100009720 3300005468 Bacteria 8938
136 Ga0070707_100072582 3300005468 Bacteria 3317
137 Ga0070707_100147384 3300005468 Bacteria 2291
138 Ga0070707_100229201 3300005468 Unclassified 1809
139 Ga0070707_100247308 3300005468 Bacteria 1735
140 Ga0070698_100002711 3300005471 Bacteria 19475
141 Ga0070698_100009217 3300005471 Bacteria 10592
142 Ga0070698_100070545 3300005471 Unclassified 3506
143 Ga0070698_100085199 3300005471 Unclassified 3147
144 Ga0070698_100282882 3300005471 Bacteria 1590
145 Ga0070699_100004975 3300005518 Bacteria 11715
146 Ga0070699_100025429 3300005518 Bacteria 5103
147 Ga0070699_100048432 3300005518 Bacteria 3678
148 Ga0070699_100136793 3300005518 Bacteria 2161
149 Ga0070679_100043848 3300005530 Bacteria 4454
150 Ga0070679_100158480 3300005530 Bacteria 2238
151 Ga0070679_100265840 3300005530 Unclassified 1670
152 Ga0070679_100565861 3300005530 Unclassified 1080
153 Ga0070684_100041470 3300005535 Bacteria 3968
154 Ga0070684_100060175 3300005535 Bacteria 3321
155 Ga0070684_100080931 3300005535 Bacteria 2874
156 Ga0070697_100000015 3300005536 Bacteria 143397
157 Ga0070697_100000389 3300005536 Bacteria 34237
158 Ga0070697_100001978 3300005536 Bacteria 15681
159 Ga0070697_100013157 3300005536 Bacteria 6488
160 Ga0070697_100015949 3300005536 Bacteria 5905
161 Ga0070697_100120348 3300005536 Bacteria 2195
162 Ga0070697_100142468 3300005536 Bacteria 2016
163 Ga0068853_100088646 3300005539 Bacteria 2716
164 Ga0068853_100119350 3300005539 Bacteria 2350
165 Ga0070672_100007893 3300005543 Bacteria 7266
166 Ga0070686_100007812 3300005544 Bacteria 5978
167 Ga0070686_100124596 3300005544 Bacteria 1773
168 Ga0070695_100097819 3300005545 Unclassified 1971
169 Ga0070695_100135571 3300005545 Bacteria 1701
170 Ga0070696_100184200 3300005546 Bacteria 1550
171 Ga0070693_100019577 3300005547 Bacteria 3551
172 Ga0070693_100120149 3300005547 Bacteria 1628
173 Ga0070665_100042008 3300005548 Bacteria 4596
174 Ga0068855_100002122 3300005563 Bacteria 24539
175 Ga0068855_100141018 3300005563 Bacteria 2747
176 Ga0068855_100167179 3300005563 Bacteria 2492
177 Ga0070664_100042196 3300005564 Bacteria 3851
178 Ga0070664_100401155 3300005564 Bacteria 1254
179 Ga0068857_100179694 3300005577 Bacteria 1925
180 Ga0068857_100298295 3300005577 Unclassified 1485
181 Ga0068857_100324320 3300005577 Bacteria 1423
182 Ga0068854_100002075 3300005578 Bacteria 12287
183 Ga0068854_100167452 3300005578 Bacteria 1707
184 Ga0068856_100004490 3300005614 Bacteria 13876
185 Ga0068856_100080672 3300005614 Bacteria 3227
186 Ga0068856_100173176 3300005614 Bacteria 2170
187 Ga0068856_100346291 3300005614 Bacteria 1505
188 Ga0068856_100647396 3300005614 Bacteria 1077
189 Ga0070702_100026990 3300005615 Bacteria 3093
190 Ga0068852_100004761 3300005616 Bacteria 9638
191 Ga0068859_100018009 3300005617 Bacteria 7097
192 Ga0068859_100023995 3300005617 Bacteria 6121
193 Ga0068859_100133591 3300005617 Bacteria 2553
194 Ga0068864_100272688 3300005618 Unclassified 1577
195 Ga0068866_10011374 3300005718 Bacteria 3848
196 Ga0068866_10025164 3300005718 Bacteria 2795
197 Ga0068861_100290149 3300005719 Unclassified 1412
198 Ga0068851_10008550 3300005834 Bacteria 4736
199 Ga0068851_10028964 3300005834 Bacteria 2738
200 Ga0068851_10094637 3300005834 Bacteria 1577
201 Ga0068870_10015319 3300005840 Bacteria 3635
202 Ga0068870_10050699 3300005840 Bacteria 2194
203 Ga0068863_100083550 3300005841 Bacteria 3026
204 Ga0068863_100254109 3300005841 Bacteria 1698
205 Ga0068863_100392889 3300005841 Bacteria 1355
206 Ga0068863_100513782 3300005841 Bacteria 1180
207 Ga0068858_100003905 3300005842 Bacteria 14724
208 Ga0068858_100029444 3300005842 Bacteria 5099
209 Ga0068858_100320880 3300005842 Unclassified 1480
210 Ga0068860_100011552 3300005843 Bacteria 8705
211 Ga0068860_100054724 3300005843 Bacteria 3793
212 Ga0068860_100123140 3300005843 Bacteria 2484
213 Ga0068860_100153069 3300005843 Bacteria 2221
214 Ga0068862_100008948 3300005844 Bacteria 8288
215 Ga0068862_100096372 3300005844 Bacteria 2582
216 Ga0068862_100160178 3300005844 Bacteria 2008
217 Ga0068862_100184422 3300005844 Bacteria 1874
218 Ga0081540_1021791 3300005983 Bacteria 3801
219 Ga0070717_10001227 3300006028 Bacteria 17447
220 Ga0070717_10005049 3300006028 Bacteria 9615
221 Ga0070717_10006280 3300006028 Bacteria 8727
222 Ga0070717_10006485 3300006028 Bacteria 8613
223 Ga0070717_10012322 3300006028 Bacteria 6517
224 Ga0070717_10053353 3300006028 Bacteria 3332
225 Ga0070717_10085391 3300006028 Unclassified 2656
226 Ga0070717_10104044 3300006028 Bacteria 2414
227 Ga0070717_10256469 3300006028 Bacteria 1546
228 Ga0070717_10305121 3300006028 Bacteria 1416
229 Ga0070715_10013537 3300006163 Bacteria 2999
230 Ga0070715_10017279 3300006163 Bacteria 2728
231 Ga0070716_100010654 3300006173 Bacteria 4615
232 Ga0070716_100059240 3300006173 Bacteria 2207
233 Ga0070716_100066983 3300006173 Bacteria 2096
234 Ga0070712_100000586 3300006175 Bacteria 21238
235 Ga0070712_100003006 3300006175 Bacteria 10438
236 Ga0070712_100044643 3300006175 Bacteria 3056
237 Ga0070712_100053544 3300006175 Bacteria 2817
238 Ga0070712_100147640 3300006175 Bacteria 1801
239 Ga0070712_100150346 3300006175 Bacteria 1787
240 Ga0070712_100175505 3300006175 Bacteria 1666
241 Ga0070712_100479294 3300006175 Bacteria 1040
242 Ga0097621_100005633 3300006237 Bacteria 8832
243 Ga0097621_100081412 3300006237 Bacteria 2694
244 Ga0097621_100258017 3300006237 Bacteria 1528
245 Ga0097621_100367147 3300006237 Bacteria 1283
246 Ga0068871_100002915 3300006358 Bacteria 11730
247 Ga0068871_100010394 3300006358 Bacteria 6791
248 Ga0068871_100309947 3300006358 Unclassified 1387
249 Ga0075433_10018081 3300006852 Bacteria 5852
250 Ga0075433_10020953 3300006852 Bacteria 5475
251 Ga0075434_100000976 3300006871 Bacteria 23086
252 Ga0075434_100006334 3300006871 Bacteria 10850
253 Ga0075434_100263702 3300006871 Unclassified 1742
254 Ga0068865_100065979 3300006881 Bacteria 2552
255 Ga0068865_100068595 3300006881 Bacteria 2507
256 Ga0068865_100124149 3300006881 Bacteria 1924
257 Ga0075436_100001061 3300006914 Bacteria 18523
258 Ga0075436_100033643 3300006914 Bacteria 3533
259 Ga0075436_100083203 3300006914 Bacteria 2220
260 Ga0097620_100018009 3300006931 Bacteria 7097
261 Ga0097620_100023993 3300006931 Bacteria 6121
262 Ga0097620_100133597 3300006931 Bacteria 2553
263 Ga0075435_100001744 3300007076 Bacteria 14157
264 Ga0075435_100116605 3300007076 Bacteria 2225
265 Ga0075435_100218125 3300007076 Bacteria 1619
266 Ga0075435_100415531 3300007076 Bacteria 1158
267 Ga0105250_10044260 3300009092 Bacteria 1785
268 Ga0105240_10032276 3300009093 Bacteria 6782
269 Ga0105240_10033712 3300009093 Bacteria 6612
270 Ga0105240_10034130 3300009093 Bacteria 6566
271 Ga0105240_10166863 3300009093 Bacteria 2611
272 Ga0105240_10253790 3300009093 Bacteria 2032
273 Ga0105240_10296530 3300009093 Bacteria 1851
274 Ga0105240_10461851 3300009093 Bacteria 1419
275 Ga0105245_10011889 3300009098 Bacteria 7569
276 Ga0105245_10017602 3300009098 Bacteria 6238
277 Ga0105245_10039167 3300009098 Bacteria 4218
278 Ga0105245_10136625 3300009098 Bacteria 2305
279 Ga0105245_10194558 3300009098 Bacteria 1944
280 Ga0105247_10022118 3300009101 Bacteria 3828
281 Ga0105247_10025982 3300009101 Bacteria 3535
282 Ga0105247_10040642 3300009101 Bacteria 2843
283 Ga0105247_10222384 3300009101 Viruses 1278
284 Ga0105247_10262041 3300009101 Bacteria 1186
285 Ga0105247_10278239 3300009101 Bacteria 1154
286 Ga0114129_10271973 3300009147 Unclassified 2266
287 Ga0105241_10010779 3300009174 Bacteria 6706
288 Ga0105241_10059045 3300009174 Bacteria 2948
289 Ga0105241_10089749 3300009174 Bacteria 2422
290 Ga0105242_10027658 3300009176 Bacteria 4507
291 Ga0105242_10140130 3300009176 Bacteria 2098
292 Ga0105242_10222624 3300009176 Bacteria 1687
293 Ga0105248_10017692 3300009177 Bacteria 7861
294 Ga0105248_10247172 3300009177 Bacteria 2008
295 Ga0105248_10282060 3300009177 Unclassified 1870
296 Ga0105248_10435967 3300009177 Unclassified 1476
297 Ga0105237_10032309 3300009545 Bacteria 5299
298 Ga0105237_10042776 3300009545 Bacteria 4566
299 Ga0105237_10166196 3300009545 Bacteria 2205
300 Ga0105237_10168145 3300009545 Bacteria 2192
301 Ga0105237_10218829 3300009545 Bacteria 1904
302 Ga0105238_10000570 3300009551 Bacteria 38677
303 Ga0105238_10119189 3300009551 Bacteria 2619
304 Ga0105238_10325517 3300009551 Bacteria 1523
305 Ga0105238_10790659 3300009551 Unclassified 964
306 Ga0105249_10009980 3300009553 Bacteria 8328
307 Ga0105249_10037822 3300009553 Bacteria 4379
308 Ga0105239_10006742 3300010375 Bacteria 13265
309 Ga0105239_10032973 3300010375 Bacteria 5690
310 Ga0105239_10047821 3300010375 Bacteria 4689
311 Ga0105239_10090842 3300010375 Bacteria 3369
312 Ga0105246_10121128 3300011119 Bacteria 1939
313 Ga0157373_10062503 3300013100 Bacteria 2637
314 Ga0157371_10021750 3300013102 Bacteria 4705
315 Ga0157371_10049540 3300013102 Bacteria 2984
316 Ga0157370_10162084 3300013104 Bacteria 2080
317 Ga0157369_10000309 3300013105 Bacteria 65396
318 Ga0157369_10031967 3300013105 Bacteria 5790
319 Ga0157369_10050541 3300013105 Bacteria 4502
320 Ga0157369_10074407 3300013105 Bacteria 3642
321 Ga0157369_10183867 3300013105 Bacteria 2198
322 Ga0157374_10001227 3300013296 Bacteria 21912
323 Ga0157374_10002450 3300013296 Bacteria 15672
324 Ga0157374_10062745 3300013296 Bacteria 3484
325 Ga0157374_10077162 3300013296 Bacteria 3152
326 Ga0157374_10129725 3300013296 Bacteria 2439
