F478394

General Info

Members Datasets Scaffolds Average Seq Length
738 255 1476 262

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10455080|Ga0207679_104550801
Length 297
Sequence VGVLGEELAQAVESCLPGRAPLLDPALGGAQRLGPHLAGAHPSALLRADEAAGLQHLEELRRRIIYSIIAVGVGFFFCWGYASRIYALMQKPIIDVLHSHNLPEKLVFLSPTEPFNLYLKIGFMSGIFVASPFVLYQLWMFISPGLYRNEKRYVFPFMGSTIILFAAGAVFGYKLVYPQALNFLIEYGVQFQPMITIGEYTDLFLTIILGLGVIFELPILVFFLALMGVVSAGWMWRNLRYSILGIFTIAAIVTPTTDIMNMCLFAAPMIILYVISIAIAWFVHPRQRKARQARKNQ

Samples

Sample ID Description Type Environment
1 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
248 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
249 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
250 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.2
Rhizosphere 94.58
Stem 0
Stem Tuber 0
Unclassified 22.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207679_10455080 3300025945 Bacteria 1136
2 MRS1b_contig_9212784 2162886011 Unclassified 1242
3 JGI24737J22298_10050251 3300001990 Unclassified 1268
4 JGI24743J22301_10031702 3300001991 Synthetic 1042
5 Ga0065712_10117106 3300005290 Bacteria 1714
6 Ga0065712_10117566 3300005290 Unclassified 1718
7 Ga0065712_10246933 3300005290 Bacteria 969
8 Ga0065712_10272610 3300005290 Bacteria 912
9 Ga0065715_10145026 3300005293 Bacteria 1799
10 Ga0065715_10407363 3300005293 Bacteria 874
11 Ga0070658_10552986 3300005327 Bacteria 996
12 Ga0070676_10170230 3300005328 Unclassified 1408
13 Ga0070683_100000996 3300005329 Bacteria 21213
14 Ga0070683_100073142 3300005329 Unclassified 3201
15 Ga0070683_100100788 3300005329 Unclassified 2719
16 Ga0070683_100200734 3300005329 Unclassified 1894
17 Ga0070690_100130224 3300005330 Bacteria 1698
18 Ga0070690_100178498 3300005330 Unclassified 1466
19 Ga0070670_100010214 3300005331 Bacteria 8011
20 Ga0070670_100022664 3300005331 Bacteria 5404
21 Ga0070670_100186273 3300005331 Unclassified 1802
22 Ga0070670_100217955 3300005331 Bacteria 1660
23 Ga0070677_10022501 3300005333 Bacteria 2323
24 Ga0068869_100006311 3300005334 Bacteria 7506
25 Ga0068869_100401888 3300005334 Bacteria 1127
26 Ga0070666_10034392 3300005335 Unclassified 3358
27 Ga0070680_100023130 3300005336 Unclassified 4954
28 Ga0070680_100076357 3300005336 Bacteria 2758
29 Ga0070682_100002535 3300005337 Bacteria 10083
30 Ga0068868_100003985 3300005338 Bacteria 10312
31 Ga0068868_100006259 3300005338 Bacteria 8418
32 Ga0068868_100282120 3300005338 Bacteria 1406
33 Ga0070660_100006382 3300005339 Bacteria 8171
34 Ga0070660_100032389 3300005339 Bacteria 3933
35 Ga0070660_100043786 3300005339 Unclassified 3421
36 Ga0070660_100421576 3300005339 Bacteria 1105
37 Ga0070689_100000844 3300005340 Bacteria 19045
38 Ga0070689_100028593 3300005340 Bacteria 4215
39 Ga0070689_100320977 3300005340 Bacteria 1293
40 Ga0070687_100002055 3300005343 Bacteria 7398
41 Ga0070687_100331765 3300005343 Bacteria 975
42 Ga0070661_100019010 3300005344 Bacteria 4891
43 Ga0070661_100034867 3300005344 Bacteria 3651
44 Ga0070668_100008093 3300005347 Bacteria 7809
45 Ga0070668_100078168 3300005347 Bacteria 2587
46 Ga0070669_100177950 3300005353 Unclassified 1662
47 Ga0070675_100002781 3300005354 Bacteria 13167
48 Ga0070675_100342055 3300005354 Bacteria 1325
49 Ga0070671_100122780 3300005355 Bacteria 2186
50 Ga0070674_100022355 3300005356 Unclassified 4078
51 Ga0070673_100016252 3300005364 Bacteria 5257
52 Ga0070673_100457923 3300005364 Bacteria 1148
53 Ga0070688_100014009 3300005365 Unclassified 4535
54 Ga0070659_100015849 3300005366 Bacteria 5651
55 Ga0070667_100012738 3300005367 Bacteria 6953
56 Ga0070709_10008666 3300005434 Bacteria 5595
57 Ga0070709_10119965 3300005434 Unclassified 1781
58 Ga0070709_10204510 3300005434 Bacteria 1400
59 Ga0070709_10334746 3300005434 Unclassified 1115
60 Ga0070709_10357201 3300005434 Bacteria 1081
61 Ga0070714_100062248 3300005435 Bacteria 3207
62 Ga0070714_100081406 3300005435 Bacteria 2818
63 Ga0070714_100114506 3300005435 Bacteria 2392
64 Ga0070714_100145420 3300005435 Unclassified 2132
65 Ga0070714_100230099 3300005435 Unclassified 1707
66 Ga0070714_100369035 3300005435 Bacteria 1351
67 Ga0070713_100027201 3300005436 Unclassified 4501
68 Ga0070713_100062242 3300005436 Bacteria 3125
69 Ga0070713_100076581 3300005436 Bacteria 2842
70 Ga0070713_100127102 3300005436 Bacteria 2244
71 Ga0070713_100128753 3300005436 Bacteria 2230
72 Ga0070713_100173917 3300005436 Bacteria 1930
73 Ga0070710_10022575 3300005437 Bacteria 3293
74 Ga0070710_10024862 3300005437 Unclassified 3164
75 Ga0070710_10159208 3300005437 Bacteria 1399
76 Ga0070711_100017703 3300005439 Bacteria 4539
77 Ga0070711_100033693 3300005439 Bacteria 3412
78 Ga0070711_100039331 3300005439 Bacteria 3185
79 Ga0070711_100052965 3300005439 Unclassified 2795
80 Ga0070711_100057485 3300005439 Unclassified 2694
81 Ga0070711_100075664 3300005439 Bacteria 2385
82 Ga0070711_100292029 3300005439 Bacteria 1293
83 Ga0070705_100150946 3300005440 Bacteria 1541
84 Ga0070694_100075969 3300005444 Bacteria 2325
85 Ga0070708_100003146 3300005445 Bacteria 12861
86 Ga0070708_100003966 3300005445 Bacteria 11615
87 Ga0070708_100023212 3300005445 Bacteria 5272
88 Ga0070708_100037006 3300005445 Unclassified 4256
89 Ga0070708_100081114 3300005445 Bacteria 2937
90 Ga0070708_100089157 3300005445 Unclassified 2806
91 Ga0070708_100158945 3300005445 Bacteria 2105
92 Ga0070708_100189306 3300005445 Bacteria 1924
93 Ga0070708_100660189 3300005445 Unclassified 985
94 Ga0070708_100790906 3300005445 Unclassified 892
95 Ga0070663_100016064 3300005455 Bacteria 4849
96 Ga0070663_100020172 3300005455 Unclassified 4409
97 Ga0070678_100003297 3300005456 Bacteria 8975
98 Ga0070678_100022663 3300005456 Bacteria 4167
99 Ga0070662_100002565 3300005457 Bacteria 11188
100 Ga0070662_100068638 3300005457 Unclassified 2607
101 Ga0070662_100100888 3300005457 Bacteria 2184
102 Ga0070681_10000988 3300005458 Bacteria 24052
103 Ga0070681_10011272 3300005458 Bacteria 8842
104 Ga0070681_10012120 3300005458 Bacteria 8551
105 Ga0070681_10206078 3300005458 Bacteria 1883
106 Ga0070681_10224946 3300005458 Bacteria 1791
107 Ga0070681_10283619 3300005458 Bacteria 1567
108 Ga0068867_100016423 3300005459 Bacteria 5255
109 Ga0068867_100201820 3300005459 Bacteria 1592
110 Ga0068867_100232568 3300005459 Bacteria 1491
111 Ga0070685_10001933 3300005466 Bacteria 10758
112 Ga0070685_10093357 3300005466 Bacteria 1825
113 Ga0070706_100000499 3300005467 Bacteria 45986
114 Ga0070706_100017064 3300005467 Bacteria 6707
115 Ga0070706_100022122 3300005467 Bacteria 5854
116 Ga0070706_100109918 3300005467 Bacteria 2565
117 Ga0070706_100116070 3300005467 Bacteria 2493
118 Ga0070707_100037132 3300005468 Unclassified 4649
119 Ga0070707_100184084 3300005468 Bacteria 2037
120 Ga0070707_100209000 3300005468 Unclassified 1902
121 Ga0070707_100251525 3300005468 Bacteria 1720
122 Ga0070698_100013058 3300005471 Bacteria 8794
