F477882

General Info

Members Datasets Scaffolds Average Seq Length
729 263 1458 160

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0000944|Ga0496100_0000944_2204_2779
Length 191
Sequence MRLERDWTKCAHADRNESMRLKRTYSSREIASLTGLTARQLQLWDASGLMAAAIPTHRTDAGGYTERRYTPIELFELLVLADLRRRGFSVPQLHQIIATLRGQFGARLFEATGGGGHVQLLTDGHDIYARTDRGEFFNLLREPAQPLLVVGDEGLLKELSSTLRPRRPRSHKGALPAPRKRSAGRSRDQKL

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
178 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 5.35
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 25.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0000944 3300048903 Bacteria 13902
2 Ga0058861_11794399 3300004800 Bacteria 1965
3 Ga0058862_10215903 3300004803 Unclassified 1914
4 Ga0065704_10309473 3300005289 Unclassified 871
5 Ga0065712_10104326 3300005290 Bacteria 1964
6 Ga0065715_10008955 3300005293 Bacteria 4270
7 Ga0065715_10011211 3300005293 Bacteria 2063
8 Ga0070676_10732885 3300005328 Unclassified 724
9 Ga0070683_100547814 3300005329 Unclassified 1106
10 Ga0070690_100689438 3300005330 Bacteria 783
11 Ga0070670_100091860 3300005331 Bacteria 2610
12 Ga0070670_100385630 3300005331 Bacteria 1235
13 Ga0068869_100105587 3300005334 Bacteria 2137
14 Ga0068869_100663065 3300005334 Unclassified 887
15 Ga0070666_10020939 3300005335 Bacteria 4234
16 Ga0070666_10200812 3300005335 Unclassified 1403
17 Ga0070680_100035994 3300005336 Bacteria 3998
18 Ga0070680_101038433 3300005336 Bacteria 708
19 Ga0070680_101420094 3300005336 Bacteria 601
20 Ga0070682_100431594 3300005337 Bacteria 1004
21 Ga0068868_100016138 3300005338 Bacteria 5540
22 Ga0068868_100029482 3300005338 Bacteria 4202
23 Ga0068868_100786000 3300005338 Unclassified 858
24 Ga0070660_100005024 3300005339 Bacteria 9144
25 Ga0070689_100152789 3300005340 Bacteria 1862
26 Ga0070689_100443957 3300005340 Bacteria 1103
27 Ga0070687_100061394 3300005343 Bacteria 1987
28 Ga0070687_100182483 3300005343 Unclassified 1258
29 Ga0070687_100462813 3300005343 Bacteria 846
30 Ga0070661_100570016 3300005344 Bacteria 913
31 Ga0070668_100145233 3300005347 Bacteria 1914
32 Ga0070668_100268044 3300005347 Bacteria 1422
33 Ga0070669_100008803 3300005353 Bacteria 7199
34 Ga0070669_100069820 3300005353 Bacteria 2595
35 Ga0070669_100361940 3300005353 Bacteria 1180
36 Ga0070675_100153447 3300005354 Unclassified 1976
37 Ga0070671_100022694 3300005355 Bacteria 5127
38 Ga0070671_100393607 3300005355 Bacteria 1185
39 Ga0070671_100631495 3300005355 Unclassified 927
40 Ga0070671_100932829 3300005355 Unclassified 759
41 Ga0070671_100942501 3300005355 Unclassified 755
42 Ga0070674_100108568 3300005356 Unclassified 2034
43 Ga0070674_100150230 3300005356 Bacteria 1757
44 Ga0070674_100271766 3300005356 Bacteria 1340
45 Ga0070674_100620616 3300005356 Bacteria 916
46 Ga0070673_100314915 3300005364 Bacteria 1381
47 Ga0070673_100374824 3300005364 Unclassified 1268
48 Ga0070673_100565925 3300005364 Bacteria 1034
49 Ga0070673_101404190 3300005364 Unclassified 657
50 Ga0070688_100085989 3300005365 Bacteria 2045
51 Ga0070688_100105316 3300005365 Unclassified 1867
52 Ga0070688_100248469 3300005365 Bacteria 1265
53 Ga0070659_100059747 3300005366 Bacteria 3010
54 Ga0070659_100102679 3300005366 Bacteria 2302
55 Ga0070667_100038020 3300005367 Bacteria 4036
56 Ga0070667_100360609 3300005367 Bacteria 1317
57 Ga0070709_10493408 3300005434 Bacteria 929
58 Ga0070714_100744055 3300005435 Bacteria 947
59 Ga0070713_100079681 3300005436 Bacteria 2790
60 Ga0070701_10305087 3300005438 Unclassified 980
61 Ga0070701_10403681 3300005438 Bacteria 866
62 Ga0070701_10620954 3300005438 Bacteria 718
63 Ga0070705_100510647 3300005440 Unclassified 914
64 Ga0070700_100109117 3300005441 Bacteria 1837
65 Ga0070700_100194041 3300005441 Unclassified 1422
66 Ga0070700_100906851 3300005441 Bacteria 718
67 Ga0070694_100018134 3300005444 Bacteria 4463
68 Ga0070694_100106599 3300005444 Bacteria 1990
69 Ga0070694_100888550 3300005444 Bacteria 735
70 Ga0070708_100036911 3300005445 Bacteria 4262
71 Ga0070708_100642728 3300005445 Bacteria 1000
72 Ga0070678_100161269 3300005456 Bacteria 1817
73 Ga0070678_100173014 3300005456 Bacteria 1761
74 Ga0070678_100357755 3300005456 Bacteria 1257
75 Ga0070662_100456949 3300005457 Bacteria 1061
76 Ga0070681_10012336 3300005458 Bacteria 8474
77 Ga0070681_10834860 3300005458 Bacteria 839
78 Ga0068867_100250438 3300005459 Bacteria 1440
79 Ga0068867_100625023 3300005459 Bacteria 942
80 Ga0070706_100280137 3300005467 Bacteria 1556
81 Ga0070706_100826941 3300005467 Bacteria 857
82 Ga0070706_100987075 3300005467 Bacteria 777
83 Ga0070706_101245726 3300005467 Bacteria 683
84 Ga0070707_100102237 3300005468 Unclassified 2777
85 Ga0070707_100106459 3300005468 Bacteria 2720
86 Ga0070707_100128094 3300005468 Bacteria 2467
87 Ga0070707_100413052 3300005468 Bacteria 1310
88 Ga0070707_100561210 3300005468 Bacteria 1104
89 Ga0070707_101706518 3300005468 Bacteria 597
90 Ga0070698_100056676 3300005471 Bacteria 3970
91 Ga0070699_100014967 3300005518 Bacteria 6666
92 Ga0070699_100074390 3300005518 Bacteria 2956
93 Ga0070699_100081960 3300005518 Bacteria 2812
94 Ga0070679_100295562 3300005530 Unclassified 1571
95 Ga0070679_101618933 3300005530 Bacteria 595
96 Ga0070684_100502300 3300005535 Unclassified 1123
97 Ga0070697_100040806 3300005536 Bacteria 3756
98 Ga0070697_100674575 3300005536 Unclassified 911
99 Ga0070697_100764836 3300005536 Bacteria 854
100 Ga0068853_100805322 3300005539 Unclassified 900
101 Ga0070672_100002128 3300005543 Bacteria 12501
102 Ga0070672_100147334 3300005543 Unclassified 1946
103 Ga0070672_100637720 3300005543 Bacteria 930
104 Ga0070672_101094461 3300005543 Bacteria 708
105 Ga0070686_100020103 3300005544 Bacteria 3948
106 Ga0070686_100070078 3300005544 Bacteria 2292
107 Ga0070686_100093777 3300005544 Bacteria 2014
108 Ga0070686_100187636 3300005544 Bacteria 1473
109 Ga0070686_100602724 3300005544 Unclassified 866
110 Ga0070695_100006549 3300005545 Bacteria 6882
111 Ga0070695_100110168 3300005545 Bacteria 1867
112 Ga0070696_100085226 3300005546 Bacteria 2242
113 Ga0070696_100156796 3300005546 Unclassified 1675
114 Ga0070696_100158511 3300005546 Bacteria 1666
115 Ga0070696_100168474 3300005546 Bacteria 1618
116 Ga0070696_100657387 3300005546 Unclassified 850
117 Ga0070696_101215242 3300005546 Bacteria 637
118 Ga0070693_100217419 3300005547 Bacteria 1250
119 Ga0070693_100218155 3300005547 Bacteria 1248
120 Ga0070665_100014048 3300005548 Bacteria 8050
121 Ga0070665_100022599 3300005548 Bacteria 6332
122 Ga0070665_100163570 3300005548 Bacteria 2227