327 Ga0157374_10157790 3300013296 Bacteria 2209
328 Ga0157374_10168532 3300013296 Unclassified 2136
329 Ga0157374_10181667 3300013296 Bacteria 2055
330 Ga0157378_10003661 3300013297 Bacteria 13617
331 Ga0157378_10012740 3300013297 Bacteria 7360
332 Ga0157378_10080384 3300013297 Bacteria 2944
333 Ga0157378_10082051 3300013297 Bacteria 2915
334 Ga0157378_10143990 3300013297 Bacteria 2215
335 Ga0157378_10230242 3300013297 Bacteria 1766
336 Ga0163162_10001911 3300013306 Bacteria 19633
337 Ga0163162_10031676 3300013306 Bacteria 5245
338 Ga0163162_10069055 3300013306 Bacteria 3586
339 Ga0163162_10144535 3300013306 Bacteria 2493
340 Ga0163162_10394012 3300013306 Bacteria 1517
341 Ga0157372_10000497 3300013307 Bacteria 43246
342 Ga0157372_10004364 3300013307 Bacteria 15101
343 Ga0157372_10012853 3300013307 Bacteria 8922
344 Ga0157372_10050349 3300013307 Bacteria 4634
345 Ga0157372_10108506 3300013307 Bacteria 3177
346 Ga0157372_10164931 3300013307 Bacteria 2562
347 Ga0157375_10191345 3300013308 Bacteria 2200
348 Ga0157375_10351179 3300013308 Bacteria 1640
349 Ga0157375_10694029 3300013308 Bacteria 1172
350 Ga0163163_10020316 3300014325 Bacteria 6251
351 Ga0163163_10034896 3300014325 Bacteria 4876
352 Ga0163163_10077093 3300014325 Bacteria 3329
353 Ga0163163_10232342 3300014325 Bacteria 1893
354 Ga0157380_10083580 3300014326 Bacteria 2616
355 Ga0182008_10054129 3300014497 Bacteria 1986
356 Ga0157377_10017724 3300014745 Bacteria 3688
357 Ga0157379_10004138 3300014968 Bacteria 12380
358 Ga0157379_10080461 3300014968 Bacteria 2918
359 Ga0157379_10125002 3300014968 Bacteria 2314
360 Ga0157379_10146181 3300014968 Bacteria 2132
361 Ga0157376_10038613 3300014969 Bacteria 3886
362 Ga0157376_10110237 3300014969 Bacteria 2421
363 Ga0157376_10157777 3300014969 Bacteria 2054
364 Ga0157376_10410179 3300014969 Bacteria 1312
365 Ga0157376_10873879 3300014969 Unclassified 916
366 Ga0182005_1019017 3300015265 Bacteria 1896
367 Ga0163161_10046137 3300017792 Bacteria 3143
368 Ga0163161_10281715 3300017792 Bacteria 1304
369 Ga0213874_10022180 3300021377 Bacteria 1759
370 Ga0224569_102017 3300022732 Bacteria 1674
371 Ga0224572_1007744 3300024225 Bacteria 1974
372 Ga0228598_1003051 3300024227 Bacteria 3629
373 Ga0228598_1004351 3300024227 Bacteria 2998
374 Ga0228598_1005499 3300024227 Bacteria 2647
375 Ga0228598_1008184 3300024227 Bacteria 2116
376 Ga0207656_10015696 3300025321 Bacteria 2936
377 Ga0207692_10007889 3300025898 Bacteria 4384
378 Ga0207692_10015363 3300025898 Bacteria 3367
379 Ga0207692_10022524 3300025898 Bacteria 2900
380 Ga0207692_10039661 3300025898 Bacteria 2319
381 Ga0207692_10060351 3300025898 Unclassified 1961
382 Ga0207642_10049539 3300025899 Bacteria 1889
383 Ga0207642_10125451 3300025899 Bacteria 1331
384 Ga0207642_10171159 3300025899 Bacteria 1175
385 Ga0207710_10026561 3300025900 Bacteria 2503
386 Ga0207710_10054998 3300025900 Bacteria 1793
387 Ga0207680_10031443 3300025903 Bacteria 3006
388 Ga0207680_10198523 3300025903 Bacteria 1366
389 Ga0207647_10000903 3300025904 Bacteria 22977
390 Ga0207647_10010492 3300025904 Bacteria 6542
391 Ga0207685_10013586 3300025905 Bacteria 2523
392 Ga0207699_10003310 3300025906 Bacteria 7682
393 Ga0207699_10006411 3300025906 Bacteria 5695
394 Ga0207699_10014214 3300025906 Bacteria 4096
395 Ga0207699_10019041 3300025906 Bacteria 3651
396 Ga0207699_10062563 3300025906 Bacteria 2244
397 Ga0207699_10167265 3300025906 Bacteria 1468
398 Ga0207699_10187701 3300025906 Bacteria 1393
399 Ga0207699_10212482 3300025906 Bacteria 1316
400 Ga0207645_10035862 3300025907 Bacteria 3185
401 Ga0207645_10057670 3300025907 Bacteria 2479
402 Ga0207643_10004784 3300025908 Bacteria 7253
403 Ga0207705_10149758 3300025909 Unclassified 1748
404 Ga0207705_10239633 3300025909 Bacteria 1381
405 Ga0207684_10000267 3300025910 Bacteria 77172
406 Ga0207684_10001492 3300025910 Bacteria 25166
407 Ga0207684_10016631 3300025910 Bacteria 6315
408 Ga0207684_10022758 3300025910 Bacteria 5350
409 Ga0207684_10057475 3300025910 Bacteria 3301
410 Ga0207684_10107579 3300025910 Unclassified 2386
411 Ga0207684_10212703 3300025910 Bacteria 1668
412 Ga0207684_10216174 3300025910 Bacteria 1654
413 Ga0207654_10113749 3300025911 Bacteria 1688
414 Ga0207654_10374505 3300025911 Bacteria 985
415 Ga0207707_10000878 3300025912 Bacteria 29399
416 Ga0207707_10054116 3300025912 Bacteria 3494
417 Ga0207707_10080808 3300025912 Unclassified 2838
418 Ga0207707_10263706 3300025912 Unclassified 1494
419 Ga0207695_10012611 3300025913 Bacteria 10128
420 Ga0207695_10021580 3300025913 Bacteria 7344
421 Ga0207695_10041995 3300025913 Bacteria 4889
422 Ga0207695_10098609 3300025913 Unclassified 2921
423 Ga0207695_10235230 3300025913 Bacteria 1735
424 Ga0207671_10124011 3300025914 Unclassified 1977
425 Ga0207671_10200641 3300025914 Bacteria 1558
426 Ga0207693_10000142 3300025915 Bacteria 65780
427 Ga0207693_10002184 3300025915 Bacteria 17057
428 Ga0207693_10140916 3300025915 Bacteria 1896
429 Ga0207693_10168345 3300025915 Bacteria 1725
430 Ga0207693_10200397 3300025915 Unclassified 1570
431 Ga0207693_10220546 3300025915 Bacteria 1490
432 Ga0207693_10357030 3300025915 Bacteria 1143
433 Ga0207663_10020803 3300025916 Bacteria 3723
434 Ga0207663_10088829 3300025916 Unclassified 2045
435 Ga0207663_10218874 3300025916 Bacteria 1384
436 Ga0207662_10002927 3300025918 Bacteria 8666
437 Ga0207657_10007959 3300025919 Bacteria 10809
438 Ga0207657_10028691 3300025919 Bacteria 5072
439 Ga0207657_10153539 3300025919 Bacteria 1874
440 Ga0207649_10009110 3300025920 Bacteria 5427
441 Ga0207652_10022743 3300025921 Bacteria 5190
442 Ga0207652_10386872 3300025921 Bacteria 1262
443 Ga0207646_10001228 3300025922 Bacteria 32199
444 Ga0207646_10009914 3300025922 Bacteria 9370
445 Ga0207646_10059625 3300025922 Bacteria 3408
446 Ga0207646_10105166 3300025922 Unclassified 2531
447 Ga0207646_10190908 3300025922 Bacteria 1850
448 Ga0207646_10292427 3300025922 Bacteria 1472
449 Ga0207646_10449438 3300025922 Bacteria 1163
450 Ga0207681_10068171 3300025923 Bacteria 2470
451 Ga0207681_10076561 3300025923 Bacteria 2349
452 Ga0207694_10001825 3300025924 Bacteria 17733
453 Ga0207694_10209105 3300025924 Bacteria 1589
454 Ga0207650_10000442 3300025925 Bacteria 35606
455 Ga0207659_10085844 3300025926 Bacteria 2339
456 Ga0207687_10000653 3300025927 Bacteria 23344
457 Ga0207687_10031084 3300025927 Bacteria 3607
458 Ga0207687_10040180 3300025927 Bacteria 3205
459 Ga0207687_10136622 3300025927 Bacteria 1855
460 Ga0207700_10000200 3300025928 Bacteria 35788
461 Ga0207700_10005255 3300025928 Bacteria 7717
462 Ga0207700_10005553 3300025928 Bacteria 7567
463 Ga0207700_10009464 3300025928 Bacteria 6089
464 Ga0207700_10012034 3300025928 Bacteria 5556
465 Ga0207700_10062156 3300025928 Bacteria 2836
466 Ga0207700_10128012 3300025928 Unclassified 2069
467 Ga0207700_10194733 3300025928 Bacteria 1705
468 Ga0207700_10231339 3300025928 Bacteria 1572
469 Ga0207700_10251319 3300025928 Bacteria 1510
470 Ga0207664_10000033 3300025929 Bacteria 176549
471 Ga0207664_10019718 3300025929 Bacteria 4990
472 Ga0207664_10101560 3300025929 Bacteria 2377
473 Ga0207664_10120028 3300025929 Bacteria 2199
474 Ga0207664_10137666 3300025929 Bacteria 2062
475 Ga0207664_10148802 3300025929 Bacteria 1988
476 Ga0207664_10150295 3300025929 Bacteria 1978
477 Ga0207664_10179778 3300025929 Bacteria 1815
478 Ga0207644_10063031 3300025931 Bacteria 2690
479 Ga0207690_10031811 3300025932 Bacteria 3380
480 Ga0207690_10095894 3300025932 Unclassified 2108
481 Ga0207706_10000102 3300025933 Bacteria 89878
482 Ga0207706_10000651 3300025933 Bacteria 36655
483 Ga0207706_10087946 3300025933 Bacteria 2732
484 Ga0207686_10124688 3300025934 Bacteria 1758
485 Ga0207686_10177896 3300025934 Bacteria 1506
486 Ga0207670_10022758 3300025936 Bacteria 3889
487 Ga0207669_10060309 3300025937 Bacteria 2325
488 Ga0207704_10005477 3300025938 Bacteria 5852
489 Ga0207665_10000313 3300025939 Bacteria 33592
490 Ga0207665_10063717 3300025939 Bacteria 2504
491 Ga0207665_10074992 3300025939 Bacteria 2316
492 Ga0207665_10142770 3300025939 Bacteria 1709
493 Ga0207665_10185846 3300025939 Bacteria 1507
494 Ga0207665_10249084 3300025939 Bacteria 1312
495 Ga0207665_10347106 3300025939 Bacteria 1120
496 Ga0207691_10005111 3300025940 Bacteria 12662
497 Ga0207711_10002678 3300025941 Bacteria 15751
498 Ga0207711_10074835 3300025941 Bacteria 2946
499 Ga0207689_10000788 3300025942 Bacteria 30435
500 Ga0207689_10008927 3300025942 Bacteria 8691
501 Ga0207689_10026073 3300025942 Bacteria 4894
502 Ga0207689_10106656 3300025942 Bacteria 2302
503 Ga0207661_10000213 3300025944 Bacteria 37493
504 Ga0207661_10118293 3300025944 Bacteria 2252
505 Ga0207679_10000080 3300025945 Bacteria 84997
506 Ga0207679_10043673 3300025945 Bacteria 3229
507 Ga0207679_10066596 3300025945 Bacteria 2699
508 Ga0207667_10000708 3300025949 Bacteria 43198
509 Ga0207667_10005798 3300025949 Bacteria 15067
510 Ga0207667_10166549 3300025949 Bacteria 2266
511 Ga0207651_10071799 3300025960 Bacteria 2455
512 Ga0207668_10029002 3300025972 Bacteria 3624
513 Ga0207640_10035589 3300025981 Bacteria 3117
514 Ga0207640_10248866 3300025981 Bacteria 1378
515 Ga0207640_10568507 3300025981 Unclassified 955
516 Ga0207658_10046413 3300025986 Bacteria 3172
517 Ga0207658_10165243 3300025986 Bacteria 1817
518 Ga0207658_10313711 3300025986 Unclassified 1355
519 Ga0207677_10004059 3300026023 Bacteria 7822
520 Ga0207677_10009387 3300026023 Bacteria 5506
521 Ga0207677_10014783 3300026023 Bacteria 4570