123 Ga0070698_100223136 3300005471 Bacteria 1818
124 Ga0070699_100001027 3300005518 Bacteria 25921
125 Ga0070699_100007250 3300005518 Bacteria 9648
126 Ga0070699_100096021 3300005518 Bacteria 2596
127 Ga0070699_100183731 3300005518 Bacteria 1856
128 Ga0070699_100387798 3300005518 Bacteria 1262
129 Ga0070699_100489442 3300005518 Bacteria 1117
130 Ga0070679_100014737 3300005530 Bacteria 7512
131 Ga0070679_100172263 3300005530 Bacteria 2137
132 Ga0070679_100464459 3300005530 Unclassified 1210
133 Ga0070684_100001677 3300005535 Bacteria 16089
134 Ga0070684_100014670 3300005535 Bacteria 6355
135 Ga0070684_100015349 3300005535 Bacteria 6236
136 Ga0070684_100037540 3300005535 Unclassified 4157
137 Ga0070684_100106170 3300005535 Bacteria 2514
138 Ga0070697_100000111 3300005536 Bacteria 63543
139 Ga0070697_100000237 3300005536 Bacteria 44549
140 Ga0070697_100001234 3300005536 Bacteria 19331
141 Ga0070697_100022916 3300005536 Bacteria 4965
142 Ga0070697_100025982 3300005536 Unclassified 4672
143 Ga0070697_100279249 3300005536 Bacteria 1433
144 Ga0068853_100005375 3300005539 Bacteria 10029
145 Ga0068853_100014856 3300005539 Bacteria 6394
146 Ga0068853_100018379 3300005539 Bacteria 5785
147 Ga0068853_100157381 3300005539 Bacteria 2048
148 Ga0070672_100128080 3300005543 Bacteria 2084
149 Ga0070695_100015812 3300005545 Unclassified 4559
150 Ga0070696_100141341 3300005546 Bacteria 1760
151 Ga0070693_100008310 3300005547 Bacteria 5109
152 Ga0070693_100113701 3300005547 Unclassified 1669
153 Ga0070665_100008351 3300005548 Bacteria 10476
154 Ga0070665_100124026 3300005548 Bacteria 2585
155 Ga0070665_100815155 3300005548 Bacteria 946
156 Ga0068855_100000440 3300005563 Bacteria 51346
157 Ga0068855_100001467 3300005563 Bacteria 29462
158 Ga0068855_100033223 3300005563 Bacteria 6159
159 Ga0068855_100058930 3300005563 Bacteria 4495
160 Ga0068855_100119682 3300005563 Bacteria 3015
161 Ga0068855_100133493 3300005563 Unclassified 2833
162 Ga0070664_100000079 3300005564 Bacteria 61393
163 Ga0070664_100020262 3300005564 Bacteria 5476
164 Ga0070664_100054375 3300005564 Unclassified 3396
165 Ga0070664_100090314 3300005564 Unclassified 2651
166 Ga0068857_100004770 3300005577 Bacteria 11483
167 Ga0068857_100040124 3300005577 Unclassified 4151
168 Ga0068857_100107688 3300005577 Unclassified 2503
169 Ga0068854_100014008 3300005578 Bacteria 5276
170 Ga0068854_100022674 3300005578 Unclassified 4283
171 Ga0068854_100037953 3300005578 Bacteria 3385
172 Ga0068854_100047532 3300005578 Bacteria 3059
173 Ga0068854_100335242 3300005578 Bacteria 1234
174 Ga0068856_100000314 3300005614 Bacteria 53174
175 Ga0068856_100000884 3300005614 Bacteria 32074
176 Ga0068856_100001689 3300005614 Bacteria 23073
177 Ga0068856_100013950 3300005614 Bacteria 7769
178 Ga0068856_100013970 3300005614 Bacteria 7765
179 Ga0068856_100045755 3300005614 Unclassified 4310
180 Ga0068856_100195303 3300005614 Bacteria 2038
181 Ga0068856_100202881 3300005614 Bacteria 1997
182 Ga0068856_100282874 3300005614 Bacteria 1675
183 Ga0070702_100131113 3300005615 Unclassified 1583
184 Ga0068852_100005106 3300005616 Bacteria 9349
185 Ga0068852_100008868 3300005616 Bacteria 7439
186 Ga0068852_100073044 3300005616 Unclassified 3016
187 Ga0068852_100237967 3300005616 Unclassified 1738
188 Ga0068859_100000743 3300005617 Bacteria 32840
189 Ga0068859_100029696 3300005617 Bacteria 5486
190 Ga0068859_100107366 3300005617 Bacteria 2852
191 Ga0068859_100617244 3300005617 Unclassified 1177
192 Ga0068866_10000598 3300005718 Bacteria 16433
193 Ga0068866_10105674 3300005718 Bacteria 1561
194 Ga0068866_10109412 3300005718 Bacteria 1539
195 Ga0068861_100004952 3300005719 Bacteria 8971
196 Ga0068861_100058819 3300005719 Unclassified 2941
197 Ga0068861_100068073 3300005719 Bacteria 2750
198 Ga0068861_100086440 3300005719 Bacteria 2465
199 Ga0068851_10029758 3300005834 Bacteria 2705
200 Ga0068870_10001859 3300005840 Bacteria 8688
201 Ga0068870_10034485 3300005840 Unclassified 2590
202 Ga0068863_100007633 3300005841 Bacteria 10579
203 Ga0068863_100027936 3300005841 Bacteria 5385
204 Ga0068863_100033173 3300005841 Bacteria 4918
205 Ga0068863_100076640 3300005841 Bacteria 3163
206 Ga0068863_100119501 3300005841 Bacteria 2512
207 Ga0068863_100169603 3300005841 Unclassified 2093
208 Ga0068863_100278670 3300005841 Bacteria 1620
209 Ga0068858_100008051 3300005842 Bacteria 10151
210 Ga0068858_100010361 3300005842 Bacteria 8830
211 Ga0068858_100037929 3300005842 Bacteria 4469
212 Ga0068858_100400035 3300005842 Bacteria 1319
213 Ga0068860_100011415 3300005843 Bacteria 8752
214 Ga0068860_100017651 3300005843 Bacteria 6953
215 Ga0068860_100072721 3300005843 Bacteria 3268
216 Ga0068860_100132368 3300005843 Bacteria 2394
217 Ga0068862_100039922 3300005844 Bacteria 3988
218 Ga0068862_100040805 3300005844 Unclassified 3946
219 Ga0068862_100048021 3300005844 Unclassified 3644
220 Ga0070717_10001917 3300006028 Bacteria 14536
221 Ga0070717_10003179 3300006028 Bacteria 11734
222 Ga0070717_10005046 3300006028 Bacteria 9617
223 Ga0070717_10009320 3300006028 Bacteria 7377
224 Ga0070717_10014384 3300006028 Bacteria 6087
225 Ga0070717_10037304 3300006028 Unclassified 3946
226 Ga0070717_10198906 3300006028 Unclassified 1754
227 Ga0070717_10223765 3300006028 Bacteria 1655
228 Ga0070717_10278980 3300006028 Unclassified 1482
229 Ga0070717_10290734 3300006028 Bacteria 1451
230 Ga0070717_10326139 3300006028 Unclassified 1369
231 Ga0070717_10506851 3300006028 Bacteria 1091
232 Ga0070716_100000963 3300006173 Bacteria 12483
233 Ga0070716_100009156 3300006173 Bacteria 4928
234 Ga0070716_100017261 3300006173 Bacteria 3738
235 Ga0070716_100037014 3300006173 Unclassified 2694
236 Ga0070716_100037319 3300006173 Bacteria 2685
237 Ga0070716_100059096 3300006173 Unclassified 2209
238 Ga0070712_100001489 3300006175 Bacteria 14297
239 Ga0070712_100004426 3300006175 Bacteria 8668
240 Ga0070712_100028835 3300006175 Bacteria 3716
241 Ga0070712_100319851 3300006175 Unclassified 1261
242 Ga0070712_100394155 3300006175 Unclassified 1142
243 Ga0097621_100000088 3300006237 Bacteria 49698
244 Ga0097621_100000731 3300006237 Bacteria 22963
245 Ga0097621_100001934 3300006237 Bacteria 14133
246 Ga0097621_100009212 3300006237 Bacteria 7159
247 Ga0097621_100032470 3300006237 Unclassified 4150
248 Ga0097621_100083976 3300006237 Bacteria 2654
249 Ga0097621_100576711 3300006237 Unclassified 1026
250 Ga0097621_100666514 3300006237 Bacteria 956
251 Ga0068871_100000266 3300006358 Bacteria 35937
252 Ga0068871_100000428 3300006358 Bacteria 29019
253 Ga0068871_100008870 3300006358 Bacteria 7249
254 Ga0068871_100017378 3300006358 Bacteria 5441
255 Ga0068871_100026158 3300006358 Unclassified 4551
256 Ga0068871_100076855 3300006358 Bacteria 2758
257 Ga0068871_100535561 3300006358 Bacteria 1059
258 Ga0068871_100537222 3300006358 Unclassified 1057
259 Ga0075433_10000048 3300006852 Bacteria 50702