123 Ga0070704_100029626 3300005549 Unclassified 3657
124 Ga0070704_100861213 3300005549 Unclassified 813
125 Ga0068855_100285795 3300005563 Bacteria 1830
126 Ga0068855_100292620 3300005563 Bacteria 1805
127 Ga0070664_100111635 3300005564 Unclassified 2386
128 Ga0070664_100200107 3300005564 Bacteria 1782
129 Ga0070664_100286926 3300005564 Unclassified 1485
130 Ga0068857_100227389 3300005577 Bacteria 1705
131 Ga0068854_100045603 3300005578 Bacteria 3118
132 Ga0068854_100159208 3300005578 Bacteria 1747
133 Ga0068854_100205010 3300005578 Unclassified 1552
134 Ga0068854_100355577 3300005578 Unclassified 1200
135 Ga0068856_100041738 3300005614 Bacteria 4510
136 Ga0070702_100307945 3300005615 Unclassified 1099
137 Ga0070702_100693488 3300005615 Unclassified 775
138 Ga0068852_100393989 3300005616 Unclassified 1361
139 Ga0068859_100004413 3300005617 Bacteria 14352
140 Ga0068859_100037441 3300005617 Bacteria 4868
141 Ga0068859_100110799 3300005617 Bacteria 2807
142 Ga0068859_100139856 3300005617 Unclassified 2494
143 Ga0068859_100361110 3300005617 Bacteria 1547
144 Ga0068859_100828231 3300005617 Bacteria 1012
145 Ga0068864_100012604 3300005618 Bacteria 6991
146 Ga0068864_100289994 3300005618 Bacteria 1530
147 Ga0068866_10025138 3300005718 Bacteria 2796
148 Ga0068866_11255111 3300005718 Unclassified 537
149 Ga0068861_100012934 3300005719 Bacteria 5827
150 Ga0068861_100072744 3300005719 Bacteria 2668
151 Ga0068861_100142405 3300005719 Bacteria 1958
152 Ga0068861_100703915 3300005719 Unclassified 939
153 Ga0068861_101717754 3300005719 Bacteria 621
154 Ga0068870_10293112 3300005840 Bacteria 1024
155 Ga0068863_100192030 3300005841 Unclassified 1963
156 Ga0068863_101894779 3300005841 Unclassified 606
157 Ga0068858_100012051 3300005842 Bacteria 8150
158 Ga0068858_100041172 3300005842 Bacteria 4284
159 Ga0068858_100071308 3300005842 Bacteria 3222
160 Ga0068858_100409361 3300005842 Unclassified 1304
161 Ga0068860_100069823 3300005843 Unclassified 3340
162 Ga0068860_100120363 3300005843 Bacteria 2514
163 Ga0068860_100288617 3300005843 Bacteria 1605
164 Ga0068860_100494770 3300005843 Bacteria 1220
165 Ga0068860_100559689 3300005843 Bacteria 1146
166 Ga0068862_100028651 3300005844 Unclassified 4691
167 Ga0068862_100109126 3300005844 Bacteria 2427
168 Ga0068862_100194662 3300005844 Unclassified 1826
169 Ga0068862_101162696 3300005844 Bacteria 769
170 Ga0070715_10013608 3300006163 Bacteria 2993
171 Ga0070716_100543294 3300006173 Bacteria 865
172 Ga0097621_100004117 3300006237 Bacteria 10085
173 Ga0097621_100021404 3300006237 Bacteria 5002
174 Ga0097621_100034551 3300006237 Bacteria 4034
175 Ga0097621_100053650 3300006237 Bacteria 3286
176 Ga0097621_100057424 3300006237 Bacteria 3183
177 Ga0097621_100112068 3300006237 Bacteria 2306
178 Ga0097621_100132474 3300006237 Bacteria 2123
179 Ga0097621_100186678 3300006237 Unclassified 1794
180 Ga0097621_100222990 3300006237 Bacteria 1643
181 Ga0097621_100418628 3300006237 Bacteria 1202
182 Ga0097621_100521204 3300006237 Bacteria 1079
183 Ga0097621_100654898 3300006237 Bacteria 964
184 Ga0068871_100000670 3300006358 Bacteria 23450
185 Ga0068871_100051184 3300006358 Bacteria 3343
186 Ga0068871_100055205 3300006358 Bacteria 3225
187 Ga0068871_100057193 3300006358 Bacteria 3173
188 Ga0068871_100100775 3300006358 Bacteria 2420
189 Ga0068871_100141055 3300006358 Bacteria 2049
190 Ga0068871_100155946 3300006358 Unclassified 1950
191 Ga0068871_100214812 3300006358 Unclassified 1664
192 Ga0068871_100540775 3300006358 Bacteria 1054
193 Ga0068871_101454766 3300006358 Bacteria 647
194 Ga0075428_100000007 3300006844 Bacteria 273226
195 Ga0075428_100106189 3300006844 Bacteria 3061
196 Ga0075428_100831261 3300006844 Bacteria 981
197 Ga0075428_100935433 3300006844 Bacteria 919
198 Ga0075430_100825898 3300006846 Bacteria 764
199 Ga0075431_100013395 3300006847 Bacteria 8285
200 Ga0075431_100048384 3300006847 Unclassified 4386
201 Ga0075431_100089929 3300006847 Bacteria 3169
202 Ga0075433_10025649 3300006852 Unclassified 4984
203 Ga0075433_10098369 3300006852 Bacteria 2590
204 Ga0075433_10180809 3300006852 Bacteria 1877
205 Ga0075433_10220526 3300006852 Bacteria 1685
206 Ga0075433_10323315 3300006852 Bacteria 1365
207 Ga0075433_10429002 3300006852 Unclassified 1166
208 Ga0075433_10435665 3300006852 Bacteria 1156
209 Ga0075433_10869367 3300006852 Bacteria 787
210 Ga0075434_100000134 3300006871 Bacteria 44745
211 Ga0075434_100014854 3300006871 Bacteria 7449
212 Ga0075434_100041050 3300006871 Bacteria 4582
213 Ga0075434_100135105 3300006871 Bacteria 2485
214 Ga0075434_100164745 3300006871 Unclassified 2237
215 Ga0075434_100541510 3300006871 Bacteria 1184
216 Ga0075434_101146006 3300006871 Unclassified 790
217 Ga0075434_101532064 3300006871 Unclassified 676
218 Ga0075434_101628579 3300006871 Bacteria 654
219 Ga0075429_100149587 3300006880 Bacteria 2044
220 Ga0075429_100598858 3300006880 Bacteria 966
221 Ga0075429_100618383 3300006880 Unclassified 949
222 Ga0075429_100627333 3300006880 Bacteria 942
223 Ga0068865_100007288 3300006881 Bacteria 6797
224 Ga0068865_100210965 3300006881 Bacteria 1513
225 Ga0068865_100337974 3300006881 Bacteria 1216
226 Ga0068865_101290534 3300006881 Bacteria 649
227 Ga0075436_100000233 3300006914 Bacteria 34841
228 Ga0075436_100006348 3300006914 Bacteria 8100
229 Ga0075436_100021857 3300006914 Bacteria 4392
230 Ga0075436_100028943 3300006914 Bacteria 3811
231 Ga0075436_100029792 3300006914 Bacteria 3753
232 Ga0075436_100117907 3300006914 Bacteria 1856
233 Ga0075436_100697747 3300006914 Unclassified 752
234 Ga0097620_100004413 3300006931 Bacteria 14352
235 Ga0097620_100037442 3300006931 Bacteria 4868
236 Ga0097620_100110791 3300006931 Bacteria 2807
237 Ga0097620_100139860 3300006931 Unclassified 2494
238 Ga0097620_100361086 3300006931 Bacteria 1547
239 Ga0097620_100828117 3300006931 Bacteria 1012
240 Ga0097620_101660241 3300006931 Bacteria 706
241 Ga0075435_100000220 3300007076 Bacteria 35137
242 Ga0075435_100002765 3300007076 Bacteria 11718
243 Ga0075435_100016194 3300007076 Bacteria 5619
244 Ga0075435_100021209 3300007076 Bacteria 4993
245 Ga0075435_100026406 3300007076 Unclassified 4530
246 Ga0075435_100298903 3300007076 Bacteria 1377
247 Ga0075435_100347327 3300007076 Bacteria 1271
248 Ga0075435_100528562 3300007076 Bacteria 1021
249 Ga0075435_101118762 3300007076 Bacteria 689
250 Ga0075435_101341200 3300007076 Unclassified 627
251 Ga0075435_102030348 3300007076 Unclassified 505
252 Ga0099794_10263078 3300007265 Bacteria 890
253 Ga0105240_10062935 3300009093 Bacteria 4618