522 Ga0207677_10014999 3300026023 Bacteria 4543
523 Ga0207677_10031822 3300026023 Bacteria 3383
524 Ga0207703_10005982 3300026035 Bacteria 9747
525 Ga0207703_10057247 3300026035 Bacteria 3178
526 Ga0207703_10165382 3300026035 Bacteria 1941
527 Ga0207639_10181844 3300026041 Bacteria 1789
528 Ga0207639_10192197 3300026041 Bacteria 1744
529 Ga0207639_10205210 3300026041 Unclassified 1693
530 Ga0207639_10255826 3300026041 Bacteria 1529
531 Ga0207678_10005273 3300026067 Bacteria 11577
532 Ga0207678_10024713 3300026067 Bacteria 5246
533 Ga0207708_10447663 3300026075 Bacteria 1075
534 Ga0207702_10000490 3300026078 Bacteria 44511
535 Ga0207702_10149489 3300026078 Bacteria 2123
536 Ga0207641_10000432 3300026088 Bacteria 48190
537 Ga0207641_10029359 3300026088 Bacteria 4547
538 Ga0207641_10149681 3300026088 Bacteria 2113
539 Ga0207641_10248327 3300026088 Bacteria 1661
540 Ga0207641_10271849 3300026088 Bacteria 1590
541 Ga0207648_10001706 3300026089 Bacteria 24036
542 Ga0207648_10016467 3300026089 Bacteria 6752
543 Ga0207648_10103008 3300026089 Bacteria 2503
544 Ga0207676_10000586 3300026095 Bacteria 29950
545 Ga0207676_10166498 3300026095 Unclassified 1916
546 Ga0207676_10572049 3300026095 Unclassified 1082
547 Ga0207674_10001107 3300026116 Bacteria 35021
548 Ga0207674_10002982 3300026116 Bacteria 20997
549 Ga0207674_10010514 3300026116 Bacteria 10474
550 Ga0207674_10133203 3300026116 Bacteria 2448
551 Ga0207675_100093618 3300026118 Bacteria 2826
552 Ga0207683_10004817 3300026121 Bacteria 11622
553 Ga0207683_10165202 3300026121 Bacteria 2003
554 Ga0207683_10226056 3300026121 Unclassified 1706
555 Ga0265356_1000078 3300028017 Bacteria 16086
556 Ga0265356_1002791 3300028017 Bacteria 2262
557 Ga0265356_1005028 3300028017 Bacteria 1593
558 Ga0268266_10122619 3300028379 Bacteria 2314
559 Ga0268266_10613426 3300028379 Bacteria 1045
560 Ga0268265_10006060 3300028380 Bacteria 8213
561 Ga0268265_10531415 3300028380 Bacteria 1113
562 Ga0268264_10051570 3300028381 Bacteria 3428
563 Ga0268264_10084884 3300028381 Bacteria 2716
564 Ga0268264_10097039 3300028381 Bacteria 2554
565 Ga0265338_10002910 3300028800 Bacteria 24891
566 Ga0265338_10035271 3300028800 Bacteria 4814
567 Ga0265338_10079871 3300028800 Bacteria 2750
568 Ga0265338_10145770 3300028800 Bacteria 1847
569 Ga0265762_1000283 3300030760 Bacteria 8455
570 Ga0265762_1001988 3300030760 Bacteria 3719
571 Ga0265762_1012207 3300030760 Bacteria 1539
572 Ga0265765_1002398 3300030879 Bacteria 1811
573 Ga0265760_10000599 3300031090 Bacteria 10250
574 Ga0265760_10001517 3300031090 Bacteria 6839
575 Ga0265760_10003165 3300031090 Bacteria 4814
576 Ga0265760_10015386 3300031090 Bacteria 2192
577 Ga0265760_10020798 3300031090 Bacteria 1896
578 Ga0265330_10008062 3300031235 Bacteria 5094
579 Ga0265325_10037851 3300031241 Bacteria 2549
580 Ga0265325_10103160 3300031241 Unclassified 1394
581 Ga0265340_10038313 3300031247 Unclassified 2372
582 Ga0265340_10063336 3300031247 Bacteria 1765
583 Ga0265339_10003284 3300031249 Bacteria 11322
584 Ga0265339_10008695 3300031249 Bacteria 6443
585 Ga0265339_10061810 3300031249 Bacteria 2014
586 Ga0265316_10001490 3300031344 Bacteria 25094
587 Ga0265316_10013551 3300031344 Bacteria 7235
588 Ga0265316_10038118 3300031344 Bacteria 3876
589 Ga0265316_10355891 3300031344 Unclassified 1059
590 Ga0265314_10021008 3300031711 Bacteria 5031
591 Ga0265314_10075352 3300031711 Bacteria 2245
592 Ga0265342_10125352 3300031712 Viruses 1443
593 Ga0373929_0002552 3300035085 Bacteria 3346
594 Ga0373934_0053286 3300035086 Bacteria 1604
595 Ga0373923_0056568 3300035111 Bacteria 1656
596 Ga0373936_0045026 3300035113 Bacteria 1776
597 Ga0373945_0018990 3300035116 Bacteria 2343
598 Ga0373954_0098001 3300035118 Bacteria 1413
599 Ga0373956_0097099 3300035119 Bacteria 1363
600 Ga0373943_0001752 3300035170 Bacteria 9835
601 Ga0373943_0171757 3300035170 Bacteria 1187
602 Ga0373946_0059159 3300035171 Bacteria 1625
603 Ga0373961_0072285 3300035241 Unclassified 1069
604 Ga0373962_0039798 3300035242 Bacteria 1321
605 Ga0373924_0011344 3300035410 Bacteria 3308
606 Ga0373931_0042332 3300035691 Bacteria 2395
607 Ga0373931_0068945 3300035691 Bacteria 1926
608 Ga0373931_0408276 3300035691 Bacteria 861
609 Ga0373935_0005301 3300035692 Bacteria 7589
610 Ga0373935_0040938 3300035692 Bacteria 2909
611 Ga0373935_0047719 3300035692 Bacteria 2709
612 Ga0373935_0280923 3300035692 Bacteria 1172
613 Ga0373927_0000229 3300035695 Bacteria 44230
614 Ga0373927_0044440 3300035695 Bacteria 2874
615 Ga0373927_0073103 3300035695 Bacteria 2220
616 Ga0373927_0201130 3300035695 Unclassified 1308
617 Ga0373933_0028769 3300035724 Bacteria 3208
618 Ga0373933_0189851 3300035724 Bacteria 1312
619 Ga0373947_0009478 3300035725 Bacteria 5592
620 Ga0373947_0077103 3300035725 Bacteria 2055
621 Ga0373947_0125667 3300035725 Bacteria 1633
622 Ga0373947_0185149 3300035725 Bacteria 1357
623 Ga0373947_0236526 3300035725 Bacteria 1204
624 Ga0373947_0331233 3300035725 Bacteria 1019
625 Ga0373937_0027681 3300036401 Bacteria 5128
626 Ga0373937_0069620 3300036401 Bacteria 3244
627 Ga0373937_0074227 3300036401 Bacteria 3138
628 Ga0373937_0093206 3300036401 Bacteria 2792
629 Ga0373937_0236070 3300036401 Bacteria 1722
630 Ga0373937_0672213 3300036401 Bacteria 981
631 Ga0373925_0166154 3300037068 Unclassified 1740
632 Ga0373925_0292113 3300037068 Bacteria 1314
633 Ga0373925_0487649 3300037068 Bacteria 1011
634 Ga0436364_0935288 3300037853 Bacteria 1350
635 Ga0436365_0109293 3300039437 Bacteria 2048
636 Ga0436360_0657632 3300039438 Unclassified 1892
637 Ga0436363_1637340 3300039450 Bacteria 1751
638 Ga0436362_1207079 3300039453 Bacteria 2489
639 Ga0466966_0034801 3300044684 Bacteria 3257
640 Ga0466968_0149246 3300044735 Bacteria 1074
641 Ga0451576_0312849 3300045051 Bacteria 1643
642 Ga0495629_0056413 3300046459 Bacteria 2747
643 Ga0495580_0005055 3300046472 Bacteria 10994
644 Ga0495580_0006797 3300046472 Bacteria 9269
645 Ga0495580_0010833 3300046472 Bacteria 7075
646 Ga0495580_0019702 3300046472 Bacteria 5009
647 Ga0495580_0044298 3300046472 Bacteria 3165
648 Ga0495580_0084543 3300046472 Bacteria 2210
649 Ga0495580_0134094 3300046472 Bacteria 1717
650 Ga0495580_0195561 3300046472 Bacteria 1394
651 Ga0495580_0253457 3300046472 Bacteria 1204
652 Ga0495580_0281597 3300046472 Bacteria 1134
653 Ga0495582_0238905 3300046473 Bacteria 1041
654 Ga0495664_0208564 3300046477 Bacteria 1183
655 Ga0495608_0270674 3300046511 Bacteria 1056
656 Ga0495628_0064803 3300046516 Bacteria 2860
657 Ga0495628_0267525 3300046516 Unclassified 1272
658 Ga0495630_0356637 3300046517 Unclassified 1119
659 Ga0495586_0291208 3300046535 Unclassified 935
660 Ga0495645_0127644 3300046543 Unclassified 1786
661 Ga0495669_0155469 3300046684 Unclassified 1084
662 Ga0495624_0056773 3300046690 Bacteria 2463
663 Ga0495604_0152281 3300047317 Bacteria 1642
664 Ga0495674_0022349 3300047319 Bacteria 5834
665 Ga0495674_0046114 3300047319 Bacteria 3869
666 Ga0495674_0081276 3300047319 Bacteria 2780
667 Ga0495674_0119590 3300047319 Bacteria 2226
668 Ga0495674_0294909 3300047319 Bacteria 1325
669 Ga0495676_0409325 3300047321 Bacteria 899
670 Ga0495680_0172176 3300047322 Bacteria 1567
671 Ga0495675_0096528 3300047444 Bacteria 1853
672 Ga0495684_0063476 3300047471 Bacteria 2808
673 Ga0495602_0279395 3300048088 Unclassified 1231
674 Ga0496101_0066564 3300048904 Bacteria 2628
675 Ga0496101_0089877 3300048904 Bacteria 2283
676 Ga0496101_0226494 3300048904 Unclassified 1452
677 Ga0496101_0235719 3300048904 Bacteria 1423
678 Ga0496102_0015404 3300048905 Bacteria 6658
679 Ga0496102_0067241 3300048905 Bacteria 3286
680 Ga0496102_0083537 3300048905 Unclassified 2947
681 Ga0496102_0100333 3300048905 Bacteria 2688
682 Ga0496102_0210163 3300048905 Bacteria 1835
683 Ga0496102_0309607 3300048905 Unclassified 1488
684 Ga0496102_0323029 3300048905 Bacteria 1454
685 Ga0496102_0401704 3300048905 Viruses 1288
686 Ga0496103_0014109 3300048906 Bacteria 4743
687 Ga0496103_0079682 3300048906 Bacteria 2058
688 Ga0496103_0129954 3300048906 Unclassified 1608
689 Ga0496104_0014057 3300048907 Bacteria 7226
690 Ga0496104_0028582 3300048907 Bacteria 5168
691 Ga0496104_0077313 3300048907 Unclassified 3171
692 Ga0496104_0086818 3300048907 Bacteria 2987
693 Ga0496105_0099931 3300048908 Bacteria 2396
694 Ga0496105_0379352 3300048908 Bacteria 1125
695 Ga0496106_0035779 3300048909 Bacteria 3713
696 Ga0496106_0095340 3300048909 Bacteria 2301
697 Ga0496106_0263429 3300048909 Bacteria 1379
698 Ga0496107_0079258 3300048910 Bacteria 2394
699 Ga0496107_0117036 3300048910 Bacteria 1962
700 Ga0496108_0000228 3300048911 Bacteria 50279
701 Ga0496108_0121361 3300048911 Bacteria 2242
702 Ga0496108_0231790 3300048911 Bacteria 1606
703 Ga0496109_0000362 3300048912 Bacteria 42175
704 Ga0496109_0075613 3300048912 Bacteria 3097
705 Ga0496109_0158738 3300048912 Bacteria 2118
706 Ga0496110_0001221 3300048913 Bacteria 18300
707 Ga0496110_0106280 3300048913 Bacteria 2518
708 Ga0496111_0031062 3300048914 Bacteria 3803
709 Ga0496111_0062347 3300048914 Bacteria 2704
710 Ga0496111_0358550 3300048914 Bacteria 1079
711 Ga0496112_0000034 3300048915 Bacteria 107237
712 Ga0496112_0001689 3300048915 Bacteria 17199
713 Ga0496112_0001953 3300048915 Bacteria 16282
714 Ga0496112_0484329 3300048915 Bacteria 1173
715 Ga0496112_0591966 3300048915 Bacteria 1041
716 Ga0496113_0019265 3300048916 Bacteria 4770
717 Ga0496113_0222868 3300048916 Bacteria 1503
718 Ga0496113_0248108 3300048916 Bacteria 1421