260 Ga0075433_10003910 3300006852 Bacteria 11533
261 Ga0075434_100007179 3300006871 Bacteria 10301
262 Ga0075434_100034614 3300006871 Bacteria 4989
263 Ga0075434_100065078 3300006871 Unclassified 3631
264 Ga0075434_100138002 3300006871 Bacteria 2458
265 Ga0075434_100175929 3300006871 Bacteria 2160
266 Ga0075434_100273872 3300006871 Bacteria 1707
267 Ga0068865_100007069 3300006881 Bacteria 6892
268 Ga0068865_100046813 3300006881 Unclassified 2969
269 Ga0068865_100085305 3300006881 Bacteria 2278
270 Ga0075436_100003918 3300006914 Bacteria 10201
271 Ga0075436_100006016 3300006914 Bacteria 8330
272 Ga0075436_100024846 3300006914 Bacteria 4120
273 Ga0075436_100032947 3300006914 Unclassified 3570
274 Ga0097620_100000743 3300006931 Bacteria 32840
275 Ga0097620_100029691 3300006931 Bacteria 5486
276 Ga0097620_100107371 3300006931 Bacteria 2852
277 Ga0097620_100617320 3300006931 Unclassified 1177
278 Ga0075435_100002276 3300007076 Bacteria 12672
279 Ga0075435_100028468 3300007076 Unclassified 4383
280 Ga0075435_100030477 3300007076 Bacteria 4242
281 Ga0075435_100108003 3300007076 Bacteria 2312
282 Ga0075435_100159998 3300007076 Unclassified 1896
283 Ga0105250_10059427 3300009092 Unclassified 1535
284 Ga0105240_10005076 3300009093 Bacteria 19734
285 Ga0105240_10009676 3300009093 Bacteria 13622
286 Ga0105240_10046006 3300009093 Bacteria 5533
287 Ga0105240_10130352 3300009093 Unclassified 3017
288 Ga0105240_10354797 3300009093 Bacteria 1663
289 Ga0105245_10021687 3300009098 Bacteria 5639
290 Ga0105245_10043511 3300009098 Bacteria 4006
291 Ga0105245_10134582 3300009098 Unclassified 2321
292 Ga0105245_10188012 3300009098 Bacteria 1977
293 Ga0105245_10318767 3300009098 Bacteria 1531
294 Ga0105247_10117309 3300009101 Bacteria 1720
295 Ga0105247_10170366 3300009101 Bacteria 1447
296 Ga0114129_10263397 3300009147 Bacteria 2309
297 Ga0105243_10065709 3300009148 Unclassified 2915
298 Ga0105241_10021553 3300009174 Unclassified 4765
299 Ga0105241_10028616 3300009174 Unclassified 4153
300 Ga0105241_10068900 3300009174 Bacteria 2742
301 Ga0105241_10805168 3300009174 Bacteria 866
302 Ga0105242_10066838 3300009176 Unclassified 2970
303 Ga0105248_10002754 3300009177 Bacteria 19526
304 Ga0105248_10024617 3300009177 Bacteria 6694
305 Ga0105248_10054467 3300009177 Bacteria 4485
306 Ga0105248_10057988 3300009177 Bacteria 4347
307 Ga0105248_10061141 3300009177 Bacteria 4228
308 Ga0105248_10097481 3300009177 Unclassified 3313
309 Ga0105237_10010940 3300009545 Bacteria 9628
310 Ga0105237_10037740 3300009545 Bacteria 4882
311 Ga0105237_10090403 3300009545 Bacteria 3051
312 Ga0105237_10127258 3300009545 Bacteria 2542
313 Ga0105237_10129749 3300009545 Unclassified 2515
314 Ga0105237_10274245 3300009545 Bacteria 1689
315 Ga0105238_10001256 3300009551 Bacteria 25520
316 Ga0105238_10011948 3300009551 Bacteria 8748
317 Ga0105238_10076516 3300009551 Bacteria 3338
318 Ga0105238_10195438 3300009551 Bacteria 1999
319 Ga0105249_10010877 3300009553 Bacteria 7996
320 Ga0105249_10110523 3300009553 Unclassified 2597
321 Ga0105239_10020769 3300010375 Bacteria 7247
322 Ga0105239_10027319 3300010375 Bacteria 6282
323 Ga0105239_10066265 3300010375 Bacteria 3967
324 Ga0105239_10131950 3300010375 Bacteria 2779
325 Ga0105239_10133705 3300010375 Bacteria 2761
326 Ga0105239_10170577 3300010375 Bacteria 2433
327 Ga0105246_10130306 3300011119 Unclassified 1878
328 Ga0157373_10009346 3300013100 Bacteria 7244
329 Ga0157373_10181386 3300013100 Bacteria 1482
330 Ga0157371_10011620 3300013102 Bacteria 6769
331 Ga0157371_10042533 3300013102 Unclassified 3238
332 Ga0157371_10068655 3300013102 Bacteria 2509
333 Ga0157369_10000196 3300013105 Bacteria 84536
334 Ga0157369_10001722 3300013105 Bacteria 26646
335 Ga0157369_10010846 3300013105 Bacteria 10379
336 Ga0157369_10014078 3300013105 Bacteria 9038
337 Ga0157369_10021606 3300013105 Bacteria 7197
338 Ga0157369_10047180 3300013105 Bacteria 4679
339 Ga0157369_10124427 3300013105 Bacteria 2735
340 Ga0157369_10252144 3300013105 Bacteria 1842
341 Ga0157369_10406164 3300013105 Bacteria 1413
342 Ga0157369_10428591 3300013105 Bacteria 1371
343 Ga0157374_10000312 3300013296 Bacteria 45142
344 Ga0157374_10000989 3300013296 Bacteria 24633
345 Ga0157374_10001078 3300013296 Bacteria 23634
346 Ga0157374_10003563 3300013296 Bacteria 13110
347 Ga0157374_10069754 3300013296 Bacteria 3310
348 Ga0157374_10093357 3300013296 Unclassified 2873
349 Ga0157374_10292023 3300013296 Unclassified 1611
350 Ga0157378_10000057 3300013297 Bacteria 96589
351 Ga0157378_10000058 3300013297 Bacteria 96172
352 Ga0157378_10000304 3300013297 Bacteria 47798
353 Ga0157378_10001335 3300013297 Bacteria 22158
354 Ga0157378_10014035 3300013297 Bacteria 7013
355 Ga0157378_10017752 3300013297 Bacteria 6247
356 Ga0157378_10077210 3300013297 Unclassified 3002
357 Ga0157378_10314628 3300013297 Bacteria 1519
358 Ga0163162_10013577 3300013306 Bacteria 7957
359 Ga0163162_10108566 3300013306 Bacteria 2871
360 Ga0163162_10117086 3300013306 Bacteria 2766
361 Ga0163162_10134902 3300013306 Bacteria 2579
362 Ga0163162_10477484 3300013306 Bacteria 1378
363 Ga0157372_10000200 3300013307 Bacteria 66086
364 Ga0157372_10000379 3300013307 Bacteria 49273
365 Ga0157372_10000714 3300013307 Bacteria 36499
366 Ga0157372_10003854 3300013307 Bacteria 16121
367 Ga0157372_10008585 3300013307 Bacteria 10857
368 Ga0157372_10018945 3300013307 Bacteria 7406
369 Ga0157372_10070788 3300013307 Unclassified 3925
370 Ga0157372_10114379 3300013307 Bacteria 3093
371 Ga0157372_10202191 3300013307 Unclassified 2301
372 Ga0157375_10335189 3300013308 Bacteria 1678
373 Ga0163163_10011964 3300014325 Bacteria 7895
374 Ga0163163_10028994 3300014325 Bacteria 5322
375 Ga0163163_10047416 3300014325 Bacteria 4224
376 Ga0163163_10052362 3300014325 Bacteria 4027
377 Ga0163163_10082546 3300014325 Unclassified 3218
378 Ga0163163_10231656 3300014325 Bacteria 1896
379 Ga0163163_10466176 3300014325 Bacteria 1324
380 Ga0157377_10122308 3300014745 Bacteria 1579
381 Ga0157379_10002438 3300014968 Bacteria 15569
382 Ga0157379_10041098 3300014968 Unclassified 4127
383 Ga0157379_10329788 3300014968 Bacteria 1394
384 Ga0157376_10003037 3300014969 Bacteria 11495
385 Ga0157376_10018903 3300014969 Bacteria 5298
386 Ga0157376_10120856 3300014969 Unclassified 2321
387 Ga0157376_10150773 3300014969 Unclassified 2096
388 Ga0157376_10150939 3300014969 Unclassified 2095
389 Ga0157376_10842264 3300014969 Unclassified 932
390 Ga0157376_10851861 3300014969 Unclassified 927
391 Ga0163161_10003804 3300017792 Bacteria 10582
392 Ga0213873_10020184 3300021358 Unclassified 1554
393 Ga0213874_10005028 3300021377 Bacteria 3060
394 Ga0213874_10074028 3300021377 Bacteria 1092
395 Ga0224572_1003559 3300024225 Unclassified 2640
396 Ga0228598_1003592 3300024227 Unclassified 3330
397 Ga0207697_10024904 3300025315 Unclassified 2447
398 Ga0207656_10072464 3300025321 Bacteria 1534