254 Ga0105240_10085699 3300009093 Bacteria 3859
255 Ga0105240_10216820 3300009093 Unclassified 2232
256 Ga0111539_10000009 3300009094 Bacteria 375223
257 Ga0111539_10093939 3300009094 Bacteria 3523
258 Ga0111539_10184065 3300009094 Bacteria 2440
259 Ga0111539_10596571 3300009094 Bacteria 1286
260 Ga0111539_10747835 3300009094 Unclassified 1138
261 Ga0111539_11104190 3300009094 Unclassified 922
262 Ga0105245_10006254 3300009098 Bacteria 10476
263 Ga0105245_10010096 3300009098 Bacteria 8225
264 Ga0105245_10122846 3300009098 Unclassified 2427
265 Ga0105245_10230764 3300009098 Bacteria 1790
266 Ga0105245_11210980 3300009098 Unclassified 803
267 Ga0105245_11417869 3300009098 Bacteria 745
268 Ga0105247_10011056 3300009101 Bacteria 5446
269 Ga0105247_11351083 3300009101 Unclassified 574
270 Ga0114129_10004706 3300009147 Bacteria 19261
271 Ga0114129_10007723 3300009147 Bacteria 15300
272 Ga0114129_10009392 3300009147 Bacteria 13941
273 Ga0114129_10015041 3300009147 Bacteria 11017
274 Ga0114129_10015597 3300009147 Bacteria 10804
275 Ga0114129_10034764 3300009147 Bacteria 7119
276 Ga0114129_10043922 3300009147 Bacteria 6287
277 Ga0114129_10048650 3300009147 Bacteria 5958
278 Ga0114129_10059158 3300009147 Bacteria 5358
279 Ga0114129_10195958 3300009147 Bacteria 2739
280 Ga0114129_10407884 3300009147 Bacteria 1790
281 Ga0114129_10541827 3300009147 Bacteria 1514
282 Ga0114129_10668027 3300009147 Bacteria 1339
283 Ga0114129_11386554 3300009147 Bacteria 868
284 Ga0105243_10008653 3300009148 Bacteria 7807
285 Ga0105243_10191534 3300009148 Bacteria 1786
286 Ga0105243_10372456 3300009148 Bacteria 1318
287 Ga0105243_10487293 3300009148 Bacteria 1165
288 Ga0105243_10747343 3300009148 Unclassified 958
289 Ga0105243_11329237 3300009148 Bacteria 737
290 Ga0105243_11398444 3300009148 Bacteria 720
291 Ga0105243_12322397 3300009148 Bacteria 574
292 Ga0105241_10040605 3300009174 Bacteria 3513
293 Ga0105241_10661645 3300009174 Unclassified 950
294 Ga0105242_10014004 3300009176 Bacteria 6206
295 Ga0105242_10057921 3300009176 Bacteria 3174
296 Ga0105242_10143979 3300009176 Bacteria 2071
297 Ga0105242_10236770 3300009176 Bacteria 1639
298 Ga0105242_10972295 3300009176 Unclassified 855
299 Ga0105242_11233705 3300009176 Unclassified 768
300 Ga0105242_11271527 3300009176 Bacteria 758
301 Ga0105248_10001520 3300009177 Bacteria 25812
302 Ga0105248_10079497 3300009177 Bacteria 3686
303 Ga0105248_10084319 3300009177 Bacteria 3574
304 Ga0105248_10088785 3300009177 Bacteria 3479
305 Ga0105248_10163207 3300009177 Unclassified 2512
306 Ga0105248_10477785 3300009177 Bacteria 1405
307 Ga0105248_10733657 3300009177 Unclassified 1115
308 Ga0105248_10966032 3300009177 Bacteria 962
309 Ga0105248_11542307 3300009177 Bacteria 752
310 Ga0105237_10272351 3300009545 Bacteria 1696
311 Ga0105237_10833675 3300009545 Bacteria 929
312 Ga0105238_10038628 3300009551 Bacteria 4847
313 Ga0105249_10150964 3300009553 Unclassified 2237
314 Ga0105249_10199644 3300009553 Bacteria 1957
315 Ga0105249_10449673 3300009553 Bacteria 1327
316 Ga0105249_10685088 3300009553 Bacteria 1084
317 Ga0105239_11104557 3300010375 Bacteria 913
318 Ga0105239_11302357 3300010375 Unclassified 838
319 Ga0105239_11347253 3300010375 Bacteria 823
320 Ga0105246_11272292 3300011119 Bacteria 680
321 Ga0157369_11215275 3300013105 Bacteria 769
322 Ga0157374_10103311 3300013296 Bacteria 2734
323 Ga0157374_12029313 3300013296 Unclassified 601
324 Ga0157378_10167637 3300013297 Unclassified 2058
325 Ga0157378_10301949 3300013297 Bacteria 1550
326 Ga0157378_10392125 3300013297 Unclassified 1366
327 Ga0157378_10704411 3300013297 Unclassified 1029
328 Ga0163162_10105974 3300013306 Bacteria 2906
329 Ga0163162_10227342 3300013306 Unclassified 1996
330 Ga0163162_10600550 3300013306 Bacteria 1227
331 Ga0157372_10634619 3300013307 Bacteria 1244
332 Ga0157375_10099977 3300013308 Bacteria 2980
333 Ga0157375_10108935 3300013308 Bacteria 2865
334 Ga0157375_11287801 3300013308 Bacteria 859
335 Ga0163163_10002362 3300014325 Bacteria 15969
336 Ga0163163_10076945 3300014325 Bacteria 3332
337 Ga0163163_10271672 3300014325 Unclassified 1746
338 Ga0163163_11331606 3300014325 Unclassified 780
339 Ga0157380_10085607 3300014326 Unclassified 2587
340 Ga0157380_10088492 3300014326 Bacteria 2548
341 Ga0157380_10174194 3300014326 Bacteria 1883
342 Ga0157380_10454279 3300014326 Bacteria 1231
343 Ga0157380_10458400 3300014326 Bacteria 1226
344 Ga0157380_11039878 3300014326 Unclassified 855
345 Ga0157380_12498293 3300014326 Unclassified 582
346 Ga0157377_11027803 3300014745 Bacteria 626
347 Ga0157377_11178686 3300014745 Unclassified 592
348 Ga0157379_10008466 3300014968 Bacteria 8947
349 Ga0157379_10100607 3300014968 Bacteria 2595
350 Ga0157379_10351832 3300014968 Bacteria 1349
351 Ga0157379_10770349 3300014968 Bacteria 907
352 Ga0157379_11587829 3300014968 Unclassified 638
353 Ga0157376_10003000 3300014969 Bacteria 11581
354 Ga0157376_10005627 3300014969 Bacteria 8769
355 Ga0157376_10033464 3300014969 Bacteria 4139
356 Ga0157376_10112853 3300014969 Bacteria 2395
357 Ga0157376_10253384 3300014969 Bacteria 1645
358 Ga0157376_10527194 3300014969 Bacteria 1165
359 Ga0157376_12036715 3300014969 Unclassified 612
360 Ga0163161_10276673 3300017792 Unclassified 1315
361 Ga0163161_10691982 3300017792 Bacteria 848
362 Ga0206350_10238524 3300020080 Bacteria 539
363 Ga0207697_10183827 3300025315 Bacteria 917
364 Ga0207682_10062740 3300025893 Bacteria 1559
365 Ga0207642_10016420 3300025899 Bacteria 2788
366 Ga0207642_11062646 3300025899 Unclassified 523
367 Ga0207710_10242787 3300025900 Bacteria 899
368 Ga0207688_10028547 3300025901 Unclassified 3069
369 Ga0207680_10012053 3300025903 Bacteria 4393
370 Ga0207680_10016138 3300025903 Bacteria 3914
371 Ga0207680_10052673 3300025903 Bacteria 2440
372 Ga0207680_10126668 3300025903 Unclassified 1677
373 Ga0207685_10665649 3300025905 Unclassified 564
374 Ga0207699_10261803 3300025906 Bacteria 1196
375 Ga0207645_10058984 3300025907 Bacteria 2451
376 Ga0207645_10181749 3300025907 Unclassified 1380
377 Ga0207645_10340146 3300025907 Unclassified 1003
378 Ga0207645_10513293 3300025907 Unclassified 812
379 Ga0207645_10904731 3300025907 Unclassified 599
380 Ga0207684_10245858 3300025910 Bacteria 1544
381 Ga0207684_10770727 3300025910 Bacteria 814
382 Ga0207684_10889375 3300025910 Bacteria 749
383 Ga0207684_11035191 3300025910 Bacteria 685
384 Ga0207654_10083693 3300025911 Bacteria 1927
385 Ga0207654_10315895 3300025911 Bacteria 1066
386 Ga0207707_10096365 3300025912 Bacteria 2585
387 Ga0207707_10365421 3300025912 Bacteria 1242