719 Ga0496113_0315149 3300048916 Bacteria 1253
720 Ga0496114_0106115 3300048917 Bacteria 2403
721 Ga0496114_0461611 3300048917 Bacteria 1124
722 Ga0496115_0032038 3300048918 Unclassified 4146
723 Ga0496115_0091842 3300048918 Bacteria 2481
724 Ga0496115_0105049 3300048918 Bacteria 2318
725 Ga0496115_0105540 3300048918 Bacteria 2312
726 Ga0496115_0155860 3300048918 Bacteria 1887
727 nmdc:mga05p37_314944_c1 3300050507 Bacteria 1854
728 nmdc:mga0n895_1952_c1 3300050512 Bacteria 15821
729 nmdc:mga0n895_204554_c1 3300050512 Bacteria 2005
730 nmdc:mga0n895_4619_c1 3300050512 Bacteria 11353
731 nmdc:mga0rr50_139752_c1 3300050513 Bacteria 1947
732 nmdc:mga0rr50_19062_c1 3300050513 Bacteria 4622
733 nmdc:mga0rr50_19451_c1 3300050513 Bacteria 4584
734 nmdc:mga0rr50_265403_c1 3300050513 Bacteria 1429
735 nmdc:mga0rr50_432027_c1 3300050513 Bacteria 1115
736 nmdc:mga08x19_12762_c1 3300050514 Bacteria 5068
737 nmdc:mga08x19_1517_c1 3300050514 Bacteria 14391
738 nmdc:mga08x19_8058_c1 3300050514 Bacteria 6260
739 nmdc:mga08x19_96474_c1 3300050514 Bacteria 1957
740 nmdc:mga0a205_23451_c1 3300050515 Bacteria 5854
741 nmdc:mga0a205_25965_c1 3300050515 Bacteria 5581
742 Ga0495619_0102108 3300053085 Unclassified 1953

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0231790 Ga0496108_0231790_628_1407 227
2 3300037853 Ga0436364_0935288 Ga0436364_0935288_495_1304 229
3 3300028800 Ga0265338_10079871 Ga0265338_100798712 230
4 3300031249 Ga0265339_10003284 Ga0265339_1000328410 230
5 3300031344 Ga0265316_10013551 Ga0265316_100135515 230
6 3300031711 Ga0265314_10075352 Ga0265314_100753522 230
7 3300005436 Ga0070713_100358377 Ga0070713_1003583771 232
8 3300006028 Ga0070717_10012322 Ga0070717_100123225 232
9 3300046473 Ga0495582_0238905 Ga0495582_0238905_52_831 232
10 3300048917 Ga0496114_0106115 Ga0496114_0106115_76_855 232
11 3300005338 Ga0068868_100145488 Ga0068868_1001454881 233
12 3300005445 Ga0070708_100253501 Ga0070708_1002535012 233
13 3300005536 Ga0070697_100142468 Ga0070697_1001424684 233
14 3300005841 Ga0068863_100392889 Ga0068863_1003928893 233
15 3300009098 Ga0105245_10194558 Ga0105245_101945582 233
16 3300013296 Ga0157374_10077162 Ga0157374_100771624 233
17 3300014325 Ga0163163_10077093 Ga0163163_100770932 233
18 3300025927 Ga0207687_10136622 Ga0207687_101366223 233
19 3300025928 Ga0207700_10009464 Ga0207700_100094646 233
20 3300026088 Ga0207641_10271849 Ga0207641_102718492 233
21 3300035695 Ga0373927_0073103 Ga0373927_0073103_971_1783 233
22 3300046472 Ga0495580_0019702 Ga0495580_0019702_904_1716 233
23 3300005445 Ga0070708_100002311 Ga0070708_10000231114 234
24 3300006871 Ga0075434_100263702 Ga0075434_1002637023 234
25 3300009101 Ga0105247_10222384 Ga0105247_102223842 234
26 3300009545 Ga0105237_10166196 Ga0105237_101661962 234
27 3300009551 Ga0105238_10790659 Ga0105238_107906592 234
28 3300013105 Ga0157369_10074407 Ga0157369_100744074 234
29 3300013307 Ga0157372_10000497 Ga0157372_1000049723 234
30 3300013307 Ga0157372_10012853 Ga0157372_100128537 234
31 3300024227 Ga0228598_1008184 Ga0228598_10081841 234
32 3300035113 Ga0373936_0045026 Ga0373936_0045026_397_1155 234
33 3300035118 Ga0373954_0098001 Ga0373954_0098001_40_807 234
34 3300035691 Ga0373931_0408276 Ga0373931_0408276_11_793 234
35 3300035725 Ga0373947_0077103 Ga0373947_0077103_1034_1792 234
36 3300036401 Ga0373937_0069620 Ga0373937_0069620_1432_2199 234
37 3300036401 Ga0373937_0074227 Ga0373937_0074227_2061_2816 234
38 3300039438 Ga0436360_0657632 Ga0436360_0657632_95_922 234
39 3300046511 Ga0495608_0270674 Ga0495608_0270674_195_962 234
40 3300047444 Ga0495675_0096528 Ga0495675_0096528_425_1192 234
41 3300048088 Ga0495602_0279395 Ga0495602_0279395_448_1203 234
42 3300050512 nmdc:mga0n895_204554_c1 nmdc:mga0n895_204554_c1_130_888 234
43 3300050513 nmdc:mga0rr50_19451_c1 nmdc:mga0rr50_19451_c1_1679_2437 234
44 3300050514 nmdc:mga08x19_96474_c1 nmdc:mga08x19_96474_c1_542_1300 234
45 3300025939 Ga0207665_10142770 Ga0207665_101427702 235
46 3300044684 Ga0466966_0034801 Ga0466966_0034801_401_1177 235
47 3300025910 Ga0207684_10212703 Ga0207684_102127033 236
48 3300031247 Ga0265340_10038313 Ga0265340_100383133 236
49 3300031344 Ga0265316_10001490 Ga0265316_1000149012 236
50 3300047471 Ga0495684_0063476 Ga0495684_0063476_992_1759 236
51 3300003323 rootH1_10349975 rootH1_103499752 237
52 3300036401 Ga0373937_0672213 Ga0373937_0672213_119_952 237
53 3300005436 Ga0070713_100438125 Ga0070713_1004381251 238
54 3300005468 Ga0070707_100072582 Ga0070707_1000725823 238
55 3300005563 Ga0068855_100002122 Ga0068855_10000212214 238
56 3300006237 Ga0097621_100258017 Ga0097621_1002580171 238
57 3300006358 Ga0068871_100010394 Ga0068871_1000103944 238
58 3300009093 Ga0105240_10032276 Ga0105240_100322769 238
59 3300009093 Ga0105240_10296530 Ga0105240_102965302 238
60 3300009101 Ga0105247_10278239 Ga0105247_102782392 238
61 3300009174 Ga0105241_10010779 Ga0105241_100107796 238
62 3300009551 Ga0105238_10000570 Ga0105238_1000057029 238
63 3300009551 Ga0105238_10119189 Ga0105238_101191892 238
64 3300010375 Ga0105239_10006742 Ga0105239_1000674215 238
65 3300013105 Ga0157369_10000309 Ga0157369_1000030926 238
66 3300013296 Ga0157374_10001227 Ga0157374_1000122715 238
67 3300013297 Ga0157378_10003661 Ga0157378_100036612 238
68 3300013297 Ga0157378_10082051 Ga0157378_100820512 238
69 3300013306 Ga0163162_10394012 Ga0163162_103940122 238
70 3300013307 Ga0157372_10004364 Ga0157372_100043644 238
71 3300013308 Ga0157375_10694029 Ga0157375_106940292 238
72 3300014969 Ga0157376_10410179 Ga0157376_104101792 238
73 3300025912 Ga0207707_10000878 Ga0207707_1000087825 238
74 3300025913 Ga0207695_10041995 Ga0207695_100419954 238
75 3300025913 Ga0207695_10235230 Ga0207695_102352302 238
76 3300025921 Ga0207652_10022743 Ga0207652_100227434 238
77 3300025924 Ga0207694_10001825 Ga0207694_100018255 238
78 3300026035 Ga0207703_10057247 Ga0207703_100572474 238
79 3300026078 Ga0207702_10000490 Ga0207702_100004905 238
80 3300026116 Ga0207674_10002982 Ga0207674_1000298210 238
81 3300031249 Ga0265339_10008695 Ga0265339_100086951 238
82 3300031711 Ga0265314_10021008 Ga0265314_100210083 238
83 3300035692 Ga0373935_0047719 Ga0373935_0047719_1464_2261 238
84 3300035695 Ga0373927_0044440 Ga0373927_0044440_251_1036 238
85 3300035725 Ga0373947_0236526 Ga0373947_0236526_162_947 238
86 3300035725 Ga0373947_0331233 Ga0373947_0331233_140_937 238
87 3300037068 Ga0373925_0166154 Ga0373925_0166154_58_843 238
88 3300037068 Ga0373925_0487649 Ga0373925_0487649_29_826 238
89 3300045051 Ga0451576_0312849 Ga0451576_0312849_181_960 238
90 3300046459 Ga0495629_0056413 Ga0495629_0056413_1051_1848 238
91 3300046516 Ga0495628_0267525 Ga0495628_0267525_71_868 238
92 3300046535 Ga0495586_0291208 Ga0495586_0291208_135_920 238
93 3300047319 Ga0495674_0294909 Ga0495674_0294909_341_1138 238
94 3300047321 Ga0495676_0409325 Ga0495676_0409325_81_878 238
95 3300048904 Ga0496101_0066564 Ga0496101_0066564_282_1079 238
96 3300048905 Ga0496102_0401704 Ga0496102_0401704_372_1148 238
97 3300048907 Ga0496104_0028582 Ga0496104_0028582_2135_2911 238
98 3300048908 Ga0496105_0099931 Ga0496105_0099931_1246_2022 238
99 3300048910 Ga0496107_0079258 Ga0496107_0079258_1186_1983 238
100 3300048915 Ga0496112_0001689 Ga0496112_0001689_11876_12652 238
101 3300048916 Ga0496113_0222868 Ga0496113_0222868_181_957 238
102 3300048918 Ga0496115_0105049 Ga0496115_0105049_294_1070 238
103 3300048918 Ga0496115_0105540 Ga0496115_0105540_1371_2168 238
104 3300053085 Ga0495619_0102108 Ga0495619_0102108_1126_1923 238
105 3300025915 Ga0207693_10220546 Ga0207693_102205462 239
106 3300005445 Ga0070708_100554934 Ga0070708_1005549341 240
107 3300005468 Ga0070707_100147384 Ga0070707_1001473842 240
108 3300006028 Ga0070717_10006280 Ga0070717_100062807 240
109 3300014497 Ga0182008_10054129 Ga0182008_100541292 240
110 3300025922 Ga0207646_10190908 Ga0207646_101909082 240
111 3300025939 Ga0207665_10185846 Ga0207665_101858462 240
112 3300005536 Ga0070697_100000015 Ga0070697_10000001565 241
113 3300005545 Ga0070695_100135571 Ga0070695_1001355712 241
114 3300013307 Ga0157372_10164931 Ga0157372_101649313 241
115 3300025912 Ga0207707_10080808 Ga0207707_100808084 241
116 3300026116 Ga0207674_10010514 Ga0207674_100105147 241
117 3300005434 Ga0070709_10004147 Ga0070709_100041475 242
118 3300005435 Ga0070714_100104432 Ga0070714_1001044322 242
119 3300005436 Ga0070713_100006167 Ga0070713_1000061676 242
120 3300005437 Ga0070710_10014713 Ga0070710_100147131 242
121 3300005439 Ga0070711_100146958 Ga0070711_1001469581 242
122 3300005471 Ga0070698_100282882 Ga0070698_1002828822 242
123 3300005841 Ga0068863_100254109 Ga0068863_1002541093 242
124 3300005983 Ga0081540_1021791 Ga0081540_10217913 242
125 3300026088 Ga0207641_10029359 Ga0207641_100293592 242
126 3300028017 Ga0265356_1005028 Ga0265356_10050282 242
127 3300030760 Ga0265762_1000283 Ga0265762_10002834 242
128 3300005335 Ga0070666_10054652 Ga0070666_100546522 243
129 3300005338 Ga0068868_100128111 Ga0068868_1001281111 243
130 3300005367 Ga0070667_100152871 Ga0070667_1001528713 243
131 3300005434 Ga0070709_10000342 Ga0070709_1000034221 243
132 3300005436 Ga0070713_100000464 Ga0070713_10000046415 243
133 3300005437 Ga0070710_10041368 Ga0070710_100413681 243
134 3300005439 Ga0070711_100026283 Ga0070711_1000262834 243
135 3300005445 Ga0070708_100496587 Ga0070708_1004965872 243
136 3300005456 Ga0070678_100107019 Ga0070678_1001070193 243
137 3300005458 Ga0070681_10029824 Ga0070681_100298242 243