399 Ga0207656_10084586 3300025321 Unclassified 1431
400 Ga0207656_10202119 3300025321 Unclassified 960
401 Ga0207682_10063867 3300025893 Unclassified 1546
402 Ga0207692_10029019 3300025898 Unclassified 2624
403 Ga0207692_10049371 3300025898 Bacteria 2123
404 Ga0207692_10150872 3300025898 Bacteria 1331
405 Ga0207642_10049092 3300025899 Bacteria 1895
406 Ga0207642_10167243 3300025899 Bacteria 1186
407 Ga0207688_10093312 3300025901 Unclassified 1731
408 Ga0207680_10067798 3300025903 Unclassified 2199
409 Ga0207647_10005883 3300025904 Bacteria 8937
410 Ga0207647_10024407 3300025904 Bacteria 3986
411 Ga0207699_10008930 3300025906 Unclassified 4969
412 Ga0207699_10021420 3300025906 Bacteria 3484
413 Ga0207699_10036191 3300025906 Unclassified 2812
414 Ga0207699_10238930 3300025906 Bacteria 1247
415 Ga0207699_10338704 3300025906 Bacteria 1059
416 Ga0207699_10358348 3300025906 Bacteria 1031
417 Ga0207699_10448100 3300025906 Bacteria 925
418 Ga0207645_10000551 3300025907 Bacteria 31119
419 Ga0207645_10004243 3300025907 Bacteria 10640
420 Ga0207643_10002140 3300025908 Bacteria 10851
421 Ga0207684_10016288 3300025910 Bacteria 6383
422 Ga0207684_10033830 3300025910 Unclassified 4347
423 Ga0207684_10064619 3300025910 Unclassified 3107
424 Ga0207684_10077797 3300025910 Bacteria 2821
425 Ga0207684_10279783 3300025910 Bacteria 1439
426 Ga0207684_10487378 3300025910 Unclassified 1057
427 Ga0207654_10048036 3300025911 Bacteria 2441
428 Ga0207707_10000617 3300025912 Bacteria 35411
429 Ga0207707_10002456 3300025912 Bacteria 16676
430 Ga0207707_10129771 3300025912 Bacteria 2205
431 Ga0207695_10005582 3300025913 Bacteria 16616
432 Ga0207695_10016407 3300025913 Bacteria 8665
433 Ga0207695_10024396 3300025913 Bacteria 6808
434 Ga0207695_10053870 3300025913 Bacteria 4205
435 Ga0207695_10058048 3300025913 Bacteria 4018
436 Ga0207695_10176066 3300025913 Unclassified 2062
437 Ga0207695_10252313 3300025913 Bacteria 1663
438 Ga0207695_10312606 3300025913 Bacteria 1461
439 Ga0207695_10440108 3300025913 Bacteria 1187
440 Ga0207695_10577129 3300025913 Unclassified 1006
441 Ga0207671_10009068 3300025914 Bacteria 8362
442 Ga0207671_10131643 3300025914 Bacteria 1920
443 Ga0207671_10258684 3300025914 Bacteria 1369
444 Ga0207693_10009791 3300025915 Bacteria 7801
445 Ga0207693_10010388 3300025915 Bacteria 7558
446 Ga0207693_10026726 3300025915 Bacteria 4566
447 Ga0207693_10053913 3300025915 Unclassified 3155
448 Ga0207663_10070270 3300025916 Bacteria 2255
449 Ga0207663_10122908 3300025916 Bacteria 1781
450 Ga0207663_10177613 3300025916 Bacteria 1518
451 Ga0207663_10217699 3300025916 Bacteria 1388
452 Ga0207663_10286619 3300025916 Bacteria 1225
453 Ga0207660_10234598 3300025917 Bacteria 1443
454 Ga0207662_10004460 3300025918 Bacteria 7368
455 Ga0207662_10314459 3300025918 Bacteria 1044
456 Ga0207657_10002740 3300025919 Bacteria 18981
457 Ga0207657_10003665 3300025919 Bacteria 16357
458 Ga0207657_10009009 3300025919 Bacteria 10078
459 Ga0207649_10001493 3300025920 Bacteria 13728
460 Ga0207649_10035538 3300025920 Bacteria 2995
461 Ga0207649_10127147 3300025920 Bacteria 1726
462 Ga0207652_10031964 3300025921 Unclassified 4421
463 Ga0207652_10049802 3300025921 Bacteria 3587
464 Ga0207646_10217352 3300025922 Bacteria 1726
465 Ga0207681_10184901 3300025923 Unclassified 1590
466 Ga0207694_10000743 3300025924 Bacteria 29301
467 Ga0207694_10020189 3300025924 Bacteria 5039
468 Ga0207694_10068819 3300025924 Unclassified 2765
469 Ga0207650_10000045 3300025925 Bacteria 181507
470 Ga0207650_10042503 3300025925 Bacteria 3334
471 Ga0207650_10257958 3300025925 Bacteria 1413
472 Ga0207687_10047387 3300025927 Unclassified 2980
473 Ga0207687_10114864 3300025927 Bacteria 2005
474 Ga0207700_10026354 3300025928 Unclassified 4051
475 Ga0207700_10034264 3300025928 Unclassified 3644
476 Ga0207700_10146715 3300025928 Unclassified 1945
477 Ga0207700_10147114 3300025928 Bacteria 1943
478 Ga0207700_10202860 3300025928 Bacteria 1672
479 Ga0207700_10203610 3300025928 Bacteria 1669
480 Ga0207700_10217446 3300025928 Unclassified 1618
481 Ga0207700_10339306 3300025928 Bacteria 1306
482 Ga0207700_10645546 3300025928 Bacteria 943
483 Ga0207664_10011058 3300025929 Bacteria 6395
484 Ga0207664_10048706 3300025929 Unclassified 3334
485 Ga0207664_10124402 3300025929 Bacteria 2163
486 Ga0207664_10653603 3300025929 Bacteria 945
487 Ga0207664_10746112 3300025929 Unclassified 880
488 Ga0207644_10234750 3300025931 Bacteria 1458
489 Ga0207644_10328554 3300025931 Bacteria 1238
490 Ga0207706_10003060 3300025933 Bacteria 16104
491 Ga0207706_10037894 3300025933 Bacteria 4278
492 Ga0207686_10131534 3300025934 Unclassified 1717
493 Ga0207686_10147256 3300025934 Bacteria 1635
494 Ga0207709_10050443 3300025935 Unclassified 2545
495 Ga0207670_10186756 3300025936 Unclassified 1565
496 Ga0207670_10308095 3300025936 Bacteria 1242
497 Ga0207704_10013405 3300025938 Bacteria 4099
498 Ga0207665_10001295 3300025939 Bacteria 16905
499 Ga0207665_10004259 3300025939 Bacteria 9510
500 Ga0207665_10017745 3300025939 Bacteria 4677
501 Ga0207665_10060541 3300025939 Bacteria 2564
502 Ga0207665_10066960 3300025939 Bacteria 2445
503 Ga0207665_10067636 3300025939 Unclassified 2433
504 Ga0207665_10203739 3300025939 Bacteria 1443
505 Ga0207665_10272350 3300025939 Bacteria 1258
506 Ga0207665_10287210 3300025939 Unclassified 1226
507 Ga0207691_10004307 3300025940 Bacteria 13821
508 Ga0207691_10483887 3300025940 Bacteria 1052
509 Ga0207711_10021084 3300025941 Bacteria 5442
510 Ga0207711_10035712 3300025941 Bacteria 4215
511 Ga0207711_10057050 3300025941 Bacteria 3357
512 Ga0207711_10118544 3300025941 Unclassified 2361
513 Ga0207711_10204551 3300025941 Bacteria 1802
514 Ga0207689_10004596 3300025942 Bacteria 12489
515 Ga0207689_10009031 3300025942 Bacteria 8631
516 Ga0207689_10018148 3300025942 Bacteria 5941
517 Ga0207661_10000131 3300025944 Bacteria 47673
518 Ga0207661_10125130 3300025944 Unclassified 2194
519 Ga0207679_10000283 3300025945 Bacteria 38405
520 Ga0207679_10073991 3300025945 Unclassified 2580
521 Ga0207679_10234442 3300025945 Bacteria 1551
522 Ga0207679_10251611 3300025945 Unclassified 1502
523 Ga0207667_10001753 3300025949 Bacteria 27293
524 Ga0207667_10022333 3300025949 Bacteria 6991
525 Ga0207667_10047229 3300025949 Unclassified 4557
526 Ga0207667_10056561 3300025949 Bacteria 4121
527 Ga0207667_10095084 3300025949 Bacteria 3076
528 Ga0207667_10129991 3300025949 Bacteria 2594
529 Ga0207667_10305979 3300025949 Bacteria 1624
530 Ga0207667_10846263 3300025949 Bacteria 909
531 Ga0207651_10029577 3300025960 Bacteria 3473
532 Ga0207651_10039352 3300025960 Unclassified 3117
533 Ga0207651_10414784 3300025960 Bacteria 1148
534 Ga0207712_10011555 3300025961 Bacteria 5628
535 Ga0207668_10017040 3300025972 Unclassified 4546
536 Ga0207640_10010779 3300025981 Bacteria 5158
537 Ga0207640_10031062 3300025981 Bacteria 3297
538 Ga0207640_10042734 3300025981 Bacteria 2892