388 Ga0207707_10561086 3300025912 Bacteria 969
389 Ga0207695_10057917 3300025913 Bacteria 4024
390 Ga0207695_10140240 3300025913 Bacteria 2366
391 Ga0207695_10149476 3300025913 Bacteria 2276
392 Ga0207695_10193738 3300025913 Bacteria 1949
393 Ga0207671_10213152 3300025914 Bacteria 1511
394 Ga0207671_10816727 3300025914 Bacteria 739
395 Ga0207671_10929289 3300025914 Unclassified 687
396 Ga0207660_11012960 3300025917 Bacteria 677
397 Ga0207662_10063755 3300025918 Bacteria 2216
398 Ga0207662_10420177 3300025918 Unclassified 910
399 Ga0207657_10013707 3300025919 Bacteria 7938
400 Ga0207649_10512829 3300025920 Bacteria 913
401 Ga0207652_10067785 3300025921 Bacteria 3095
402 Ga0207652_11130648 3300025921 Bacteria 684
403 Ga0207646_10139140 3300025922 Bacteria 2186
404 Ga0207646_10382851 3300025922 Bacteria 1271
405 Ga0207646_10405508 3300025922 Bacteria 1231
406 Ga0207646_10451982 3300025922 Bacteria 1159
407 Ga0207681_10105502 3300025923 Unclassified 2040
408 Ga0207681_10899938 3300025923 Bacteria 741
409 Ga0207681_10945128 3300025923 Unclassified 723
410 Ga0207694_10967337 3300025924 Unclassified 720
411 Ga0207650_10086397 3300025925 Bacteria 2388
412 Ga0207650_10311367 3300025925 Bacteria 1288
413 Ga0207650_10333950 3300025925 Bacteria 1243
414 Ga0207687_10005610 3300025927 Bacteria 8294
415 Ga0207687_10016516 3300025927 Bacteria 4848
416 Ga0207687_10111812 3300025927 Bacteria 2028
417 Ga0207687_10973222 3300025927 Unclassified 727
418 Ga0207687_11135110 3300025927 Unclassified 671
419 Ga0207700_10221376 3300025928 Unclassified 1604
420 Ga0207664_10040462 3300025929 Bacteria 3625
421 Ga0207644_10079652 3300025931 Bacteria 2417
422 Ga0207644_10106453 3300025931 Bacteria 2114
423 Ga0207644_10685610 3300025931 Unclassified 854
424 Ga0207690_10065447 3300025932 Bacteria 2486
425 Ga0207690_10606998 3300025932 Unclassified 894
426 Ga0207706_10026485 3300025933 Bacteria 5190
427 Ga0207706_10378085 3300025933 Bacteria 1229
428 Ga0207706_10396369 3300025933 Bacteria 1197
429 Ga0207706_10457836 3300025933 Unclassified 1103
430 Ga0207706_10841678 3300025933 Bacteria 777
431 Ga0207686_10003728 3300025934 Bacteria 8173
432 Ga0207686_10011750 3300025934 Bacteria 4802
433 Ga0207686_10053537 3300025934 Bacteria 2523
434 Ga0207686_10103642 3300025934 Bacteria 1904
435 Ga0207686_10126340 3300025934 Bacteria 1748
436 Ga0207686_10332392 3300025934 Bacteria 1139
437 Ga0207709_10202294 3300025935 Bacteria 1419
438 Ga0207709_10367943 3300025935 Bacteria 1090
439 Ga0207709_11641727 3300025935 Unclassified 534
440 Ga0207670_10180642 3300025936 Bacteria 1589
441 Ga0207670_10254610 3300025936 Unclassified 1358
442 Ga0207670_10276812 3300025936 Bacteria 1306
443 Ga0207670_10327067 3300025936 Bacteria 1208
444 Ga0207669_10171538 3300025937 Bacteria 1544
445 Ga0207669_10293830 3300025937 Bacteria 1232
446 Ga0207704_10047507 3300025938 Bacteria 2566
447 Ga0207704_10400270 3300025938 Bacteria 1083
448 Ga0207691_10045665 3300025940 Bacteria 4026
449 Ga0207691_10103221 3300025940 Bacteria 2542
450 Ga0207691_10138534 3300025940 Bacteria 2145
451 Ga0207711_10009258 3300025941 Bacteria 8223
452 Ga0207711_10010569 3300025941 Bacteria 7672
453 Ga0207711_10360775 3300025941 Unclassified 1346
454 Ga0207711_10511947 3300025941 Bacteria 1119
455 Ga0207711_10738736 3300025941 Bacteria 918
456 Ga0207711_11304305 3300025941 Bacteria 668
457 Ga0207711_11307495 3300025941 Bacteria 667
458 Ga0207689_10430139 3300025942 Bacteria 1102
459 Ga0207661_10011981 3300025944 Bacteria 6299
460 Ga0207661_10657478 3300025944 Unclassified 963
461 Ga0207679_10246854 3300025945 Bacteria 1515
462 Ga0207679_10251685 3300025945 Unclassified 1502
463 Ga0207679_10251814 3300025945 Bacteria 1502
464 Ga0207679_10311421 3300025945 Unclassified 1360
465 Ga0207667_10870105 3300025949 Unclassified 894
466 Ga0207651_10100180 3300025960 Bacteria 2148
467 Ga0207651_10134178 3300025960 Bacteria 1901
468 Ga0207651_10244351 3300025960 Bacteria 1465
469 Ga0207651_10872576 3300025960 Unclassified 800
470 Ga0207712_10043645 3300025961 Bacteria 3094
471 Ga0207712_10044811 3300025961 Bacteria 3060
472 Ga0207712_10430682 3300025961 Bacteria 1115
473 Ga0207668_10019746 3300025972 Bacteria 4267
474 Ga0207668_10053905 3300025972 Bacteria 2789
475 Ga0207640_10004967 3300025981 Bacteria 7232
476 Ga0207640_11167871 3300025981 Unclassified 683
477 Ga0207658_10065949 3300025986 Bacteria 2721
478 Ga0207658_10283542 3300025986 Unclassified 1421
479 Ga0207658_10340326 3300025986 Bacteria 1304
480 Ga0207658_10571963 3300025986 Bacteria 1013
481 Ga0207677_10060548 3300026023 Bacteria 2617
482 Ga0207677_10306272 3300026023 Bacteria 1314
483 Ga0207677_10360054 3300026023 Bacteria 1222
484 Ga0207677_10744258 3300026023 Bacteria 873
485 Ga0207677_11195218 3300026023 Unclassified 696
486 Ga0207703_10071163 3300026035 Bacteria 2872
487 Ga0207703_10442094 3300026035 Unclassified 1213
488 Ga0207703_10531658 3300026035 Bacteria 1107
489 Ga0207703_11051856 3300026035 Unclassified 781
490 Ga0207639_11379445 3300026041 Bacteria 661
491 Ga0207708_10032003 3300026075 Bacteria 3993
492 Ga0207708_10337514 3300026075 Bacteria 1233
493 Ga0207708_10538345 3300026075 Unclassified 983
494 Ga0207708_10691169 3300026075 Unclassified 871
495 Ga0207708_10714530 3300026075 Bacteria 857
496 Ga0207641_10000409 3300026088 Bacteria 50240
497 Ga0207641_10223522 3300026088 Bacteria 1747
498 Ga0207641_10998164 3300026088 Bacteria 834
499 Ga0207648_10016299 3300026089 Bacteria 6794
500 Ga0207648_10231522 3300026089 Bacteria 1643
501 Ga0207648_10677017 3300026089 Bacteria 955
502 Ga0207648_11068992 3300026089 Bacteria 756
503 Ga0207676_10022651 3300026095 Bacteria 4621
504 Ga0207676_11120418 3300026095 Unclassified 778
505 Ga0207674_10087223 3300026116 Bacteria 3115
506 Ga0207674_10274214 3300026116 Bacteria 1634
507 Ga0207675_100044993 3300026118 Bacteria 4124
508 Ga0207675_100102955 3300026118 Bacteria 2690
509 Ga0207675_100541528 3300026118 Bacteria 1162
510 Ga0207675_100658214 3300026118 Bacteria 1054
511 Ga0207675_100661992 3300026118 Bacteria 1051
512 Ga0207675_100874014 3300026118 Bacteria 914
513 Ga0207675_100960003 3300026118 Bacteria 872
514 Ga0207675_101493076 3300026118 Bacteria 697
515 Ga0207683_10028853 3300026121 Bacteria 4801
516 Ga0207683_10090290 3300026121 Bacteria 2728
517 Ga0207683_10371555 3300026121 Unclassified 1314
518 Ga0207683_10931314 3300026121 Bacteria 807
519 Ga0207698_10361555 3300026142 Unclassified 1375
520 Ga0207698_11287098 3300026142 Bacteria 746
521 Ga0207428_10000022 3300027907 Bacteria 273333