138 3300005614 Ga0068856_100004490 Ga0068856_1000044903 243
139 3300005843 Ga0068860_100054724 Ga0068860_1000547243 243
140 3300006028 Ga0070717_10085391 Ga0070717_100853915 243
141 3300006163 Ga0070715_10013537 Ga0070715_100135373 243
142 3300006175 Ga0070712_100003006 Ga0070712_10000300610 243
143 3300006237 Ga0097621_100005633 Ga0097621_1000056334 243
144 3300006358 Ga0068871_100002915 Ga0068871_10000291512 243
145 3300009093 Ga0105240_10033712 Ga0105240_100337121 243
146 3300009098 Ga0105245_10017602 Ga0105245_100176023 243
147 3300009176 Ga0105242_10027658 Ga0105242_100276584 243
148 3300009177 Ga0105248_10282060 Ga0105248_102820603 243
149 3300013296 Ga0157374_10181667 Ga0157374_101816673 243
150 3300013297 Ga0157378_10012740 Ga0157378_100127408 243
151 3300014969 Ga0157376_10157777 Ga0157376_101577772 243
152 3300025898 Ga0207692_10022524 Ga0207692_100225242 243
153 3300025898 Ga0207692_10060351 Ga0207692_100603511 243
154 3300025903 Ga0207680_10198523 Ga0207680_101985232 243
155 3300025906 Ga0207699_10003310 Ga0207699_100033102 243
156 3300025906 Ga0207699_10014214 Ga0207699_100142144 243
157 3300025912 Ga0207707_10054116 Ga0207707_100541166 243
158 3300025915 Ga0207693_10002184 Ga0207693_1000218418 243
159 3300025927 Ga0207687_10040180 Ga0207687_100401803 243
160 3300025928 Ga0207700_10005255 Ga0207700_100052552 243
161 3300025928 Ga0207700_10012034 Ga0207700_100120345 243
162 3300025929 Ga0207664_10019718 Ga0207664_100197185 243
163 3300025934 Ga0207686_10124688 Ga0207686_101246882 243
164 3300025949 Ga0207667_10000708 Ga0207667_100007085 243
165 3300025986 Ga0207658_10313711 Ga0207658_103137112 243
166 3300026023 Ga0207677_10009387 Ga0207677_100093873 243
167 3300026121 Ga0207683_10165202 Ga0207683_101652023 243
168 3300028381 Ga0268264_10084884 Ga0268264_100848843 243
169 3300030760 Ga0265762_1012207 Ga0265762_10122072 243
170 3300000546 LJNas_1000808 LJNas_10008084 244
171 3300005434 Ga0070709_10121752 Ga0070709_101217522 244
172 3300005435 Ga0070714_100139733 Ga0070714_1001397332 244
173 3300005436 Ga0070713_100114870 Ga0070713_1001148703 244
174 3300005436 Ga0070713_100252971 Ga0070713_1002529711 244
175 3300005458 Ga0070681_10371698 Ga0070681_103716982 244
176 3300005458 Ga0070681_10444857 Ga0070681_104448571 244
177 3300005530 Ga0070679_100265840 Ga0070679_1002658402 244
178 3300005530 Ga0070679_100565861 Ga0070679_1005658611 244
179 3300005545 Ga0070695_100097819 Ga0070695_1000978192 244
180 3300006028 Ga0070717_10305121 Ga0070717_103051212 244
181 3300006914 Ga0075436_100001061 Ga0075436_1000010617 244
182 3300009093 Ga0105240_10034130 Ga0105240_100341304 244
183 3300025906 Ga0207699_10212482 Ga0207699_102124822 244
184 3300025911 Ga0207654_10374505 Ga0207654_103745051 244
185 3300025912 Ga0207707_10263706 Ga0207707_102637061 244
186 3300025913 Ga0207695_10098609 Ga0207695_100986093 244
187 3300025928 Ga0207700_10194733 Ga0207700_101947331 244
188 3300025929 Ga0207664_10148802 Ga0207664_101488023 244
189 3300028800 Ga0265338_10002910 Ga0265338_100029101 244
190 3300031344 Ga0265316_10355891 Ga0265316_103558911 244
191 3300031712 Ga0265342_10125352 Ga0265342_101253522 244
192 3300035086 Ga0373934_0053286 Ga0373934_0053286_238_1098 244
193 3300035111 Ga0373923_0056568 Ga0373923_0056568_508_1368 244
194 3300035119 Ga0373956_0097099 Ga0373956_0097099_322_1182 244
195 3300035170 Ga0373943_0001752 Ga0373943_0001752_8696_9556 244
196 3300035171 Ga0373946_0059159 Ga0373946_0059159_674_1534 244
197 3300035410 Ga0373924_0011344 Ga0373924_0011344_282_1142 244
198 3300035692 Ga0373935_0005301 Ga0373935_0005301_2419_3279 244
199 3300035695 Ga0373927_0000229 Ga0373927_0000229_33379_34239 244
200 3300035725 Ga0373947_0009478 Ga0373947_0009478_391_1251 244
201 3300036401 Ga0373937_0027681 Ga0373937_0027681_3468_4328 244
202 3300037068 Ga0373925_0292113 Ga0373925_0292113_254_1114 244
203 3300046472 Ga0495580_0195561 Ga0495580_0195561_316_1176 244
204 3300046477 Ga0495664_0208564 Ga0495664_0208564_226_1086 244
205 3300046516 Ga0495628_0064803 Ga0495628_0064803_255_1115 244
206 3300046690 Ga0495624_0056773 Ga0495624_0056773_1389_2249 244
207 3300047317 Ga0495604_0152281 Ga0495604_0152281_83_943 244
208 3300047319 Ga0495674_0119590 Ga0495674_0119590_929_1789 244
209 3300047322 Ga0495680_0172176 Ga0495680_0172176_131_991 244
210 3300048905 Ga0496102_0083537 Ga0496102_0083537_623_1453 244
211 3300050514 nmdc:mga08x19_1517_c1 nmdc:mga08x19_1517_c1_11877_12698 244
212 3300050514 nmdc:mga08x19_8058_c1 nmdc:mga08x19_8058_c1_108_938 244
213 3300005435 Ga0070714_100161464 Ga0070714_1001614641 245
214 3300005445 Ga0070708_100034268 Ga0070708_1000342684 245
215 3300005467 Ga0070706_100018145 Ga0070706_1000181454 245
216 3300005468 Ga0070707_100229201 Ga0070707_1002292012 245
217 3300005471 Ga0070698_100070545 Ga0070698_1000705453 245
218 3300006852 Ga0075433_10020953 Ga0075433_100209537 245
219 3300006871 Ga0075434_100000976 Ga0075434_10000097611 245
220 3300006914 Ga0075436_100033643 Ga0075436_1000336436 245
221 3300007076 Ga0075435_100001744 Ga0075435_10000174411 245
222 3300009147 Ga0114129_10271973 Ga0114129_102719733 245
223 3300022732 Ga0224569_102017 Ga0224569_1020171 245
224 3300025910 Ga0207684_10016631 Ga0207684_100166314 245
225 3300025922 Ga0207646_10105166 Ga0207646_101051662 245
226 3300025928 Ga0207700_10251319 Ga0207700_102513192 245
227 3300028017 Ga0265356_1000078 Ga0265356_100007818 245
228 3300031090 Ga0265760_10001517 Ga0265760_100015175 245
229 3300044735 Ga0466968_0149246 Ga0466968_0149246_167_988 245
230 3300046472 Ga0495580_0044298 Ga0495580_0044298_2216_2995 245
231 3300005435 Ga0070714_100251381 Ga0070714_1002513812 246
232 3300005436 Ga0070713_100000349 Ga0070713_10000034922 246
233 3300005437 Ga0070710_10094328 Ga0070710_100943282 246
234 3300005439 Ga0070711_100006200 Ga0070711_1000062004 246
235 3300005439 Ga0070711_100378128 Ga0070711_1003781281 246
236 3300006028 Ga0070717_10001227 Ga0070717_1000122715 246
237 3300006173 Ga0070716_100066983 Ga0070716_1000669832 246
238 3300006175 Ga0070712_100000586 Ga0070712_10000058616 246
239 3300021377 Ga0213874_10022180 Ga0213874_100221802 246
240 3300025898 Ga0207692_10007889 Ga0207692_100078892 246
241 3300025915 Ga0207693_10000142 Ga0207693_100001423 246
242 3300025928 Ga0207700_10000200 Ga0207700_100002002 246
243 3300025929 Ga0207664_10000033 Ga0207664_10000033132 246
244 3300025929 Ga0207664_10137666 Ga0207664_101376662 246
245 3300025939 Ga0207665_10074992 Ga0207665_100749922 246
246 3300031090 Ga0265760_10015386 Ga0265760_100153863 246
247 3300031090 Ga0265760_10020798 Ga0265760_100207983 246
248 3300035116 Ga0373945_0018990 Ga0373945_0018990_1241_2101 246
249 3300039450 Ga0436363_1637340 Ga0436363_1637340_631_1479 246
250 3300046684 Ga0495669_0155469 Ga0495669_0155469_58_915 246
251 3300048907 Ga0496104_0077313 Ga0496104_0077313_2283_3143 246
252 3300048908 Ga0496105_0379352 Ga0496105_0379352_38_898 246
253 3300048917 Ga0496114_0461611 Ga0496114_0461611_210_1070 246
254 3300048918 Ga0496115_0032038 Ga0496115_0032038_90_950 246
255 3300050507 nmdc:mga05p37_314944_c1 nmdc:mga05p37_314944_c1_314_1126 246
256 3300050512 nmdc:mga0n895_1952_c1 nmdc:mga0n895_1952_c1_14420_15232 246
257 3300050513 nmdc:mga0rr50_19062_c1 nmdc:mga0rr50_19062_c1_706_1518 246
258 3300050514 nmdc:mga08x19_12762_c1 nmdc:mga08x19_12762_c1_2146_2958 246
259 3300050515 nmdc:mga0a205_25965_c1 nmdc:mga0a205_25965_c1_1796_2608 246
260 3300005329 Ga0070683_100360942 Ga0070683_1003609421 247
261 3300005353 Ga0070669_100071985 Ga0070669_1000719853 247
262 3300005434 Ga0070709_10174044 Ga0070709_101740441 247
263 3300005435 Ga0070714_100102883 Ga0070714_1001028833 247
264 3300005436 Ga0070713_100007744 Ga0070713_1000077447 247
265 3300005436 Ga0070713_100248899 Ga0070713_1002488991 247
266 3300005437 Ga0070710_10039878 Ga0070710_100398782 247
267 3300005444 Ga0070694_100410831 Ga0070694_1004108312 247
268 3300005530 Ga0070679_100043848 Ga0070679_1000438484 247
269 3300005544 Ga0070686_100124596 Ga0070686_1001245962 247
270 3300005577 Ga0068857_100324320 Ga0068857_1003243201 247
271 3300005614 Ga0068856_100346291 Ga0068856_1003462911 247
272 3300005840 Ga0068870_10050699 Ga0068870_100506991 247
273 3300005842 Ga0068858_100029444 Ga0068858_1000294442 247
274 3300006175 Ga0070712_100053544 Ga0070712_1000535442 247
275 3300006175 Ga0070712_100147640 Ga0070712_1001476402 247
276 3300006237 Ga0097621_100081412 Ga0097621_1000814122 247
277 3300007076 Ga0075435_100415531 Ga0075435_1004155312 247
278 3300009101 Ga0105247_10040642 Ga0105247_100406422 247
279 3300009174 Ga0105241_10059045 Ga0105241_100590453 247
280 3300009177 Ga0105248_10017692 Ga0105248_100176922 247
281 3300013308 Ga0157375_10351179 Ga0157375_103511793 247
282 3300014968 Ga0157379_10004138 Ga0157379_100041385 247
283 3300017792 Ga0163161_10281715 Ga0163161_102817152 247
284 3300025898 Ga0207692_10015363 Ga0207692_100153633 247
285 3300025899 Ga0207642_10171159 Ga0207642_101711592 247
286 3300025906 Ga0207699_10187701 Ga0207699_101877012 247
287 3300025915 Ga0207693_10140916 Ga0207693_101409162 247
288 3300025923 Ga0207681_10068171 Ga0207681_100681713 247
289 3300025924 Ga0207694_10209105 Ga0207694_102091053 247
290 3300025928 Ga0207700_10005553 Ga0207700_100055538 247
291 3300025929 Ga0207664_10120028 Ga0207664_101200283 247
292 3300025934 Ga0207686_10177896 Ga0207686_101778962 247
293 3300025939 Ga0207665_10063717 Ga0207665_100637172 247