539 Ga0207640_10059925 3300025981 Bacteria 2514
540 Ga0207640_10156562 3300025981 Unclassified 1680
541 Ga0207640_10302945 3300025981 Bacteria 1265
542 Ga0207658_10003108 3300025986 Bacteria 11881
543 Ga0207677_10002125 3300026023 Bacteria 10402
544 Ga0207677_10163209 3300026023 Bacteria 1733
545 Ga0207677_10253370 3300026023 Bacteria 1431
546 Ga0207703_10003528 3300026035 Bacteria 13086
547 Ga0207703_10008464 3300026035 Bacteria 8128
548 Ga0207703_10011057 3300026035 Bacteria 7033
549 Ga0207703_10039474 3300026035 Unclassified 3773
550 Ga0207639_10005137 3300026041 Bacteria 8821
551 Ga0207639_10089777 3300026041 Bacteria 2456
552 Ga0207639_10131743 3300026041 Bacteria 2071
553 Ga0207639_10286015 3300026041 Bacteria 1452
554 Ga0207678_10000026 3300026067 Bacteria 116850
555 Ga0207678_10001488 3300026067 Bacteria 21502
556 Ga0207702_10001299 3300026078 Bacteria 25024
557 Ga0207702_10001432 3300026078 Bacteria 23781
558 Ga0207702_10005337 3300026078 Bacteria 11266
559 Ga0207702_10056905 3300026078 Bacteria 3321
560 Ga0207702_10076023 3300026078 Bacteria 2902
561 Ga0207702_10145132 3300026078 Bacteria 2152
562 Ga0207641_10000021 3300026088 Bacteria 279851
563 Ga0207641_10010380 3300026088 Bacteria 7657
564 Ga0207641_10070055 3300026088 Bacteria 3013
565 Ga0207641_10102549 3300026088 Bacteria 2523
566 Ga0207641_10112651 3300026088 Bacteria 2414
567 Ga0207641_10626665 3300026088 Unclassified 1055
568 Ga0207648_10000611 3300026089 Bacteria 40065
569 Ga0207648_10006630 3300026089 Bacteria 11501
570 Ga0207648_10030195 3300026089 Unclassified 4802
571 Ga0207648_10070587 3300026089 Bacteria 3045
572 Ga0207648_10111193 3300026089 Bacteria 2405
573 Ga0207676_10000096 3300026095 Bacteria 80353
574 Ga0207676_10091337 3300026095 Bacteria 2501
575 Ga0207676_10541104 3300026095 Bacteria 1111
576 Ga0207674_10000246 3300026116 Bacteria 67486
577 Ga0207674_10006208 3300026116 Bacteria 14082
578 Ga0207674_10009607 3300026116 Bacteria 11035
579 Ga0207674_10022219 3300026116 Bacteria 6818
580 Ga0207674_10052593 3300026116 Unclassified 4154
581 Ga0207675_100048302 3300026118 Bacteria 3973
582 Ga0207675_100099837 3300026118 Bacteria 2734
583 Ga0207683_10000259 3300026121 Bacteria 47186
584 Ga0207683_10113947 3300026121 Bacteria 2422
585 Ga0207698_10029830 3300026142 Unclassified 3913
586 Ga0265356_1012459 3300028017 Bacteria 934
587 Ga0268266_10006040 3300028379 Bacteria 11164
588 Ga0268266_10016584 3300028379 Bacteria 6295
589 Ga0268266_10433877 3300028379 Bacteria 1247
590 Ga0268265_10005648 3300028380 Bacteria 8545
591 Ga0268265_10082287 3300028380 Unclassified 2545
592 Ga0268264_10004345 3300028381 Bacteria 12099
593 Ga0268264_10044109 3300028381 Unclassified 3698
594 Ga0268264_10140172 3300028381 Bacteria 2155
595 Ga0265338_10001717 3300028800 Bacteria 34748
596 Ga0265338_10119471 3300028800 Bacteria 2104
597 Ga0265773_1005274 3300031018 Bacteria 934
598 Ga0265760_10000564 3300031090 Bacteria 10531
599 Ga0265760_10002887 3300031090 Bacteria 5024
600 Ga0265760_10003748 3300031090 Bacteria 4403
601 Ga0265760_10004692 3300031090 Unclassified 3913
602 Ga0265760_10043850 3300031090 Bacteria 1337
603 Ga0265330_10009079 3300031235 Bacteria 4741
604 Ga0265340_10037738 3300031247 Bacteria 2392
605 Ga0265339_10001780 3300031249 Bacteria 15833
606 Ga0265339_10079860 3300031249 Bacteria 1730
607 Ga0265331_10061776 3300031250 Bacteria 1768
608 Ga0265316_10006906 3300031344 Bacteria 10767
609 Ga0265316_10012757 3300031344 Bacteria 7510
610 Ga0307408_100242572 3300031548 Bacteria 1482
611 Ga0265314_10004769 3300031711 Bacteria 12427
612 Ga0307405_10018003 3300031731 Bacteria 3889
613 Ga0307410_10026642 3300031852 Bacteria 3643
614 Ga0307410_10156905 3300031852 Bacteria 1701
615 Ga0307409_100313410 3300031995 Bacteria 1465
616 Ga0307416_100183907 3300032002 Bacteria 1962
617 Ga0307411_10314839 3300032005 Bacteria 1261
618 Ga0307415_100016974 3300032126 Bacteria 4355
619 Ga0373944_0015522 3300035089 Unclassified 2139
620 Ga0373936_0029250 3300035113 Bacteria 2168
621 Ga0373954_0083902 3300035118 Bacteria 1525
622 Ga0373931_0025139 3300035691 Unclassified 3024
623 Ga0373931_0103142 3300035691 Bacteria 1607
624 Ga0373935_0157587 3300035692 Bacteria 1545
625 Ga0373935_0392149 3300035692 Unclassified 996
626 Ga0373927_0012227 3300035695 Bacteria 5710
627 Ga0373933_0104999 3300035724 Unclassified 1757
628 Ga0373947_0271652 3300035725 Bacteria 1125
629 Ga0373947_0556858 3300035725 Bacteria 781
630 Ga0373937_0018912 3300036401 Bacteria 6159
631 Ga0373925_0004417 3300037068 Bacteria 10624
632 Ga0373925_0017930 3300037068 Bacteria 5139
633 Ga0395900_0392383 3300037418 Bacteria 1354
634 Ga0395905_0005720 3300037471 Bacteria 12640
635 Ga0395905_0009325 3300037471 Bacteria 9600
636 Ga0395905_0015774 3300037471 Bacteria 7177
637 Ga0395905_0339925 3300037471 Bacteria 1392
638 Ga0436365_0117660 3300039437 Bacteria 2357
639 Ga0436365_0913571 3300039437 Bacteria 1395
640 Ga0436365_1528334 3300039437 Bacteria 2533
641 Ga0436363_0108166 3300039450 Bacteria 1068
642 Ga0436363_0644861 3300039450 Bacteria 2894
643 Ga0436363_1342541 3300039450 Bacteria 2221
644 Ga0436363_1700190 3300039450 Bacteria 4540
645 Ga0436362_0155418 3300039453 Unclassified 2386
646 Ga0451577_0000157 3300042876 Bacteria 151953
647 Ga0451577_0041769 3300042876 Unclassified 4116
648 Ga0453683_0025944 3300044673 Bacteria 3721
649 Ga0453683_0369661 3300044673 Unclassified 922
650 Ga0466963_0014508 3300044694 Bacteria 4860
651 Ga0453684_0001152 3300044712 Bacteria 82543
652 Ga0451576_0108517 3300045051 Unclassified 2888
653 Ga0451576_0221217 3300045051 Bacteria 1977
654 Ga0451576_0283887 3300045051 Bacteria 1731
655 Ga0466967_0002974 3300045976 Bacteria 10843
656 Ga0466967_0824223 3300045976 Bacteria 922
657 Ga0495653_0272272 3300046463 Bacteria 1115
658 Ga0495580_0002108 3300046472 Bacteria 17453
659 Ga0495580_0002151 3300046472 Bacteria 17310
660 Ga0495580_0002538 3300046472 Bacteria 15898
661 Ga0495580_0004470 3300046472 Bacteria 11745
662 Ga0495580_0005568 3300046472 Bacteria 10385
663 Ga0495580_0009075 3300046472 Bacteria 7844
664 Ga0495580_0042668 3300046472 Bacteria 3230
665 Ga0495580_0096651 3300046472 Bacteria 2054
666 Ga0495580_0282665 3300046472 Bacteria 1132
667 Ga0495582_0000074 3300046473 Bacteria 50012
668 Ga0495594_0159038 3300046499 Bacteria 1284
669 Ga0495608_0206802 3300046511 Bacteria 1235
670 Ga0495628_0404339 3300046516 Bacteria 997
671 Ga0495665_0000640 3300046531 Bacteria 17853
672 Ga0495665_0018105 3300046531 Unclassified 3787
673 Ga0495645_0291642 3300046543 Bacteria 1069
674 Ga0495667_0123160 3300046559 Bacteria 1674
675 Ga0495656_0012753 3300046615 Bacteria 3110
676 Ga0495657_0093540 3300046675 Bacteria 1924
677 Ga0495657_0239335 3300046675 Unclassified 1096
678 Ga0495623_0064777 3300046679 Bacteria 2287
679 Ga0495669_0013822 3300046684 Unclassified 3446
680 Ga0495669_0027789 3300046684 Bacteria 2475