522 Ga0207428_10043263 3300027907 Unclassified 3638
523 Ga0268266_10032844 3300028379 Bacteria 4410
524 Ga0268266_10033346 3300028379 Bacteria 4377
525 Ga0268266_10048341 3300028379 Bacteria 3646
526 Ga0268266_11495191 3300028379 Unclassified 651
527 Ga0268265_10045567 3300028380 Unclassified 3273
528 Ga0268265_10458438 3300028380 Unclassified 1192
529 Ga0268265_10780022 3300028380 Unclassified 930
530 Ga0268265_10961418 3300028380 Bacteria 842
531 Ga0268265_11011319 3300028380 Unclassified 821
532 Ga0268264_10175281 3300028381 Bacteria 1943
533 Ga0268264_10217406 3300028381 Bacteria 1758
534 Ga0268264_10689980 3300028381 Unclassified 1013
535 Ga0268264_10753744 3300028381 Bacteria 970
536 Ga0268264_10903078 3300028381 Unclassified 887
537 Ga0268264_11254498 3300028381 Bacteria 751
538 Ga0265314_10108617 3300031711 Bacteria 1767
539 Ga0373930_0011012 3300034816 Bacteria 1626
540 Ga0373948_0000440 3300034817 Bacteria 5140
541 Ga0373950_0000944 3300034818 Unclassified 3678
542 Ga0373958_0001739 3300034819 Bacteria 2958
543 Ga0373958_0059256 3300034819 Bacteria 826
544 Ga0373959_0002963 3300034820 Bacteria 2696
545 Ga0373938_0000829 3300034957 Bacteria 4994
546 Ga0373938_0093415 3300034957 Unclassified 747
547 Ga0373929_0001288 3300035085 Bacteria 4844
548 Ga0373934_0053214 3300035086 Bacteria 1606
549 Ga0373934_0371962 3300035086 Unclassified 596
550 Ga0373940_0001530 3300035088 Bacteria 4218
551 Ga0373940_0165575 3300035088 Unclassified 712
552 Ga0373949_0001914 3300035090 Bacteria 5623
553 Ga0373951_0007763 3300035091 Unclassified 2434
554 Ga0373952_0008447 3300035092 Bacteria 1955
555 Ga0373932_0001883 3300035112 Bacteria 5607
556 Ga0373939_0004389 3300035114 Bacteria 3332
557 Ga0373941_0000682 3300035115 Bacteria 6907
558 Ga0373945_0025158 3300035116 Unclassified 2067
559 Ga0373945_0154212 3300035116 Bacteria 933
560 Ga0373957_0130457 3300035120 Unclassified 1023
561 Ga0373960_0001092 3300035121 Bacteria 5874
562 Ga0373943_0402001 3300035170 Bacteria 791
563 Ga0373946_0039785 3300035171 Unclassified 1921
564 Ga0373955_0155423 3300035172 Bacteria 1347
565 Ga0373955_0164196 3300035172 Bacteria 1312
566 Ga0373942_0002521 3300035207 Bacteria 4434
567 Ga0373961_0002143 3300035241 Bacteria 5237
568 Ga0373962_0001173 3300035242 Bacteria 6127
569 Ga0373962_0049677 3300035242 Bacteria 1206
570 Ga0373962_0088519 3300035242 Unclassified 950
571 Ga0373931_0004099 3300035691 Bacteria 6611
572 Ga0373931_0304200 3300035691 Bacteria 986
573 Ga0373931_0468274 3300035691 Unclassified 808
574 Ga0373935_1275824 3300035692 Unclassified 548
575 Ga0373927_0252943 3300035695 Bacteria 1158
576 Ga0373933_0212880 3300035724 Bacteria 1239
577 Ga0373933_0585883 3300035724 Bacteria 732
578 Ga0373937_0078586 3300036401 Bacteria 3049
579 Ga0373937_0079910 3300036401 Bacteria 3023
580 Ga0373937_0624090 3300036401 Bacteria 1023
581 Ga0373925_0462159 3300037068 Unclassified 1040
582 Ga0373925_1533968 3300037068 Unclassified 545
583 Ga0436365_0560402 3300039437 Bacteria 2893
584 Ga0466963_0013024 3300044694 Bacteria 5098
585 Ga0451576_0024123 3300045051 Bacteria 6571
586 Ga0451576_0296635 3300045051 Bacteria 1690
587 Ga0451576_1030893 3300045051 Unclassified 862
588 Ga0466958_0815828 3300045836 Bacteria 608
589 Ga0495603_0385882 3300046455 Unclassified 803
590 Ga0495651_0442437 3300046462 Bacteria 841
591 Ga0495653_0638420 3300046463 Unclassified 651
592 Ga0495582_0207423 3300046473 Unclassified 1120
593 Ga0495664_0456919 3300046477 Unclassified 765
594 Ga0495585_0407659 3300046492 Bacteria 654
595 Ga0495628_0123131 3300046516 Bacteria 1988
596 Ga0495628_0261459 3300046516 Unclassified 1290
597 Ga0495642_0047484 3300046528 Unclassified 1759
598 Ga0495652_0280352 3300046529 Bacteria 1221
599 Ga0495640_0066661 3300046533 Bacteria 2428
600 Ga0495640_0165846 3300046533 Bacteria 1413
601 Ga0495598_0112521 3300046537 Bacteria 914
602 Ga0495667_0448398 3300046559 Bacteria 811
603 Ga0495656_0354468 3300046615 Unclassified 761
604 Ga0495635_0361741 3300046663 Unclassified 967
605 Ga0495659_0044209 3300046664 Bacteria 1601
606 Ga0495647_0010795 3300046681 Bacteria 3119
607 Ga0495658_0068189 3300046683 Bacteria 2059
608 Ga0495658_0265983 3300046683 Viruses 1080
609 Ga0495658_0278542 3300046683 Unclassified 1055
610 Ga0495658_0580589 3300046683 Unclassified 718
611 Ga0495669_0078873 3300046684 Unclassified 1509
612 Ga0495669_0262984 3300046684 Unclassified 829
613 Ga0495600_0149796 3300046809 Bacteria 1511
614 Ga0495604_0143892 3300047317 Bacteria 1701
615 Ga0495674_0672013 3300047319 Bacteria 815
616 Ga0495674_0974245 3300047319 Unclassified 651
617 Ga0496100_0436842 3300048903 Unclassified 1002
618 Ga0496100_0676023 3300048903 Bacteria 805
619 Ga0496100_0724089 3300048903 Unclassified 777
620 Ga0496101_0001899 3300048904 Bacteria 12622
621 Ga0496101_0144681 3300048904 Bacteria 1815
622 Ga0496101_0646701 3300048904 Unclassified 835
623 Ga0496102_0506596 3300048905 Bacteria 1129
624 Ga0496102_1302553 3300048905 Unclassified 646
625 Ga0496103_0270038 3300048906 Bacteria 1094
626 Ga0496103_0857183 3300048906 Bacteria 571
627 Ga0496104_0132771 3300048907 Bacteria 2392
628 Ga0496104_0279070 3300048907 Bacteria 1584
629 Ga0496104_0298908 3300048907 Unclassified 1522
630 Ga0496104_1100407 3300048907 Bacteria 698
631 Ga0496104_1126867 3300048907 Unclassified 688
632 Ga0496105_0021862 3300048908 Bacteria 5178
633 Ga0496105_0255395 3300048908 Bacteria 1419
634 Ga0496105_0369823 3300048908 Bacteria 1142
635 Ga0496106_0079923 3300048909 Bacteria 2511
636 Ga0496106_0120690 3300048909 Bacteria 2049
637 Ga0496107_0195217 3300048910 Bacteria 1504
638 Ga0496107_0214035 3300048910 Bacteria 1433
639 Ga0496108_0012961 3300048911 Bacteria 6792
640 Ga0496108_0559543 3300048911 Bacteria 997
641 Ga0496108_0618193 3300048911 Bacteria 943
642 Ga0496109_0241984 3300048912 Bacteria 1698
643 Ga0496109_0619944 3300048912 Bacteria 1018
644 Ga0496110_0100033 3300048913 Bacteria 2599
645 Ga0496110_0183516 3300048913 Unclassified 1900
646 Ga0496111_0656292 3300048914 Bacteria 765
647 Ga0496112_0049109 3300048915 Bacteria 4135
648 Ga0496112_0263438 3300048915 Bacteria 1673
649 Ga0496112_1201335 3300048915 Unclassified 675
650 Ga0496113_0027293 3300048916 Bacteria 4092
651 Ga0496114_0020828 3300048917 Bacteria 5324
652 Ga0496114_0138992 3300048917 Bacteria 2102
653 Ga0496114_0690913 3300048917 Unclassified 895
654 Ga0496115_0038754 3300048918 Bacteria 3783
655 Ga0501036_0903194 3300049572 Bacteria 725
656 Ga0501039_0181342 3300049575 Unclassified 1656
657 Ga0501072_0998305 3300049588 Bacteria 652