294 3300025942 Ga0207689_10026073 Ga0207689_100260735 247
295 3300025944 Ga0207661_10118293 Ga0207661_101182934 247
296 3300025945 Ga0207679_10043673 Ga0207679_100436734 247
297 3300025981 Ga0207640_10248866 Ga0207640_102488662 247
298 3300025986 Ga0207658_10165243 Ga0207658_101652433 247
299 3300026035 Ga0207703_10165382 Ga0207703_101653823 247
300 3300026041 Ga0207639_10255826 Ga0207639_102558263 247
301 3300028379 Ga0268266_10613426 Ga0268266_106134262 247
302 3300030760 Ga0265762_1001988 Ga0265762_10019884 247
303 3300035170 Ga0373943_0171757 Ga0373943_0171757_174_1007 247
304 3300035692 Ga0373935_0040938 Ga0373935_0040938_1260_2120 247
305 3300035692 Ga0373935_0280923 Ga0373935_0280923_263_1111 247
306 3300035724 Ga0373933_0028769 Ga0373933_0028769_300_1145 247
307 3300035724 Ga0373933_0189851 Ga0373933_0189851_211_1059 247
308 3300036401 Ga0373937_0093206 Ga0373937_0093206_1621_2466 247
309 3300036401 Ga0373937_0236070 Ga0373937_0236070_540_1400 247
310 3300046517 Ga0495630_0356637 Ga0495630_0356637_134_994 247
311 3300046543 Ga0495645_0127644 Ga0495645_0127644_816_1676 247
312 3300047319 Ga0495674_0022349 Ga0495674_0022349_271_1119 247
313 3300047319 Ga0495674_0046114 Ga0495674_0046114_2713_3573 247
314 3300048905 Ga0496102_0015404 Ga0496102_0015404_3519_4301 247
315 3300048906 Ga0496103_0014109 Ga0496103_0014109_1025_1807 247
316 3300048907 Ga0496104_0014057 Ga0496104_0014057_2007_2789 247
317 3300048909 Ga0496106_0035779 Ga0496106_0035779_454_1236 247
318 3300048910 Ga0496107_0117036 Ga0496107_0117036_55_837 247
319 3300048916 Ga0496113_0248108 Ga0496113_0248108_582_1364 247
320 3300050513 nmdc:mga0rr50_432027_c1 nmdc:mga0rr50_432027_c1_27_869 247
321 3300005334 Ga0068869_100005013 Ga0068869_1000050137 248
322 3300005338 Ga0068868_100084460 Ga0068868_1000844603 248
323 3300005441 Ga0070700_100419361 Ga0070700_1004193611 248
324 3300005445 Ga0070708_100071788 Ga0070708_1000717883 248
325 3300005459 Ga0068867_100200660 Ga0068867_1002006601 248
326 3300005467 Ga0070706_100279323 Ga0070706_1002793232 248
327 3300005617 Ga0068859_100018009 Ga0068859_1000180092 248
328 3300005842 Ga0068858_100003905 Ga0068858_1000039052 248
329 3300005844 Ga0068862_100096372 Ga0068862_1000963722 248
330 3300006175 Ga0070712_100150346 Ga0070712_1001503462 248
331 3300006881 Ga0068865_100065979 Ga0068865_1000659793 248
332 3300006931 Ga0097620_100018009 Ga0097620_1000180092 248
333 3300009098 Ga0105245_10136625 Ga0105245_101366253 248
334 3300009545 Ga0105237_10032309 Ga0105237_100323096 248
335 3300010375 Ga0105239_10032973 Ga0105239_100329732 248
336 3300013296 Ga0157374_10002450 Ga0157374_100024504 248
337 3300013306 Ga0163162_10031676 Ga0163162_100316765 248
338 3300014968 Ga0157379_10146181 Ga0157379_101461813 248
339 3300025899 Ga0207642_10125451 Ga0207642_101254512 248
340 3300025910 Ga0207684_10216174 Ga0207684_102161743 248
341 3300025915 Ga0207693_10200397 Ga0207693_102003973 248
342 3300025915 Ga0207693_10357030 Ga0207693_103570302 248
343 3300025929 Ga0207664_10150295 Ga0207664_101502952 248
344 3300025942 Ga0207689_10000788 Ga0207689_1000078817 248
345 3300026023 Ga0207677_10031822 Ga0207677_100318221 248
346 3300026035 Ga0207703_10005982 Ga0207703_100059824 248
347 3300026041 Ga0207639_10181844 Ga0207639_101818443 248
348 3300026075 Ga0207708_10447663 Ga0207708_104476632 248
349 3300028380 Ga0268265_10531415 Ga0268265_105314151 248
350 3300028381 Ga0268264_10051570 Ga0268264_100515702 248
351 3300031249 Ga0265339_10061810 Ga0265339_100618103 248
352 3300035695 Ga0373927_0201130 Ga0373927_0201130_345_1202 248
353 3300035725 Ga0373947_0125667 Ga0373947_0125667_193_1050 248
354 3300046472 Ga0495580_0005055 Ga0495580_0005055_8135_8950 248
355 3300046472 Ga0495580_0010833 Ga0495580_0010833_4177_5034 248
356 3300048914 Ga0496111_0358550 Ga0496111_0358550_211_1014 248
357 3300048915 Ga0496112_0001953 Ga0496112_0001953_13221_14024 248
358 3300005434 Ga0070709_10028860 Ga0070709_100288604 249
359 3300005436 Ga0070713_100247965 Ga0070713_1002479653 249
360 3300005445 Ga0070708_100034096 Ga0070708_1000340962 249
361 3300005518 Ga0070699_100025429 Ga0070699_1000254294 249
362 3300005614 Ga0068856_100647396 Ga0068856_1006473961 249
363 3300006028 Ga0070717_10006485 Ga0070717_100064855 249
364 3300009101 Ga0105247_10262041 Ga0105247_102620412 249
365 3300014968 Ga0157379_10125002 Ga0157379_101250023 249
366 3300025928 Ga0207700_10128012 Ga0207700_101280122 249
367 3300026078 Ga0207702_10149489 Ga0207702_101494893 249
368 3300031090 Ga0265760_10000599 Ga0265760_100005995 249
369 3300031247 Ga0265340_10063336 Ga0265340_100633362 249
370 3300031344 Ga0265316_10038118 Ga0265316_100381184 249
371 3300035725 Ga0373947_0185149 Ga0373947_0185149_295_1152 249
372 3300046472 Ga0495580_0006797 Ga0495580_0006797_381_1238 249
373 3300005434 Ga0070709_10230519 Ga0070709_102305192 250
374 3300005434 Ga0070709_10501164 Ga0070709_105011641 250
375 3300005437 Ga0070710_10030400 Ga0070710_100304003 250
376 3300005471 Ga0070698_100085199 Ga0070698_1000851993 250
377 3300006028 Ga0070717_10104044 Ga0070717_101040443 250
378 3300006852 Ga0075433_10018081 Ga0075433_100180811 250
379 3300006871 Ga0075434_100006334 Ga0075434_1000063347 250
380 3300007076 Ga0075435_100218125 Ga0075435_1002181252 250
381 3300025906 Ga0207699_10167265 Ga0207699_101672652 250
382 3300025910 Ga0207684_10057475 Ga0207684_100574752 250
383 3300026023 Ga0207677_10014999 Ga0207677_100149993 250
384 3300030879 Ga0265765_1002398 Ga0265765_10023982 250
385 3300046472 Ga0495580_0084543 Ga0495580_0084543_1061_1876 250
386 3300046472 Ga0495580_0134094 Ga0495580_0134094_877_1689 250
387 3300046472 Ga0495580_0281597 Ga0495580_0281597_73_912 250
388 3300050512 nmdc:mga0n895_4619_c1 nmdc:mga0n895_4619_c1_3883_4704 250
389 3300050513 nmdc:mga0rr50_139752_c1 nmdc:mga0rr50_139752_c1_464_1285 250
390 3300050515 nmdc:mga0a205_23451_c1 nmdc:mga0a205_23451_c1_4342_5163 250
391 3300005434 Ga0070709_10169412 Ga0070709_101694121 251
392 3300005435 Ga0070714_100093450 Ga0070714_1000934502 251
393 3300005435 Ga0070714_100428047 Ga0070714_1004280471 251
394 3300005445 Ga0070708_100156735 Ga0070708_1001567353 251
395 3300005467 Ga0070706_100350143 Ga0070706_1003501432 251
396 3300005468 Ga0070707_100247308 Ga0070707_1002473084 251
397 3300006175 Ga0070712_100044643 Ga0070712_1000446434 251
398 3300006914 Ga0075436_100083203 Ga0075436_1000832032 251
399 3300014969 Ga0157376_10873879 Ga0157376_108738791 251
400 3300024225 Ga0224572_1007744 Ga0224572_10077442 251
401 3300024227 Ga0228598_1005499 Ga0228598_10054992 251
402 3300025906 Ga0207699_10062563 Ga0207699_100625631 251
403 3300025910 Ga0207684_10107579 Ga0207684_101075793 251
404 3300025913 Ga0207695_10012611 Ga0207695_100126118 251
405 3300025928 Ga0207700_10231339 Ga0207700_102313392 251
406 3300025929 Ga0207664_10101560 Ga0207664_101015603 251
407 3300028800 Ga0265338_10145770 Ga0265338_101457703 251
408 3300031235 Ga0265330_10008062 Ga0265330_100080624 251
409 3300031241 Ga0265325_10037851 Ga0265325_100378513 251
410 3300047319 Ga0495674_0081276 Ga0495674_0081276_213_1070 251
411 3300005290 Ga0065712_10012754 Ga0065712_100127545 252
412 3300005327 Ga0070658_10222701 Ga0070658_102227011 252
413 3300005331 Ga0070670_100140082 Ga0070670_1001400822 252
414 3300005337 Ga0070682_100189805 Ga0070682_1001898051 252
415 3300005339 Ga0070660_100039184 Ga0070660_1000391844 252
416 3300005344 Ga0070661_100124528 Ga0070661_1001245281 252
417 3300005345 Ga0070692_10358368 Ga0070692_103583681 252
418 3300005366 Ga0070659_100097351 Ga0070659_1000973513 252
419 3300005434 Ga0070709_10166165 Ga0070709_101661651 252
420 3300005457 Ga0070662_100028429 Ga0070662_1000284295 252
421 3300005458 Ga0070681_10340082 Ga0070681_103400821 252
422 3300005530 Ga0070679_100158480 Ga0070679_1001584802 252
423 3300005535 Ga0070684_100080931 Ga0070684_1000809312 252
424 3300005539 Ga0068853_100119350 Ga0068853_1001193503 252
425 3300005563 Ga0068855_100167179 Ga0068855_1001671792 252
426 3300005564 Ga0070664_100042196 Ga0070664_1000421964 252
427 3300005577 Ga0068857_100179694 Ga0068857_1001796941 252
428 3300005578 Ga0068854_100167452 Ga0068854_1001674522 252
429 3300005614 Ga0068856_100173176 Ga0068856_1001731762 252
430 3300005618 Ga0068864_100272688 Ga0068864_1002726882 252
431 3300005834 Ga0068851_10028964 Ga0068851_100289644 252
432 3300005841 Ga0068863_100083550 Ga0068863_1000835505 252
433 3300006028 Ga0070717_10256469 Ga0070717_102564692 252
434 3300009093 Ga0105240_10166863 Ga0105240_101668632 252
435 3300009093 Ga0105240_10253790 Ga0105240_102537902 252
436 3300009545 Ga0105237_10042776 Ga0105237_100427764 252
437 3300010375 Ga0105239_10090842 Ga0105239_100908423 252
438 3300013105 Ga0157369_10183867 Ga0157369_101838671 252
439 3300013296 Ga0157374_10129725 Ga0157374_101297252 252
440 3300013297 Ga0157378_10080384 Ga0157378_100803842 252
441 3300013297 Ga0157378_10230242 Ga0157378_102302422 252
442 3300013307 Ga0157372_10108506 Ga0157372_101085063 252
443 3300015265 Ga0182005_1019017 Ga0182005_10190172 252
444 3300024227 Ga0228598_1004351 Ga0228598_10043513 252
445 3300025321 Ga0207656_10015696 Ga0207656_100156963 252
446 3300025904 Ga0207647_10000903 Ga0207647_1000090320 252
447 3300025909 Ga0207705_10239633 Ga0207705_102396332 252
448 3300025919 Ga0207657_10028691 Ga0207657_100286914 252
449 3300025922 Ga0207646_10292427 Ga0207646_102924272 252
450 3300025932 Ga0207690_10031811 Ga0207690_100318112 252