681 Ga0495581_0026361 3300047315 Bacteria 3370
682 Ga0495581_0122147 3300047315 Bacteria 1516
683 Ga0495674_0487601 3300047319 Bacteria 987
684 Ga0495675_0032498 3300047444 Bacteria 3330
685 Ga0495675_0052458 3300047444 Bacteria 2589
686 Ga0495677_0166123 3300047445 Bacteria 853
687 Ga0495684_0153451 3300047471 Bacteria 1721
688 Ga0496100_0106014 3300048903 Unclassified 1945
689 Ga0496101_0127407 3300048904 Unclassified 1930
690 Ga0496102_0008569 3300048905 Bacteria 8769
691 Ga0496102_0013555 3300048905 Bacteria 7065
692 Ga0496102_0111535 3300048905 Bacteria 2550
693 Ga0496102_0327715 3300048905 Bacteria 1442
694 Ga0496103_0022061 3300048906 Unclassified 3832
695 Ga0496104_0206179 3300048907 Unclassified 1878
696 Ga0496104_0599097 3300048907 Unclassified 1012
697 Ga0496105_0575347 3300048908 Unclassified 877
698 Ga0496106_0077026 3300048909 Bacteria 2557
699 Ga0496106_0110030 3300048909 Bacteria 2144
700 Ga0496107_0070997 3300048910 Unclassified 2530
701 Ga0496108_0000605 3300048911 Bacteria 28095
702 Ga0496108_0101207 3300048911 Bacteria 2458
703 Ga0496109_0000132 3300048912 Bacteria 76436
704 Ga0496109_0011172 3300048912 Bacteria 7705
705 Ga0496109_0075326 3300048912 Unclassified 3103
706 Ga0496109_0148872 3300048912 Bacteria 2191
707 Ga0496110_0001437 3300048913 Bacteria 17222
708 Ga0496110_0053666 3300048913 Bacteria 3544
709 Ga0496111_0017498 3300048914 Bacteria 4956
710 Ga0496111_0367603 3300048914 Unclassified 1064
711 Ga0496112_0000399 3300048915 Bacteria 28374
712 Ga0496112_0000464 3300048915 Bacteria 27058
713 Ga0496112_0046418 3300048915 Bacteria 4260
714 Ga0496112_0073440 3300048915 Bacteria 3381
715 Ga0496112_0102212 3300048915 Bacteria 2836
716 Ga0496112_0148660 3300048915 Bacteria 2310
717 Ga0496112_0422625 3300048915 Unclassified 1271
718 Ga0496112_0645398 3300048915 Unclassified 988
719 Ga0501294_007687 3300049517 Bacteria 1044
720 Ga0501296_010667 3300049519 Bacteria 1092
721 Ga0501298_020448 3300049521 Bacteria 1233
722 Ga0501272_004372 3300049769 Bacteria 1467
723 nmdc:mga0n895_128602_c1 3300050512 Unclassified 2557
724 nmdc:mga0n895_1448_c1 3300050512 Bacteria 17728
725 nmdc:mga0n895_31071_c1 3300050512 Bacteria 5110
726 nmdc:mga0n895_31483_c1 3300050512 Bacteria 5080
727 nmdc:mga0n895_345_c1 3300050512 Bacteria 31108
728 nmdc:mga0n895_46359_c2 3300050512 Bacteria 3705
729 nmdc:mga0rr50_143165_c1 3300050513 Unclassified 1925
730 nmdc:mga0rr50_1877_c1 3300050513 Bacteria 11667
731 nmdc:mga0rr50_31563_c1 3300050513 Bacteria 3764
732 nmdc:mga08x19_18672_c1 3300050514 Unclassified 4249
733 nmdc:mga08x19_2129_c2 3300050514 Bacteria 5083
734 nmdc:mga08x19_43978_c1 3300050514 Bacteria 2850
735 nmdc:mga08x19_6332_c1 3300050514 Bacteria 7009
736 nmdc:mga0a205_107_c2 3300050515 Bacteria 46625
737 nmdc:mga0a205_7634_c1 3300050515 Bacteria 9808
738 Ga0501084_0254946 3300054114 Unclassified 1481
739 Ga0207679_10455080
740 MRS1b_contig_9212784
741 JGI24737J22298_10050251
742 JGI24743J22301_10031702
743 Ga0065712_10117106
744 Ga0065712_10117566
745 Ga0065712_10246933
746 Ga0065712_10272610
747 Ga0065715_10145026
748 Ga0065715_10407363
749 Ga0070658_10552986
750 Ga0070676_10170230
751 Ga0070683_100000996
752 Ga0070683_100073142
753 Ga0070683_100100788
754 Ga0070683_100200734
755 Ga0070690_100130224
756 Ga0070690_100178498
757 Ga0070670_100010214
758 Ga0070670_100022664
759 Ga0070670_100186273
760 Ga0070670_100217955
761 Ga0070677_10022501
762 Ga0068869_100006311
763 Ga0068869_100401888
764 Ga0070666_10034392
765 Ga0070680_100023130
766 Ga0070680_100076357
767 Ga0070682_100002535
768 Ga0068868_100003985
769 Ga0068868_100006259
770 Ga0068868_100282120
771 Ga0070660_100006382
772 Ga0070660_100032389
773 Ga0070660_100043786
774 Ga0070660_100421576
775 Ga0070689_100000844
776 Ga0070689_100028593
777 Ga0070689_100320977
778 Ga0070687_100002055
779 Ga0070687_100331765
780 Ga0070661_100019010
781 Ga0070661_100034867
782 Ga0070668_100008093
783 Ga0070668_100078168
784 Ga0070669_100177950
785 Ga0070675_100002781
786 Ga0070675_100342055
787 Ga0070671_100122780
788 Ga0070674_100022355
789 Ga0070673_100016252
790 Ga0070673_100457923
791 Ga0070688_100014009
792 Ga0070659_100015849
793 Ga0070667_100012738
794 Ga0070709_10008666
795 Ga0070709_10119965
796 Ga0070709_10204510
797 Ga0070709_10334746
798 Ga0070709_10357201
799 Ga0070714_100062248
800 Ga0070714_100081406
801 Ga0070714_100114506
802 Ga0070714_100145420
803 Ga0070714_100230099
804 Ga0070714_100369035
805 Ga0070713_100027201
806 Ga0070713_100062242
807 Ga0070713_100076581
808 Ga0070713_100127102
809 Ga0070713_100128753
810 Ga0070713_100173917
811 Ga0070710_10022575
812 Ga0070710_10024862
813 Ga0070710_10159208
814 Ga0070711_100017703
815 Ga0070711_100033693
816 Ga0070711_100039331
817 Ga0070711_100052965
818 Ga0070711_100057485
819 Ga0070711_100075664
820 Ga0070711_100292029
821 Ga0070705_100150946
822 Ga0070694_100075969
823 Ga0070708_100003146
824 Ga0070708_100003966
825 Ga0070708_100023212
826 Ga0070708_100037006
827 Ga0070708_100081114
828 Ga0070708_100089157
829 Ga0070708_100158945
830 Ga0070708_100189306
831 Ga0070708_100660189
832 Ga0070708_100790906
833 Ga0070663_100016064
834 Ga0070663_100020172
835 Ga0070678_100003297
836 Ga0070678_100022663
837 Ga0070662_100002565
838 Ga0070662_100068638
839 Ga0070662_100100888
840 Ga0070681_10000988
841 Ga0070681_10011272
842 Ga0070681_10012120
843 Ga0070681_10206078
844 Ga0070681_10224946
845 Ga0070681_10283619
846 Ga0068867_100016423
847 Ga0068867_100201820
848 Ga0068867_100232568
849 Ga0070685_10001933
850 Ga0070685_10093357
851 Ga0070706_100000499
852 Ga0070706_100017064
853 Ga0070706_100022122
854 Ga0070706_100109918
855 Ga0070706_100116070
856 Ga0070707_100037132
857 Ga0070707_100184084
858 Ga0070707_100209000
859 Ga0070707_100251525
860 Ga0070698_100013058
861 Ga0070698_100223136
862 Ga0070699_100001027
863 Ga0070699_100007250
864 Ga0070699_100096021
865 Ga0070699_100183731
866 Ga0070699_100387798
867 Ga0070699_100489442
868 Ga0070679_100014737
869 Ga0070679_100172263
870 Ga0070679_100464459
871 Ga0070684_100001677
872 Ga0070684_100014670
873 Ga0070684_100015349
874 Ga0070684_100037540
875 Ga0070684_100106170
876 Ga0070697_100000111
877 Ga0070697_100000237
878 Ga0070697_100001234
879 Ga0070697_100022916
880 Ga0070697_100025982
881 Ga0070697_100279249
882 Ga0068853_100005375
883 Ga0068853_100014856
884 Ga0068853_100018379
885 Ga0068853_100157381
886 Ga0070672_100128080
887 Ga0070695_100015812
888 Ga0070696_100141341
889 Ga0070693_100008310
890 Ga0070693_100113701
891 Ga0070665_100008351
892 Ga0070665_100124026
893 Ga0070665_100815155
894 Ga0068855_100000440
895 Ga0068855_100001467
896 Ga0068855_100033223
897 Ga0068855_100058930
898 Ga0068855_100119682
899 Ga0068855_100133493
900 Ga0070664_100000079
901 Ga0070664_100020262
902 Ga0070664_100054375
903 Ga0070664_100090314
904 Ga0068857_100004770
905 Ga0068857_100040124