658 Ga0501076_0263985 3300049592 Bacteria 1410
659 nmdc:mga05p37_11396_c1 3300050507 Bacteria 10581
660 nmdc:mga05p37_14016_c1 3300050507 Bacteria 9615
661 nmdc:mga05p37_172089_c1 3300050507 Bacteria 2641
662 nmdc:mga05p37_17354_c1 3300050507 Bacteria 8684
663 nmdc:mga05p37_226164_c1 3300050507 Bacteria 2256
664 nmdc:mga05p37_24324_c1 3300050507 Bacteria 7360
665 nmdc:mga05p37_277160_c1 3300050507 Bacteria 2002
666 nmdc:mga05p37_296117_c1 3300050507 Unclassified 1924
667 nmdc:mga05p37_511413_c1 3300050507 Bacteria 1376
668 nmdc:mga05p37_70327_c1 3300050507 Bacteria 4304
669 nmdc:mga05p37_780222_c1 3300050507 Bacteria 1049
670 nmdc:mga09592_21615_c2 3300050508 Bacteria 3254
671 nmdc:mga09592_493833_c1 3300050508 Bacteria 1054
672 nmdc:mga09592_933250_c1 3300050508 Unclassified 728
673 nmdc:mga06r32_118024_c1 3300050510 Bacteria 2615
674 nmdc:mga06r32_238483_c1 3300050510 Bacteria 1806
675 nmdc:mga06r32_63954_c1 3300050510 Unclassified 3547
676 nmdc:mga08y16_1274313_c1 3300050511 Bacteria 703
677 nmdc:mga08y16_18129_c1 3300050511 Bacteria 7416
678 nmdc:mga08y16_1978066_c1 3300050511 Bacteria 532
679 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
680 nmdc:mga08y16_340131_c1 3300050511 Bacteria 1543
681 nmdc:mga08y16_37358_c1 3300050511 Bacteria 5101
682 nmdc:mga08y16_716563_c1 3300050511 Bacteria 999
683 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
684 nmdc:mga0n895_174577_c1 3300050512 Bacteria 2180
685 nmdc:mga0n895_254453_c1 3300050512 Bacteria 1782
686 nmdc:mga0n895_372908_c1 3300050512 Bacteria 1444
687 nmdc:mga0n895_38575_c1 3300050512 Unclassified 4630
688 nmdc:mga0n895_39426_c1 3300050512 Bacteria 4583
689 nmdc:mga0n895_439219_c1 3300050512 Bacteria 1318
690 nmdc:mga0n895_476758_c1 3300050512 Unclassified 1259
691 nmdc:mga0n895_499117_c1 3300050512 Bacteria 1226
692 nmdc:mga0n895_549338_c1 3300050512 Bacteria 1161
693 nmdc:mga0rr50_103167_c1 3300050513 Bacteria 2244
694 nmdc:mga0rr50_124049_c1 3300050513 Unclassified 2060
695 nmdc:mga0rr50_137975_c1 3300050513 Bacteria 1959
696 nmdc:mga0rr50_1670720_c1 3300050513 Unclassified 537
697 nmdc:mga0rr50_1933_c1 3300050513 Bacteria 11522
698 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
699 nmdc:mga0rr50_240957_c1 3300050513 Bacteria 1499
700 nmdc:mga0rr50_299275_c1 3300050513 Bacteria 1345
701 nmdc:mga0rr50_60767_c1 3300050513 Bacteria 2844
702 nmdc:mga08x19_121175_c1 3300050514 Bacteria 1754
703 nmdc:mga08x19_1236768_c1 3300050514 Unclassified 529
704 nmdc:mga08x19_155532_c1 3300050514 Bacteria 1550
705 nmdc:mga08x19_24787_c1 3300050514 Bacteria 3732
706 nmdc:mga08x19_319_c1 3300050514 Bacteria 34836
707 nmdc:mga08x19_38503_c1 3300050514 Unclassified 3038
708 nmdc:mga08x19_388156_c1 3300050514 Bacteria 978
709 nmdc:mga08x19_695905_c1 3300050514 Bacteria 721
710 nmdc:mga08x19_7727_c1 3300050514 Bacteria 6387
711 nmdc:mga0a205_16668_c1 3300050515 Bacteria 6881
712 nmdc:mga0a205_191661_c1 3300050515 Unclassified 1936
713 nmdc:mga0a205_652307_c1 3300050515 Unclassified 904
714 nmdc:mga0a205_825211_c1 3300050515 Unclassified 775
715 nmdc:mga0a205_87111_c1 3300050515 Bacteria 3017
716 Ga0495601_0138533 3300053077 Bacteria 1587
717 Ga0495601_0148880 3300053077 Bacteria 1528
718 Ga0495601_0279647 3300053077 Bacteria 1088
719 Ga0495601_0455427 3300053077 Unclassified 827
720 Ga0495612_0319906 3300053078 Bacteria 698
721 Ga0495595_0056068 3300053084 Unclassified 1836
722 Ga0495595_0076666 3300053084 Unclassified 1587
723 Ga0495595_0150828 3300053084 Bacteria 1144
724 Ga0495619_0010785 3300053085 Bacteria 5750
725 Ga0495619_0103811 3300053085 Unclassified 1937
726 Ga0500658_0300173 3300053134 Unclassified 738
727 Ga0501084_0185310 3300054114 Bacteria 1757
728 Ga0530510_0227236 3300061734 Unclassified 1388
729 Ga0530510_1219117 3300061734 Bacteria 577
730 Ga0496100_0000944
731 Ga0058861_11794399
732 Ga0058862_10215903
733 Ga0065704_10309473
734 Ga0065712_10104326
735 Ga0065715_10008955
736 Ga0065715_10011211
737 Ga0070676_10732885
738 Ga0070683_100547814
739 Ga0070690_100689438
740 Ga0070670_100091860
741 Ga0070670_100385630
742 Ga0068869_100105587
743 Ga0068869_100663065
744 Ga0070666_10020939
745 Ga0070666_10200812
746 Ga0070680_100035994
747 Ga0070680_101038433
748 Ga0070680_101420094
749 Ga0070682_100431594
750 Ga0068868_100016138
751 Ga0068868_100029482
752 Ga0068868_100786000
753 Ga0070660_100005024
754 Ga0070689_100152789
755 Ga0070689_100443957
756 Ga0070687_100061394
757 Ga0070687_100182483
758 Ga0070687_100462813
759 Ga0070661_100570016
760 Ga0070668_100145233
761 Ga0070668_100268044
762 Ga0070669_100008803
763 Ga0070669_100069820
764 Ga0070669_100361940
765 Ga0070675_100153447
766 Ga0070671_100022694
767 Ga0070671_100393607
768 Ga0070671_100631495
769 Ga0070671_100932829
770 Ga0070671_100942501
771 Ga0070674_100108568
772 Ga0070674_100150230
773 Ga0070674_100271766
774 Ga0070674_100620616
775 Ga0070673_100314915
776 Ga0070673_100374824
777 Ga0070673_100565925
778 Ga0070673_101404190
779 Ga0070688_100085989
780 Ga0070688_100105316
781 Ga0070688_100248469
782 Ga0070659_100059747
783 Ga0070659_100102679
784 Ga0070667_100038020
785 Ga0070667_100360609
786 Ga0070709_10493408
787 Ga0070714_100744055
788 Ga0070713_100079681
789 Ga0070701_10305087
790 Ga0070701_10403681
791 Ga0070701_10620954
792 Ga0070705_100510647
793 Ga0070700_100109117
794 Ga0070700_100194041
795 Ga0070700_100906851
796 Ga0070694_100018134
797 Ga0070694_100106599
798 Ga0070694_100888550
799 Ga0070708_100036911
800 Ga0070708_100642728
801 Ga0070678_100161269
802 Ga0070678_100173014
803 Ga0070678_100357755
804 Ga0070662_100456949
805 Ga0070681_10012336
806 Ga0070681_10834860
807 Ga0068867_100250438
808 Ga0068867_100625023
809 Ga0070706_100280137
810 Ga0070706_100826941
811 Ga0070706_100987075
812 Ga0070706_101245726
813 Ga0070707_100102237
814 Ga0070707_100106459
815 Ga0070707_100128094
816 Ga0070707_100413052
817 Ga0070707_100561210
818 Ga0070707_101706518
819 Ga0070698_100056676
820 Ga0070699_100014967
821 Ga0070699_100074390
822 Ga0070699_100081960
823 Ga0070679_100295562
824 Ga0070679_101618933
825 Ga0070684_100502300
826 Ga0070697_100040806
827 Ga0070697_100674575
828 Ga0070697_100764836
829 Ga0068853_100805322
830 Ga0070672_100002128
831 Ga0070672_100147334
832 Ga0070672_100637720
833 Ga0070672_101094461
834 Ga0070686_100020103
835 Ga0070686_100070078
836 Ga0070686_100093777
837 Ga0070686_100187636
838 Ga0070686_100602724
839 Ga0070695_100006549
840 Ga0070695_100110168
841 Ga0070696_100085226
842 Ga0070696_100156796
843 Ga0070696_100158511
844 Ga0070696_100168474
845 Ga0070696_100657387