451 3300025933 Ga0207706_10087946 Ga0207706_100879463 252
452 3300025939 Ga0207665_10347106 Ga0207665_103471062 252
453 3300025945 Ga0207679_10066596 Ga0207679_100665964 252
454 3300025981 Ga0207640_10035589 Ga0207640_100355892 252
455 3300026041 Ga0207639_10192197 Ga0207639_101921972 252
456 3300026088 Ga0207641_10149681 Ga0207641_101496812 252
457 3300026089 Ga0207648_10016467 Ga0207648_100164671 252
458 3300026095 Ga0207676_10166498 Ga0207676_101664982 252
459 3300026116 Ga0207674_10133203 Ga0207674_101332034 252
460 3300026118 Ga0207675_100093618 Ga0207675_1000936181 252
461 3300028800 Ga0265338_10035271 Ga0265338_100352715 252
462 3300039437 Ga0436365_0109293 Ga0436365_0109293_425_1243 252
463 3300039453 Ga0436362_1207079 Ga0436362_1207079_944_1762 252
464 3300048904 Ga0496101_0089877 Ga0496101_0089877_1142_1957 252
465 3300048905 Ga0496102_0100333 Ga0496102_0100333_850_1665 252
466 3300048906 Ga0496103_0079682 Ga0496103_0079682_682_1497 252
467 3300048909 Ga0496106_0263429 Ga0496106_0263429_358_1173 252
468 3300048912 Ga0496109_0158738 Ga0496109_0158738_1092_1907 252
469 3300048913 Ga0496110_0106280 Ga0496110_0106280_938_1753 252
470 3300048914 Ga0496111_0031062 Ga0496111_0031062_1836_2651 252
471 3300048915 Ga0496112_0591966 Ga0496112_0591966_219_1016 252
472 3300048916 Ga0496113_0315149 Ga0496113_0315149_27_842 252
473 3300005436 Ga0070713_100132471 Ga0070713_1001324713 253
474 3300005445 Ga0070708_100001971 Ga0070708_1000019717 253
475 3300005445 Ga0070708_100213945 Ga0070708_1002139452 253
476 3300005467 Ga0070706_100000173 Ga0070706_10000017373 253
477 3300005467 Ga0070706_100006446 Ga0070706_10000644612 253
478 3300005468 Ga0070707_100009403 Ga0070707_1000094032 253
479 3300005468 Ga0070707_100009720 Ga0070707_1000097209 253
480 3300005471 Ga0070698_100002711 Ga0070698_10000271111 253
481 3300005471 Ga0070698_100009217 Ga0070698_1000092172 253
482 3300005518 Ga0070699_100004975 Ga0070699_1000049752 253
483 3300005518 Ga0070699_100048432 Ga0070699_1000484324 253
484 3300005536 Ga0070697_100001978 Ga0070697_1000019782 253
485 3300005536 Ga0070697_100013157 Ga0070697_1000131573 253
486 3300005536 Ga0070697_100015949 Ga0070697_1000159496 253
487 3300005841 Ga0068863_100513782 Ga0068863_1005137821 253
488 3300005843 Ga0068860_100153069 Ga0068860_1001530694 253
489 3300006028 Ga0070717_10053353 Ga0070717_100533534 253
490 3300009092 Ga0105250_10044260 Ga0105250_100442602 253
491 3300009177 Ga0105248_10435967 Ga0105248_104359671 253
492 3300013306 Ga0163162_10069055 Ga0163162_100690551 253
493 3300025910 Ga0207684_10000267 Ga0207684_1000026765 253
494 3300025910 Ga0207684_10001492 Ga0207684_1000149221 253
495 3300025916 Ga0207663_10088829 Ga0207663_100888292 253
496 3300025922 Ga0207646_10001228 Ga0207646_100012287 253
497 3300025922 Ga0207646_10009914 Ga0207646_100099148 253
498 3300025928 Ga0207700_10062156 Ga0207700_100621563 253
499 3300026088 Ga0207641_10248327 Ga0207641_102483272 253
500 3300026095 Ga0207676_10572049 Ga0207676_105720491 253
501 3300048905 Ga0496102_0323029 Ga0496102_0323029_250_1050 253
502 3300005293 Ga0065715_10110383 Ga0065715_101103833 254
503 3300005329 Ga0070683_100079235 Ga0070683_1000792353 254
504 3300005330 Ga0070690_100183060 Ga0070690_1001830602 254
505 3300005335 Ga0070666_10042107 Ga0070666_100421072 254
506 3300005336 Ga0070680_100101665 Ga0070680_1001016652 254
507 3300005337 Ga0070682_100002630 Ga0070682_1000026309 254
508 3300005338 Ga0068868_100219676 Ga0068868_1002196761 254
509 3300005343 Ga0070687_100139984 Ga0070687_1001399842 254
510 3300005367 Ga0070667_100072289 Ga0070667_1000722893 254
511 3300005434 Ga0070709_10008424 Ga0070709_100084242 254
512 3300005434 Ga0070709_10412151 Ga0070709_104121512 254
513 3300005435 Ga0070714_100143587 Ga0070714_1001435872 254
514 3300005437 Ga0070710_10064638 Ga0070710_100646382 254
515 3300005439 Ga0070711_100412841 Ga0070711_1004128411 254
516 3300005467 Ga0070706_100001330 Ga0070706_10000133021 254
517 3300005535 Ga0070684_100041470 Ga0070684_1000414706 254
518 3300005536 Ga0070697_100000389 Ga0070697_10000038924 254
519 3300005546 Ga0070696_100184200 Ga0070696_1001842001 254
520 3300005547 Ga0070693_100019577 Ga0070693_1000195773 254
521 3300005547 Ga0070693_100120149 Ga0070693_1001201492 254
522 3300005548 Ga0070665_100042008 Ga0070665_1000420083 254
523 3300005578 Ga0068854_100002075 Ga0068854_10000207511 254
524 3300005617 Ga0068859_100023995 Ga0068859_1000239955 254
525 3300005718 Ga0068866_10011374 Ga0068866_100113744 254
526 3300005834 Ga0068851_10008550 Ga0068851_100085501 254
527 3300005843 Ga0068860_100011552 Ga0068860_1000115527 254
528 3300005844 Ga0068862_100008948 Ga0068862_1000089482 254
529 3300005844 Ga0068862_100184422 Ga0068862_1001844223 254
530 3300006163 Ga0070715_10017279 Ga0070715_100172793 254
531 3300006173 Ga0070716_100010654 Ga0070716_1000106544 254
532 3300006173 Ga0070716_100059240 Ga0070716_1000592401 254
533 3300006175 Ga0070712_100479294 Ga0070712_1004792942 254
534 3300006881 Ga0068865_100124149 Ga0068865_1001241492 254
535 3300006931 Ga0097620_100023993 Ga0097620_1000239935 254
536 3300009093 Ga0105240_10461851 Ga0105240_104618512 254
537 3300009098 Ga0105245_10011889 Ga0105245_100118893 254
538 3300009101 Ga0105247_10022118 Ga0105247_100221184 254
539 3300009176 Ga0105242_10222624 Ga0105242_102226241 254
540 3300009545 Ga0105237_10218829 Ga0105237_102188293 254
541 3300009551 Ga0105238_10325517 Ga0105238_103255172 254
542 3300009553 Ga0105249_10009980 Ga0105249_100099807 254
543 3300013102 Ga0157371_10021750 Ga0157371_100217503 254
544 3300013104 Ga0157370_10162084 Ga0157370_101620843 254
545 3300013105 Ga0157369_10050541 Ga0157369_100505414 254
546 3300013296 Ga0157374_10062745 Ga0157374_100627452 254
547 3300013306 Ga0163162_10001911 Ga0163162_1000191111 254
548 3300014325 Ga0163163_10020316 Ga0163163_100203163 254
549 3300014969 Ga0157376_10038613 Ga0157376_100386133 254
550 3300025898 Ga0207692_10039661 Ga0207692_100396612 254
551 3300025900 Ga0207710_10054998 Ga0207710_100549983 254
552 3300025905 Ga0207685_10013586 Ga0207685_100135863 254
553 3300025906 Ga0207699_10006411 Ga0207699_100064112 254
554 3300025906 Ga0207699_10019041 Ga0207699_100190412 254
555 3300025907 Ga0207645_10035862 Ga0207645_100358623 254
556 3300025910 Ga0207684_10022758 Ga0207684_100227584 254
557 3300025913 Ga0207695_10021580 Ga0207695_100215802 254
558 3300025916 Ga0207663_10020803 Ga0207663_100208035 254
559 3300025916 Ga0207663_10218874 Ga0207663_102188741 254
560 3300025919 Ga0207657_10007959 Ga0207657_100079599 254
561 3300025921 Ga0207652_10386872 Ga0207652_103868722 254
562 3300025922 Ga0207646_10449438 Ga0207646_104494381 254
563 3300025927 Ga0207687_10000653 Ga0207687_100006533 254
564 3300025933 Ga0207706_10000102 Ga0207706_1000010212 254
565 3300025939 Ga0207665_10000313 Ga0207665_1000031322 254
566 3300025941 Ga0207711_10002678 Ga0207711_1000267812 254
567 3300025949 Ga0207667_10005798 Ga0207667_100057988 254
568 3300025972 Ga0207668_10029002 Ga0207668_100290023 254
569 3300026023 Ga0207677_10004059 Ga0207677_100040593 254
570 3300026067 Ga0207678_10005273 Ga0207678_100052738 254
571 3300026089 Ga0207648_10103008 Ga0207648_101030084 254
572 3300028017 Ga0265356_1002791 Ga0265356_10027912 254
573 3300031241 Ga0265325_10103160 Ga0265325_101031602 254
574 3300035085 Ga0373929_0002552 Ga0373929_0002552_1370_2230 254
575 3300035241 Ga0373961_0072285 Ga0373961_0072285_159_1049 254
576 3300035242 Ga0373962_0039798 Ga0373962_0039798_10_870 254
577 3300035691 Ga0373931_0042332 Ga0373931_0042332_750_1610 254
578 3300046472 Ga0495580_0253457 Ga0495580_0253457_76_888 254
579 3300048904 Ga0496101_0235719 Ga0496101_0235719_403_1293 254
580 3300048905 Ga0496102_0067241 Ga0496102_0067241_469_1329 254
581 3300048905 Ga0496102_0210163 Ga0496102_0210163_969_1787 254
582 3300048906 Ga0496103_0129954 Ga0496103_0129954_664_1554 254
583 3300048911 Ga0496108_0121361 Ga0496108_0121361_1008_1898 254
584 3300048912 Ga0496109_0075613 Ga0496109_0075613_275_1165 254
585 3300048915 Ga0496112_0484329 Ga0496112_0484329_313_1125 254
586 3300004803 Ga0058862_12671333 Ga0058862_126713332 255
587 3300005331 Ga0070670_100140689 Ga0070670_1001406892 255
588 3300005334 Ga0068869_100101226 Ga0068869_1001012262 255
589 3300005435 Ga0070714_100076929 Ga0070714_1000769294 255
590 3300005436 Ga0070713_100183271 Ga0070713_1001832712 255
591 3300005445 Ga0070708_100026409 Ga0070708_1000264091 255
592 3300005456 Ga0070678_100409109 Ga0070678_1004091092 255
593 3300005467 Ga0070706_100412696 Ga0070706_1004126962 255
594 3300005518 Ga0070699_100136793 Ga0070699_1001367932 255
595 3300005536 Ga0070697_100120348 Ga0070697_1001203482 255
596 3300005564 Ga0070664_100401155 Ga0070664_1004011553 255
597 3300006028 Ga0070717_10005049 Ga0070717_100050495 255
598 3300006175 Ga0070712_100175505 Ga0070712_1001755052 255
599 3300006237 Ga0097621_100367147 Ga0097621_1003671472 255
600 3300007076 Ga0075435_100116605 Ga0075435_1001166052 255
601 3300013296 Ga0157374_10168532 Ga0157374_101685321 255
602 3300014325 Ga0163163_10232342 Ga0163163_102323422 255
603 3300024227 Ga0228598_1003051 Ga0228598_10030514 255
604 3300025911 Ga0207654_10113749 Ga0207654_101137491 255
605 3300025914 Ga0207671_10124011 Ga0207671_101240113 255
606 3300025915 Ga0207693_10168345 Ga0207693_101683452 255
607 3300025922 Ga0207646_10059625 Ga0207646_100596255 255
608 3300025929 Ga0207664_10179778 Ga0207664_101797783 255