906 Ga0068857_100107688
907 Ga0068854_100014008
908 Ga0068854_100022674
909 Ga0068854_100037953
910 Ga0068854_100047532
911 Ga0068854_100335242
912 Ga0068856_100000314
913 Ga0068856_100000884
914 Ga0068856_100001689
915 Ga0068856_100013950
916 Ga0068856_100013970
917 Ga0068856_100045755
918 Ga0068856_100195303
919 Ga0068856_100202881
920 Ga0068856_100282874
921 Ga0070702_100131113
922 Ga0068852_100005106
923 Ga0068852_100008868
924 Ga0068852_100073044
925 Ga0068852_100237967
926 Ga0068859_100000743
927 Ga0068859_100029696
928 Ga0068859_100107366
929 Ga0068859_100617244
930 Ga0068866_10000598
931 Ga0068866_10105674
932 Ga0068866_10109412
933 Ga0068861_100004952
934 Ga0068861_100058819
935 Ga0068861_100068073
936 Ga0068861_100086440
937 Ga0068851_10029758
938 Ga0068870_10001859
939 Ga0068870_10034485
940 Ga0068863_100007633
941 Ga0068863_100027936
942 Ga0068863_100033173
943 Ga0068863_100076640
944 Ga0068863_100119501
945 Ga0068863_100169603
946 Ga0068863_100278670
947 Ga0068858_100008051
948 Ga0068858_100010361
949 Ga0068858_100037929
950 Ga0068858_100400035
951 Ga0068860_100011415
952 Ga0068860_100017651
953 Ga0068860_100072721
954 Ga0068860_100132368
955 Ga0068862_100039922
956 Ga0068862_100040805
957 Ga0068862_100048021
958 Ga0070717_10001917
959 Ga0070717_10003179
960 Ga0070717_10005046
961 Ga0070717_10009320
962 Ga0070717_10014384
963 Ga0070717_10037304
964 Ga0070717_10198906
965 Ga0070717_10223765
966 Ga0070717_10278980
967 Ga0070717_10290734
968 Ga0070717_10326139
969 Ga0070717_10506851
970 Ga0070716_100000963
971 Ga0070716_100009156
972 Ga0070716_100017261
973 Ga0070716_100037014
974 Ga0070716_100037319
975 Ga0070716_100059096
976 Ga0070712_100001489
977 Ga0070712_100004426
978 Ga0070712_100028835
979 Ga0070712_100319851
980 Ga0070712_100394155
981 Ga0097621_100000088
982 Ga0097621_100000731
983 Ga0097621_100001934
984 Ga0097621_100009212
985 Ga0097621_100032470
986 Ga0097621_100083976
987 Ga0097621_100576711
988 Ga0097621_100666514
989 Ga0068871_100000266
990 Ga0068871_100000428
991 Ga0068871_100008870
992 Ga0068871_100017378
993 Ga0068871_100026158
994 Ga0068871_100076855
995 Ga0068871_100535561
996 Ga0068871_100537222
997 Ga0075433_10000048
998 Ga0075433_10003910
999 Ga0075434_100007179
1000 Ga0075434_100034614
1001 Ga0075434_100065078
1002 Ga0075434_100138002
1003 Ga0075434_100175929
1004 Ga0075434_100273872
1005 Ga0068865_100007069
1006 Ga0068865_100046813
1007 Ga0068865_100085305
1008 Ga0075436_100003918
1009 Ga0075436_100006016
1010 Ga0075436_100024846
1011 Ga0075436_100032947
1012 Ga0097620_100000743
1013 Ga0097620_100029691
1014 Ga0097620_100107371
1015 Ga0097620_100617320
1016 Ga0075435_100002276
1017 Ga0075435_100028468
1018 Ga0075435_100030477
1019 Ga0075435_100108003
1020 Ga0075435_100159998
1021 Ga0105250_10059427
1022 Ga0105240_10005076
1023 Ga0105240_10009676
1024 Ga0105240_10046006
1025 Ga0105240_10130352
1026 Ga0105240_10354797
1027 Ga0105245_10021687
1028 Ga0105245_10043511
1029 Ga0105245_10134582
1030 Ga0105245_10188012
1031 Ga0105245_10318767
1032 Ga0105247_10117309
1033 Ga0105247_10170366
1034 Ga0114129_10263397
1035 Ga0105243_10065709
1036 Ga0105241_10021553
1037 Ga0105241_10028616
1038 Ga0105241_10068900
1039 Ga0105241_10805168
1040 Ga0105242_10066838
1041 Ga0105248_10002754
1042 Ga0105248_10024617
1043 Ga0105248_10054467
1044 Ga0105248_10057988
1045 Ga0105248_10061141
1046 Ga0105248_10097481
1047 Ga0105237_10010940
1048 Ga0105237_10037740
1049 Ga0105237_10090403
1050 Ga0105237_10127258
1051 Ga0105237_10129749
1052 Ga0105237_10274245
1053 Ga0105238_10001256
1054 Ga0105238_10011948
1055 Ga0105238_10076516
1056 Ga0105238_10195438
1057 Ga0105249_10010877
1058 Ga0105249_10110523
1059 Ga0105239_10020769
1060 Ga0105239_10027319
1061 Ga0105239_10066265
1062 Ga0105239_10131950
1063 Ga0105239_10133705
1064 Ga0105239_10170577
1065 Ga0105246_10130306
1066 Ga0157373_10009346
1067 Ga0157373_10181386
1068 Ga0157371_10011620
1069 Ga0157371_10042533
1070 Ga0157371_10068655
1071 Ga0157369_10000196
1072 Ga0157369_10001722
1073 Ga0157369_10010846
1074 Ga0157369_10014078
1075 Ga0157369_10021606
1076 Ga0157369_10047180
1077 Ga0157369_10124427
1078 Ga0157369_10252144
1079 Ga0157369_10406164
1080 Ga0157369_10428591
1081 Ga0157374_10000312
1082 Ga0157374_10000989
1083 Ga0157374_10001078
1084 Ga0157374_10003563
1085 Ga0157374_10069754
1086 Ga0157374_10093357
1087 Ga0157374_10292023
1088 Ga0157378_10000057
1089 Ga0157378_10000058
1090 Ga0157378_10000304
1091 Ga0157378_10001335
1092 Ga0157378_10014035
1093 Ga0157378_10017752
1094 Ga0157378_10077210
1095 Ga0157378_10314628
1096 Ga0163162_10013577
1097 Ga0163162_10108566
1098 Ga0163162_10117086
1099 Ga0163162_10134902
1100 Ga0163162_10477484
1101 Ga0157372_10000200
1102 Ga0157372_10000379
1103 Ga0157372_10000714
1104 Ga0157372_10003854
1105 Ga0157372_10008585
1106 Ga0157372_10018945
1107 Ga0157372_10070788
1108 Ga0157372_10114379
1109 Ga0157372_10202191
1110 Ga0157375_10335189
1111 Ga0163163_10011964
1112 Ga0163163_10028994
1113 Ga0163163_10047416
1114 Ga0163163_10052362
1115 Ga0163163_10082546
1116 Ga0163163_10231656
1117 Ga0163163_10466176
1118 Ga0157377_10122308
1119 Ga0157379_10002438
1120 Ga0157379_10041098
1121 Ga0157379_10329788
1122 Ga0157376_10003037
1123 Ga0157376_10018903
1124 Ga0157376_10120856
1125 Ga0157376_10150773
1126 Ga0157376_10150939
1127 Ga0157376_10842264
1128 Ga0157376_10851861
1129 Ga0163161_10003804
1130 Ga0213873_10020184
1131 Ga0213874_10005028
1132 Ga0213874_10074028
1133 Ga0224572_1003559
1134 Ga0228598_1003592
1135 Ga0207697_10024904
1136 Ga0207656_10072464
1137 Ga0207656_10084586
1138 Ga0207656_10202119
1139 Ga0207682_10063867
1140 Ga0207692_10029019
1141 Ga0207692_10049371
1142 Ga0207692_10150872
1143 Ga0207642_10049092
1144 Ga0207642_10167243
1145 Ga0207688_10093312
1146 Ga0207680_10067798
1147 Ga0207647_10005883
1148 Ga0207647_10024407
1149 Ga0207699_10008930
1150 Ga0207699_10021420
1151 Ga0207699_10036191
1152 Ga0207699_10238930
1153 Ga0207699_10338704
1154 Ga0207699_10358348
1155 Ga0207699_10448100
1156 Ga0207645_10000551
1157 Ga0207645_10004243
1158 Ga0207643_10002140
1159 Ga0207684_10016288
1160 Ga0207684_10033830
1161 Ga0207684_10064619
1162 Ga0207684_10077797
1163 Ga0207684_10279783
1164 Ga0207684_10487378
1165 Ga0207654_10048036
1166 Ga0207707_10000617
1167 Ga0207707_10002456
1168 Ga0207707_10129771
1169 Ga0207695_10005582
1170 Ga0207695_10016407
1171 Ga0207695_10024396
1172 Ga0207695_10053870
1173 Ga0207695_10058048
1174 Ga0207695_10176066
1175 Ga0207695_10252313
1176 Ga0207695_10312606
1177 Ga0207695_10440108
1178 Ga0207695_10577129
1179 Ga0207671_10009068
1180 Ga0207671_10131643
1181 Ga0207671_10258684
1182 Ga0207693_10009791
1183 Ga0207693_10010388
1184 Ga0207693_10026726
1185 Ga0207693_10053913
1186 Ga0207663_10070270
1187 Ga0207663_10122908
1188 Ga0207663_10177613
1189 Ga0207663_10217699
1190 Ga0207663_10286619
1191 Ga0207660_10234598