846 Ga0070696_101215242
847 Ga0070693_100217419
848 Ga0070693_100218155
849 Ga0070665_100014048
850 Ga0070665_100022599
851 Ga0070665_100163570
852 Ga0070704_100029626
853 Ga0070704_100861213
854 Ga0068855_100285795
855 Ga0068855_100292620
856 Ga0070664_100111635
857 Ga0070664_100200107
858 Ga0070664_100286926
859 Ga0068857_100227389
860 Ga0068854_100045603
861 Ga0068854_100159208
862 Ga0068854_100205010
863 Ga0068854_100355577
864 Ga0068856_100041738
865 Ga0070702_100307945
866 Ga0070702_100693488
867 Ga0068852_100393989
868 Ga0068859_100004413
869 Ga0068859_100037441
870 Ga0068859_100110799
871 Ga0068859_100139856
872 Ga0068859_100361110
873 Ga0068859_100828231
874 Ga0068864_100012604
875 Ga0068864_100289994
876 Ga0068866_10025138
877 Ga0068866_11255111
878 Ga0068861_100012934
879 Ga0068861_100072744
880 Ga0068861_100142405
881 Ga0068861_100703915
882 Ga0068861_101717754
883 Ga0068870_10293112
884 Ga0068863_100192030
885 Ga0068863_101894779
886 Ga0068858_100012051
887 Ga0068858_100041172
888 Ga0068858_100071308
889 Ga0068858_100409361
890 Ga0068860_100069823
891 Ga0068860_100120363
892 Ga0068860_100288617
893 Ga0068860_100494770
894 Ga0068860_100559689
895 Ga0068862_100028651
896 Ga0068862_100109126
897 Ga0068862_100194662
898 Ga0068862_101162696
899 Ga0070715_10013608
900 Ga0070716_100543294
901 Ga0097621_100004117
902 Ga0097621_100021404
903 Ga0097621_100034551
904 Ga0097621_100053650
905 Ga0097621_100057424
906 Ga0097621_100112068
907 Ga0097621_100132474
908 Ga0097621_100186678
909 Ga0097621_100222990
910 Ga0097621_100418628
911 Ga0097621_100521204
912 Ga0097621_100654898
913 Ga0068871_100000670
914 Ga0068871_100051184
915 Ga0068871_100055205
916 Ga0068871_100057193
917 Ga0068871_100100775
918 Ga0068871_100141055
919 Ga0068871_100155946
920 Ga0068871_100214812
921 Ga0068871_100540775
922 Ga0068871_101454766
923 Ga0075428_100000007
924 Ga0075428_100106189
925 Ga0075428_100831261
926 Ga0075428_100935433
927 Ga0075430_100825898
928 Ga0075431_100013395
929 Ga0075431_100048384
930 Ga0075431_100089929
931 Ga0075433_10025649
932 Ga0075433_10098369
933 Ga0075433_10180809
934 Ga0075433_10220526
935 Ga0075433_10323315
936 Ga0075433_10429002
937 Ga0075433_10435665
938 Ga0075433_10869367
939 Ga0075434_100000134
940 Ga0075434_100014854
941 Ga0075434_100041050
942 Ga0075434_100135105
943 Ga0075434_100164745
944 Ga0075434_100541510
945 Ga0075434_101146006
946 Ga0075434_101532064
947 Ga0075434_101628579
948 Ga0075429_100149587
949 Ga0075429_100598858
950 Ga0075429_100618383
951 Ga0075429_100627333
952 Ga0068865_100007288
953 Ga0068865_100210965
954 Ga0068865_100337974
955 Ga0068865_101290534
956 Ga0075436_100000233
957 Ga0075436_100006348
958 Ga0075436_100021857
959 Ga0075436_100028943
960 Ga0075436_100029792
961 Ga0075436_100117907
962 Ga0075436_100697747
963 Ga0097620_100004413
964 Ga0097620_100037442
965 Ga0097620_100110791
966 Ga0097620_100139860
967 Ga0097620_100361086
968 Ga0097620_100828117
969 Ga0097620_101660241
970 Ga0075435_100000220
971 Ga0075435_100002765
972 Ga0075435_100016194
973 Ga0075435_100021209
974 Ga0075435_100026406
975 Ga0075435_100298903
976 Ga0075435_100347327
977 Ga0075435_100528562
978 Ga0075435_101118762
979 Ga0075435_101341200
980 Ga0075435_102030348
981 Ga0099794_10263078
982 Ga0105240_10062935
983 Ga0105240_10085699
984 Ga0105240_10216820
985 Ga0111539_10000009
986 Ga0111539_10093939
987 Ga0111539_10184065
988 Ga0111539_10596571
989 Ga0111539_10747835
990 Ga0111539_11104190
991 Ga0105245_10006254
992 Ga0105245_10010096
993 Ga0105245_10122846
994 Ga0105245_10230764
995 Ga0105245_11210980
996 Ga0105245_11417869
997 Ga0105247_10011056
998 Ga0105247_11351083
999 Ga0114129_10004706
1000 Ga0114129_10007723
1001 Ga0114129_10009392
1002 Ga0114129_10015041
1003 Ga0114129_10015597
1004 Ga0114129_10034764
1005 Ga0114129_10043922
1006 Ga0114129_10048650
1007 Ga0114129_10059158
1008 Ga0114129_10195958
1009 Ga0114129_10407884
1010 Ga0114129_10541827
1011 Ga0114129_10668027
1012 Ga0114129_11386554
1013 Ga0105243_10008653
1014 Ga0105243_10191534
1015 Ga0105243_10372456
1016 Ga0105243_10487293
1017 Ga0105243_10747343
1018 Ga0105243_11329237
1019 Ga0105243_11398444
1020 Ga0105243_12322397
1021 Ga0105241_10040605
1022 Ga0105241_10661645
1023 Ga0105242_10014004
1024 Ga0105242_10057921
1025 Ga0105242_10143979
1026 Ga0105242_10236770
1027 Ga0105242_10972295
1028 Ga0105242_11233705
1029 Ga0105242_11271527
1030 Ga0105248_10001520
1031 Ga0105248_10079497
1032 Ga0105248_10084319
1033 Ga0105248_10088785
1034 Ga0105248_10163207
1035 Ga0105248_10477785
1036 Ga0105248_10733657
1037 Ga0105248_10966032
1038 Ga0105248_11542307
1039 Ga0105237_10272351
1040 Ga0105237_10833675
1041 Ga0105238_10038628
1042 Ga0105249_10150964
1043 Ga0105249_10199644
1044 Ga0105249_10449673
1045 Ga0105249_10685088
1046 Ga0105239_11104557
1047 Ga0105239_11302357
1048 Ga0105239_11347253
1049 Ga0105246_11272292
1050 Ga0157369_11215275
1051 Ga0157374_10103311
1052 Ga0157374_12029313
1053 Ga0157378_10167637
1054 Ga0157378_10301949
1055 Ga0157378_10392125
1056 Ga0157378_10704411
1057 Ga0163162_10105974
1058 Ga0163162_10227342
1059 Ga0163162_10600550
1060 Ga0157372_10634619
1061 Ga0157375_10099977
1062 Ga0157375_10108935
1063 Ga0157375_11287801
1064 Ga0163163_10002362
1065 Ga0163163_10076945
1066 Ga0163163_10271672
1067 Ga0163163_11331606
1068 Ga0157380_10085607
1069 Ga0157380_10088492
1070 Ga0157380_10174194
1071 Ga0157380_10454279
1072 Ga0157380_10458400
1073 Ga0157380_11039878
1074 Ga0157380_12498293
1075 Ga0157377_11027803
1076 Ga0157377_11178686
1077 Ga0157379_10008466
1078 Ga0157379_10100607
1079 Ga0157379_10351832
1080 Ga0157379_10770349
1081 Ga0157379_11587829
1082 Ga0157376_10003000
1083 Ga0157376_10005627
1084 Ga0157376_10033464
1085 Ga0157376_10112853
1086 Ga0157376_10253384
1087 Ga0157376_10527194
1088 Ga0157376_12036715
1089 Ga0163161_10276673
1090 Ga0163161_10691982
1091 Ga0206350_10238524
1092 Ga0207697_10183827
1093 Ga0207682_10062740
1094 Ga0207642_10016420
1095 Ga0207642_11062646
1096 Ga0207710_10242787
1097 Ga0207688_10028547
1098 Ga0207680_10012053
1099 Ga0207680_10016138
1100 Ga0207680_10052673
1101 Ga0207680_10126668
1102 Ga0207685_10665649
1103 Ga0207699_10261803
1104 Ga0207645_10058984
1105 Ga0207645_10181749
1106 Ga0207645_10340146
1107 Ga0207645_10513293
1108 Ga0207645_10904731
1109 Ga0207684_10245858
1110 Ga0207684_10770727
1111 Ga0207684_10889375
1112 Ga0207684_11035191
1113 Ga0207654_10083693
1114 Ga0207654_10315895
1115 Ga0207707_10096365
1116 Ga0207707_10365421
1117 Ga0207707_10561086
1118 Ga0207695_10057917