609 3300025939 Ga0207665_10249084 Ga0207665_102490843 255
610 3300025942 Ga0207689_10106656 Ga0207689_101066563 255
611 3300025981 Ga0207640_10568507 Ga0207640_105685071 255
612 3300026121 Ga0207683_10226056 Ga0207683_102260563 255
613 3300035691 Ga0373931_0068945 Ga0373931_0068945_646_1503 255
614 3300048918 Ga0496115_0155860 Ga0496115_0155860_386_1210 255
615 3300050513 nmdc:mga0rr50_265403_c1 nmdc:mga0rr50_265403_c1_327_1139 255
616 2162886012 MBSR1b_contig_9625197 MBSR1b_0921.00002720 256
617 3300002075 JGI24738J21930_10017364 JGI24738J21930_100173642 256
618 3300002076 JGI24749J21850_1008375 JGI24749J21850_10083751 256
619 3300002239 JGI24034J26672_10004616 JGI24034J26672_100046161 256
620 3300002459 JGI24751J29686_10008402 JGI24751J29686_100084023 256
621 3300005293 Ga0065715_10115978 Ga0065715_101159783 256
622 3300005327 Ga0070658_10100531 Ga0070658_101005313 256
623 3300005328 Ga0070676_10086462 Ga0070676_100864621 256
624 3300005329 Ga0070683_100092640 Ga0070683_1000926403 256
625 3300005330 Ga0070690_100005450 Ga0070690_1000054504 256
626 3300005333 Ga0070677_10006921 Ga0070677_100069213 256
627 3300005334 Ga0068869_100028015 Ga0068869_1000280154 256
628 3300005335 Ga0070666_10045866 Ga0070666_100458662 256
629 3300005338 Ga0068868_100047171 Ga0068868_1000471714 256
630 3300005339 Ga0070660_100131685 Ga0070660_1001316852 256
631 3300005340 Ga0070689_100040587 Ga0070689_1000405871 256
632 3300005341 Ga0070691_10272379 Ga0070691_102723791 256
633 3300005343 Ga0070687_100003791 Ga0070687_1000037915 256
634 3300005347 Ga0070668_100005248 Ga0070668_1000052488 256
635 3300005353 Ga0070669_100066648 Ga0070669_1000666483 256
636 3300005354 Ga0070675_100017919 Ga0070675_1000179192 256
637 3300005355 Ga0070671_100086528 Ga0070671_1000865282 256
638 3300005356 Ga0070674_100069317 Ga0070674_1000693173 256
639 3300005364 Ga0070673_100069199 Ga0070673_1000691993 256
640 3300005365 Ga0070688_100071053 Ga0070688_1000710533 256
641 3300005366 Ga0070659_100068692 Ga0070659_1000686923 256
642 3300005367 Ga0070667_100045357 Ga0070667_1000453572 256
643 3300005455 Ga0070663_100011290 Ga0070663_1000112905 256
644 3300005457 Ga0070662_100067835 Ga0070662_1000678353 256
645 3300005459 Ga0068867_100004171 Ga0068867_1000041718 256
646 3300005466 Ga0070685_10019163 Ga0070685_100191634 256
647 3300005467 Ga0070706_100509317 Ga0070706_1005093172 256
648 3300005535 Ga0070684_100060175 Ga0070684_1000601753 256
649 3300005539 Ga0068853_100088646 Ga0068853_1000886463 256
650 3300005543 Ga0070672_100007893 Ga0070672_1000078934 256
651 3300005544 Ga0070686_100007812 Ga0070686_1000078124 256
652 3300005563 Ga0068855_100141018 Ga0068855_1001410183 256
653 3300005577 Ga0068857_100298295 Ga0068857_1002982951 256
654 3300005614 Ga0068856_100080672 Ga0068856_1000806723 256
655 3300005615 Ga0070702_100026990 Ga0070702_1000269904 256
656 3300005616 Ga0068852_100004761 Ga0068852_1000047613 256
657 3300005617 Ga0068859_100133591 Ga0068859_1001335912 256
658 3300005718 Ga0068866_10025164 Ga0068866_100251643 256
659 3300005719 Ga0068861_100290149 Ga0068861_1002901492 256
660 3300005834 Ga0068851_10094637 Ga0068851_100946372 256
661 3300005840 Ga0068870_10015319 Ga0068870_100153194 256
662 3300005842 Ga0068858_100320880 Ga0068858_1003208801 256
663 3300005843 Ga0068860_100123140 Ga0068860_1001231403 256
664 3300005844 Ga0068862_100160178 Ga0068862_1001601782 256
665 3300006358 Ga0068871_100309947 Ga0068871_1003099471 256
666 3300006881 Ga0068865_100068595 Ga0068865_1000685953 256
667 3300006931 Ga0097620_100133597 Ga0097620_1001335972 256
668 3300009098 Ga0105245_10039167 Ga0105245_100391675 256
669 3300009101 Ga0105247_10025982 Ga0105247_100259824 256
670 3300009174 Ga0105241_10089749 Ga0105241_100897493 256
671 3300009176 Ga0105242_10140130 Ga0105242_101401302 256
672 3300009177 Ga0105248_10247172 Ga0105248_102471722 256
673 3300009545 Ga0105237_10168145 Ga0105237_101681452 256
674 3300009553 Ga0105249_10037822 Ga0105249_100378224 256
675 3300010375 Ga0105239_10047821 Ga0105239_100478215 256
676 3300011119 Ga0105246_10121128 Ga0105246_101211282 256
677 3300013100 Ga0157373_10062503 Ga0157373_100625033 256
678 3300013102 Ga0157371_10049540 Ga0157371_100495403 256
679 3300013105 Ga0157369_10031967 Ga0157369_100319673 256
680 3300013296 Ga0157374_10157790 Ga0157374_101577903 256
681 3300013297 Ga0157378_10143990 Ga0157378_101439902 256
682 3300013306 Ga0163162_10144535 Ga0163162_101445353 256
683 3300013307 Ga0157372_10050349 Ga0157372_100503494 256
684 3300013308 Ga0157375_10191345 Ga0157375_101913453 256
685 3300014325 Ga0163163_10034896 Ga0163163_100348964 256
686 3300014326 Ga0157380_10083580 Ga0157380_100835803 256
687 3300014745 Ga0157377_10017724 Ga0157377_100177244 256
688 3300014968 Ga0157379_10080461 Ga0157379_100804613 256
689 3300014969 Ga0157376_10110237 Ga0157376_101102372 256
690 3300017792 Ga0163161_10046137 Ga0163161_100461373 256
691 3300025899 Ga0207642_10049539 Ga0207642_100495393 256
692 3300025900 Ga0207710_10026561 Ga0207710_100265611 256
693 3300025903 Ga0207680_10031443 Ga0207680_100314434 256
694 3300025904 Ga0207647_10010492 Ga0207647_100104923 256
695 3300025907 Ga0207645_10057670 Ga0207645_100576703 256
696 3300025908 Ga0207643_10004784 Ga0207643_100047844 256
697 3300025909 Ga0207705_10149758 Ga0207705_101497582 256
698 3300025914 Ga0207671_10200641 Ga0207671_102006412 256
699 3300025918 Ga0207662_10002927 Ga0207662_100029274 256
700 3300025919 Ga0207657_10153539 Ga0207657_101535392 256
701 3300025920 Ga0207649_10009110 Ga0207649_100091105 256
702 3300025923 Ga0207681_10076561 Ga0207681_100765612 256
703 3300025925 Ga0207650_10000442 Ga0207650_1000044211 256
704 3300025926 Ga0207659_10085844 Ga0207659_100858442 256
705 3300025927 Ga0207687_10031084 Ga0207687_100310844 256
706 3300025931 Ga0207644_10063031 Ga0207644_100630313 256
707 3300025932 Ga0207690_10095894 Ga0207690_100958941 256
708 3300025933 Ga0207706_10000651 Ga0207706_1000065120 256
709 3300025936 Ga0207670_10022758 Ga0207670_100227584 256
710 3300025937 Ga0207669_10060309 Ga0207669_100603092 256
711 3300025938 Ga0207704_10005477 Ga0207704_100054776 256
712 3300025940 Ga0207691_10005111 Ga0207691_100051113 256
713 3300025941 Ga0207711_10074835 Ga0207711_100748354 256
714 3300025942 Ga0207689_10008927 Ga0207689_100089278 256
715 3300025944 Ga0207661_10000213 Ga0207661_1000021328 256
716 3300025945 Ga0207679_10000080 Ga0207679_1000008070 256
717 3300025949 Ga0207667_10166549 Ga0207667_101665492 256
718 3300025960 Ga0207651_10071799 Ga0207651_100717992 256
719 3300025986 Ga0207658_10046413 Ga0207658_100464133 256
720 3300026023 Ga0207677_10014783 Ga0207677_100147831 256
721 3300026041 Ga0207639_10205210 Ga0207639_102052101 256
722 3300026067 Ga0207678_10024713 Ga0207678_100247132 256
723 3300026088 Ga0207641_10000432 Ga0207641_1000043211 256
724 3300026089 Ga0207648_10001706 Ga0207648_100017064 256
725 3300026095 Ga0207676_10000586 Ga0207676_100005865 256
726 3300026116 Ga0207674_10001107 Ga0207674_1000110722 256
727 3300026121 Ga0207683_10004817 Ga0207683_100048173 256
728 3300028379 Ga0268266_10122619 Ga0268266_101226193 256
729 3300028380 Ga0268265_10006060 Ga0268265_100060608 256
730 3300028381 Ga0268264_10097039 Ga0268264_100970392 256
731 3300031090 Ga0265760_10003165 Ga0265760_100031655 256
732 3300048904 Ga0496101_0226494 Ga0496101_0226494_79_879 256
733 3300048905 Ga0496102_0309607 Ga0496102_0309607_648_1448 256
734 3300048907 Ga0496104_0086818 Ga0496104_0086818_895_1695 256
735 3300048909 Ga0496106_0095340 Ga0496106_0095340_823_1623 256
736 3300048911 Ga0496108_0000228 Ga0496108_0000228_856_1656 256
737 3300048912 Ga0496109_0000362 Ga0496109_0000362_1739_2539 256
738 3300048913 Ga0496110_0001221 Ga0496110_0001221_2714_3514 256
739 3300048914 Ga0496111_0062347 Ga0496111_0062347_1888_2688 256
740 3300048915 Ga0496112_0000034 Ga0496112_0000034_102010_102810 256
741 3300048916 Ga0496113_0019265 Ga0496113_0019265_1567_2367 256
742 3300048918 Ga0496115_0091842 Ga0496115_0091842_866_1666 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

200

256

0.96

PF00072

Response_reg

Response regulator receiver domain

54

165

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9687 174 230
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9615 175 235
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9537 174 234
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.953 174 234
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9515 174 234
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9729 175 230 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9687 174 230 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9535 174 227 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9517 175 235 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.946 175 230 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F9DBB4-F1-model_v4 Response regulatory domain-containing protein 0.9111 24 151 GO:0000160
AF-A0A7V6FDJ7-F1-model_v4 Response regulator transcription factor 0.9035 22 144 GO:0000160
AF-A0A7W0GWP8-F1-model_v4 Response regulator transcription factor 0.9031 21 143 GO:0000160
AF-A0A356A557-F1-model_v4 DNA-binding response regulator 0.8993 23 161 GO:0000160
GO:0003677
AF-G9WXZ7-F1-model_v4 Stage 0 sporulation protein A homolog 0.8842 25 163 GO:0000160

Feature Viewer

pLDDT pTM Quality
80.48 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map