1192 Ga0207662_10004460
1193 Ga0207662_10314459
1194 Ga0207657_10002740
1195 Ga0207657_10003665
1196 Ga0207657_10009009
1197 Ga0207649_10001493
1198 Ga0207649_10035538
1199 Ga0207649_10127147
1200 Ga0207652_10031964
1201 Ga0207652_10049802
1202 Ga0207646_10217352
1203 Ga0207681_10184901
1204 Ga0207694_10000743
1205 Ga0207694_10020189
1206 Ga0207694_10068819
1207 Ga0207650_10000045
1208 Ga0207650_10042503
1209 Ga0207650_10257958
1210 Ga0207687_10047387
1211 Ga0207687_10114864
1212 Ga0207700_10026354
1213 Ga0207700_10034264
1214 Ga0207700_10146715
1215 Ga0207700_10147114
1216 Ga0207700_10202860
1217 Ga0207700_10203610
1218 Ga0207700_10217446
1219 Ga0207700_10339306
1220 Ga0207700_10645546
1221 Ga0207664_10011058
1222 Ga0207664_10048706
1223 Ga0207664_10124402
1224 Ga0207664_10653603
1225 Ga0207664_10746112
1226 Ga0207644_10234750
1227 Ga0207644_10328554
1228 Ga0207706_10003060
1229 Ga0207706_10037894
1230 Ga0207686_10131534
1231 Ga0207686_10147256
1232 Ga0207709_10050443
1233 Ga0207670_10186756
1234 Ga0207670_10308095
1235 Ga0207704_10013405
1236 Ga0207665_10001295
1237 Ga0207665_10004259
1238 Ga0207665_10017745
1239 Ga0207665_10060541
1240 Ga0207665_10066960
1241 Ga0207665_10067636
1242 Ga0207665_10203739
1243 Ga0207665_10272350
1244 Ga0207665_10287210
1245 Ga0207691_10004307
1246 Ga0207691_10483887
1247 Ga0207711_10021084
1248 Ga0207711_10035712
1249 Ga0207711_10057050
1250 Ga0207711_10118544
1251 Ga0207711_10204551
1252 Ga0207689_10004596
1253 Ga0207689_10009031
1254 Ga0207689_10018148
1255 Ga0207661_10000131
1256 Ga0207661_10125130
1257 Ga0207679_10000283
1258 Ga0207679_10073991
1259 Ga0207679_10234442
1260 Ga0207679_10251611
1261 Ga0207667_10001753
1262 Ga0207667_10022333
1263 Ga0207667_10047229
1264 Ga0207667_10056561
1265 Ga0207667_10095084
1266 Ga0207667_10129991
1267 Ga0207667_10305979
1268 Ga0207667_10846263
1269 Ga0207651_10029577
1270 Ga0207651_10039352
1271 Ga0207651_10414784
1272 Ga0207712_10011555
1273 Ga0207668_10017040
1274 Ga0207640_10010779
1275 Ga0207640_10031062
1276 Ga0207640_10042734
1277 Ga0207640_10059925
1278 Ga0207640_10156562
1279 Ga0207640_10302945
1280 Ga0207658_10003108
1281 Ga0207677_10002125
1282 Ga0207677_10163209
1283 Ga0207677_10253370
1284 Ga0207703_10003528
1285 Ga0207703_10008464
1286 Ga0207703_10011057
1287 Ga0207703_10039474
1288 Ga0207639_10005137
1289 Ga0207639_10089777
1290 Ga0207639_10131743
1291 Ga0207639_10286015
1292 Ga0207678_10000026
1293 Ga0207678_10001488
1294 Ga0207702_10001299
1295 Ga0207702_10001432
1296 Ga0207702_10005337
1297 Ga0207702_10056905
1298 Ga0207702_10076023
1299 Ga0207702_10145132
1300 Ga0207641_10000021
1301 Ga0207641_10010380
1302 Ga0207641_10070055
1303 Ga0207641_10102549
1304 Ga0207641_10112651
1305 Ga0207641_10626665
1306 Ga0207648_10000611
1307 Ga0207648_10006630
1308 Ga0207648_10030195
1309 Ga0207648_10070587
1310 Ga0207648_10111193
1311 Ga0207676_10000096
1312 Ga0207676_10091337
1313 Ga0207676_10541104
1314 Ga0207674_10000246
1315 Ga0207674_10006208
1316 Ga0207674_10009607
1317 Ga0207674_10022219
1318 Ga0207674_10052593
1319 Ga0207675_100048302
1320 Ga0207675_100099837
1321 Ga0207683_10000259
1322 Ga0207683_10113947
1323 Ga0207698_10029830
1324 Ga0265356_1012459
1325 Ga0268266_10006040
1326 Ga0268266_10016584
1327 Ga0268266_10433877
1328 Ga0268265_10005648
1329 Ga0268265_10082287
1330 Ga0268264_10004345
1331 Ga0268264_10044109
1332 Ga0268264_10140172
1333 Ga0265338_10001717
1334 Ga0265338_10119471
1335 Ga0265773_1005274
1336 Ga0265760_10000564
1337 Ga0265760_10002887
1338 Ga0265760_10003748
1339 Ga0265760_10004692
1340 Ga0265760_10043850
1341 Ga0265330_10009079
1342 Ga0265340_10037738
1343 Ga0265339_10001780
1344 Ga0265339_10079860
1345 Ga0265331_10061776
1346 Ga0265316_10006906
1347 Ga0265316_10012757
1348 Ga0307408_100242572
1349 Ga0265314_10004769
1350 Ga0307405_10018003
1351 Ga0307410_10026642
1352 Ga0307410_10156905
1353 Ga0307409_100313410
1354 Ga0307416_100183907
1355 Ga0307411_10314839
1356 Ga0307415_100016974
1357 Ga0373944_0015522
1358 Ga0373936_0029250
1359 Ga0373954_0083902
1360 Ga0373931_0025139
1361 Ga0373931_0103142
1362 Ga0373935_0157587
1363 Ga0373935_0392149
1364 Ga0373927_0012227
1365 Ga0373933_0104999
1366 Ga0373947_0271652
1367 Ga0373947_0556858
1368 Ga0373937_0018912
1369 Ga0373925_0004417
1370 Ga0373925_0017930
1371 Ga0395900_0392383
1372 Ga0395905_0005720
1373 Ga0395905_0009325
1374 Ga0395905_0015774
1375 Ga0395905_0339925
1376 Ga0436365_0117660
1377 Ga0436365_0913571
1378 Ga0436365_1528334
1379 Ga0436363_0108166
1380 Ga0436363_0644861
1381 Ga0436363_1342541
1382 Ga0436363_1700190
1383 Ga0436362_0155418
1384 Ga0451577_0000157
1385 Ga0451577_0041769
1386 Ga0453683_0025944
1387 Ga0453683_0369661
1388 Ga0466963_0014508
1389 Ga0453684_0001152
1390 Ga0451576_0108517
1391 Ga0451576_0221217
1392 Ga0451576_0283887
1393 Ga0466967_0002974
1394 Ga0466967_0824223
1395 Ga0495653_0272272
1396 Ga0495580_0002108
1397 Ga0495580_0002151
1398 Ga0495580_0002538
1399 Ga0495580_0004470
1400 Ga0495580_0005568
1401 Ga0495580_0009075
1402 Ga0495580_0042668
1403 Ga0495580_0096651
1404 Ga0495580_0282665
1405 Ga0495582_0000074
1406 Ga0495594_0159038
1407 Ga0495608_0206802
1408 Ga0495628_0404339
1409 Ga0495665_0000640
1410 Ga0495665_0018105
1411 Ga0495645_0291642
1412 Ga0495667_0123160
1413 Ga0495656_0012753
1414 Ga0495657_0093540
1415 Ga0495657_0239335
1416 Ga0495623_0064777
1417 Ga0495669_0013822
1418 Ga0495669_0027789
1419 Ga0495581_0026361
1420 Ga0495581_0122147
1421 Ga0495674_0487601
1422 Ga0495675_0032498
1423 Ga0495675_0052458
1424 Ga0495677_0166123
1425 Ga0495684_0153451
1426 Ga0496100_0106014
1427 Ga0496101_0127407
1428 Ga0496102_0008569
1429 Ga0496102_0013555
1430 Ga0496102_0111535
1431 Ga0496102_0327715
1432 Ga0496103_0022061
1433 Ga0496104_0206179
1434 Ga0496104_0599097
1435 Ga0496105_0575347
1436 Ga0496106_0077026
1437 Ga0496106_0110030
1438 Ga0496107_0070997
1439 Ga0496108_0000605
1440 Ga0496108_0101207
1441 Ga0496109_0000132
1442 Ga0496109_0011172
1443 Ga0496109_0075326
1444 Ga0496109_0148872
1445 Ga0496110_0001437
1446 Ga0496110_0053666
1447 Ga0496111_0017498
1448 Ga0496111_0367603
1449 Ga0496112_0000399
1450 Ga0496112_0000464
1451 Ga0496112_0046418
1452 Ga0496112_0073440
1453 Ga0496112_0102212
1454 Ga0496112_0148660
1455 Ga0496112_0422625
1456 Ga0496112_0645398
1457 Ga0501294_007687
1458 Ga0501296_010667
1459 Ga0501298_020448
1460 Ga0501272_004372
1461 nmdc:mga0n895_128602_c1
1462 nmdc:mga0n895_1448_c1
1463 nmdc:mga0n895_31071_c1
1464 nmdc:mga0n895_31483_c1
1465 nmdc:mga0n895_345_c1
1466 nmdc:mga0n895_46359_c2
1467 nmdc:mga0rr50_143165_c1
1468 nmdc:mga0rr50_1877_c1
1469 nmdc:mga0rr50_31563_c1
1470 nmdc:mga08x19_18672_c1
1471 nmdc:mga08x19_2129_c2
1472 nmdc:mga08x19_43978_c1
1473 nmdc:mga08x19_6332_c1
1474 nmdc:mga0a205_107_c2
1475 nmdc:mga0a205_7634_c1
1476 Ga0501084_0254946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

55

268

0.97

Map