1119 Ga0207695_10140240
1120 Ga0207695_10149476
1121 Ga0207695_10193738
1122 Ga0207671_10213152
1123 Ga0207671_10816727
1124 Ga0207671_10929289
1125 Ga0207660_11012960
1126 Ga0207662_10063755
1127 Ga0207662_10420177
1128 Ga0207657_10013707
1129 Ga0207649_10512829
1130 Ga0207652_10067785
1131 Ga0207652_11130648
1132 Ga0207646_10139140
1133 Ga0207646_10382851
1134 Ga0207646_10405508
1135 Ga0207646_10451982
1136 Ga0207681_10105502
1137 Ga0207681_10899938
1138 Ga0207681_10945128
1139 Ga0207694_10967337
1140 Ga0207650_10086397
1141 Ga0207650_10311367
1142 Ga0207650_10333950
1143 Ga0207687_10005610
1144 Ga0207687_10016516
1145 Ga0207687_10111812
1146 Ga0207687_10973222
1147 Ga0207687_11135110
1148 Ga0207700_10221376
1149 Ga0207664_10040462
1150 Ga0207644_10079652
1151 Ga0207644_10106453
1152 Ga0207644_10685610
1153 Ga0207690_10065447
1154 Ga0207690_10606998
1155 Ga0207706_10026485
1156 Ga0207706_10378085
1157 Ga0207706_10396369
1158 Ga0207706_10457836
1159 Ga0207706_10841678
1160 Ga0207686_10003728
1161 Ga0207686_10011750
1162 Ga0207686_10053537
1163 Ga0207686_10103642
1164 Ga0207686_10126340
1165 Ga0207686_10332392
1166 Ga0207709_10202294
1167 Ga0207709_10367943
1168 Ga0207709_11641727
1169 Ga0207670_10180642
1170 Ga0207670_10254610
1171 Ga0207670_10276812
1172 Ga0207670_10327067
1173 Ga0207669_10171538
1174 Ga0207669_10293830
1175 Ga0207704_10047507
1176 Ga0207704_10400270
1177 Ga0207691_10045665
1178 Ga0207691_10103221
1179 Ga0207691_10138534
1180 Ga0207711_10009258
1181 Ga0207711_10010569
1182 Ga0207711_10360775
1183 Ga0207711_10511947
1184 Ga0207711_10738736
1185 Ga0207711_11304305
1186 Ga0207711_11307495
1187 Ga0207689_10430139
1188 Ga0207661_10011981
1189 Ga0207661_10657478
1190 Ga0207679_10246854
1191 Ga0207679_10251685
1192 Ga0207679_10251814
1193 Ga0207679_10311421
1194 Ga0207667_10870105
1195 Ga0207651_10100180
1196 Ga0207651_10134178
1197 Ga0207651_10244351
1198 Ga0207651_10872576
1199 Ga0207712_10043645
1200 Ga0207712_10044811
1201 Ga0207712_10430682
1202 Ga0207668_10019746
1203 Ga0207668_10053905
1204 Ga0207640_10004967
1205 Ga0207640_11167871
1206 Ga0207658_10065949
1207 Ga0207658_10283542
1208 Ga0207658_10340326
1209 Ga0207658_10571963
1210 Ga0207677_10060548
1211 Ga0207677_10306272
1212 Ga0207677_10360054
1213 Ga0207677_10744258
1214 Ga0207677_11195218
1215 Ga0207703_10071163
1216 Ga0207703_10442094
1217 Ga0207703_10531658
1218 Ga0207703_11051856
1219 Ga0207639_11379445
1220 Ga0207708_10032003
1221 Ga0207708_10337514
1222 Ga0207708_10538345
1223 Ga0207708_10691169
1224 Ga0207708_10714530
1225 Ga0207641_10000409
1226 Ga0207641_10223522
1227 Ga0207641_10998164
1228 Ga0207648_10016299
1229 Ga0207648_10231522
1230 Ga0207648_10677017
1231 Ga0207648_11068992
1232 Ga0207676_10022651
1233 Ga0207676_11120418
1234 Ga0207674_10087223
1235 Ga0207674_10274214
1236 Ga0207675_100044993
1237 Ga0207675_100102955
1238 Ga0207675_100541528
1239 Ga0207675_100658214
1240 Ga0207675_100661992
1241 Ga0207675_100874014
1242 Ga0207675_100960003
1243 Ga0207675_101493076
1244 Ga0207683_10028853
1245 Ga0207683_10090290
1246 Ga0207683_10371555
1247 Ga0207683_10931314
1248 Ga0207698_10361555
1249 Ga0207698_11287098
1250 Ga0207428_10000022
1251 Ga0207428_10043263
1252 Ga0268266_10032844
1253 Ga0268266_10033346
1254 Ga0268266_10048341
1255 Ga0268266_11495191
1256 Ga0268265_10045567
1257 Ga0268265_10458438
1258 Ga0268265_10780022
1259 Ga0268265_10961418
1260 Ga0268265_11011319
1261 Ga0268264_10175281
1262 Ga0268264_10217406
1263 Ga0268264_10689980
1264 Ga0268264_10753744
1265 Ga0268264_10903078
1266 Ga0268264_11254498
1267 Ga0265314_10108617
1268 Ga0373930_0011012
1269 Ga0373948_0000440
1270 Ga0373950_0000944
1271 Ga0373958_0001739
1272 Ga0373958_0059256
1273 Ga0373959_0002963
1274 Ga0373938_0000829
1275 Ga0373938_0093415
1276 Ga0373929_0001288
1277 Ga0373934_0053214
1278 Ga0373934_0371962
1279 Ga0373940_0001530
1280 Ga0373940_0165575
1281 Ga0373949_0001914
1282 Ga0373951_0007763
1283 Ga0373952_0008447
1284 Ga0373932_0001883
1285 Ga0373939_0004389
1286 Ga0373941_0000682
1287 Ga0373945_0025158
1288 Ga0373945_0154212
1289 Ga0373957_0130457
1290 Ga0373960_0001092
1291 Ga0373943_0402001
1292 Ga0373946_0039785
1293 Ga0373955_0155423
1294 Ga0373955_0164196
1295 Ga0373942_0002521
1296 Ga0373961_0002143
1297 Ga0373962_0001173
1298 Ga0373962_0049677
1299 Ga0373962_0088519
1300 Ga0373931_0004099
1301 Ga0373931_0304200
1302 Ga0373931_0468274
1303 Ga0373935_1275824
1304 Ga0373927_0252943
1305 Ga0373933_0212880
1306 Ga0373933_0585883
1307 Ga0373937_0078586
1308 Ga0373937_0079910
1309 Ga0373937_0624090
1310 Ga0373925_0462159
1311 Ga0373925_1533968
1312 Ga0436365_0560402
1313 Ga0466963_0013024
1314 Ga0451576_0024123
1315 Ga0451576_0296635
1316 Ga0451576_1030893
1317 Ga0466958_0815828
1318 Ga0495603_0385882
1319 Ga0495651_0442437
1320 Ga0495653_0638420
1321 Ga0495582_0207423
1322 Ga0495664_0456919
1323 Ga0495585_0407659
1324 Ga0495628_0123131
1325 Ga0495628_0261459
1326 Ga0495642_0047484
1327 Ga0495652_0280352
1328 Ga0495640_0066661
1329 Ga0495640_0165846
1330 Ga0495598_0112521
1331 Ga0495667_0448398
1332 Ga0495656_0354468
1333 Ga0495635_0361741
1334 Ga0495659_0044209
1335 Ga0495647_0010795
1336 Ga0495658_0068189
1337 Ga0495658_0265983
1338 Ga0495658_0278542
1339 Ga0495658_0580589
1340 Ga0495669_0078873
1341 Ga0495669_0262984
1342 Ga0495600_0149796
1343 Ga0495604_0143892
1344 Ga0495674_0672013
1345 Ga0495674_0974245
1346 Ga0496100_0436842
1347 Ga0496100_0676023
1348 Ga0496100_0724089
1349 Ga0496101_0001899
1350 Ga0496101_0144681
1351 Ga0496101_0646701
1352 Ga0496102_0506596
1353 Ga0496102_1302553
1354 Ga0496103_0270038
1355 Ga0496103_0857183
1356 Ga0496104_0132771
1357 Ga0496104_0279070
1358 Ga0496104_0298908
1359 Ga0496104_1100407
1360 Ga0496104_1126867
1361 Ga0496105_0021862
1362 Ga0496105_0255395
1363 Ga0496105_0369823
1364 Ga0496106_0079923
1365 Ga0496106_0120690
1366 Ga0496107_0195217
1367 Ga0496107_0214035
1368 Ga0496108_0012961
1369 Ga0496108_0559543
1370 Ga0496108_0618193
1371 Ga0496109_0241984
1372 Ga0496109_0619944
1373 Ga0496110_0100033
1374 Ga0496110_0183516
1375 Ga0496111_0656292
1376 Ga0496112_0049109
1377 Ga0496112_0263438
1378 Ga0496112_1201335
1379 Ga0496113_0027293
1380 Ga0496114_0020828
1381 Ga0496114_0138992
1382 Ga0496114_0690913
1383 Ga0496115_0038754
1384 Ga0501036_0903194
1385 Ga0501039_0181342
1386 Ga0501072_0998305
1387 Ga0501076_0263985
1388 nmdc:mga05p37_11396_c1
1389 nmdc:mga05p37_14016_c1
1390 nmdc:mga05p37_172089_c1
1391 nmdc:mga05p37_17354_c1
1392 nmdc:mga05p37_226164_c1
1393 nmdc:mga05p37_24324_c1
1394 nmdc:mga05p37_277160_c1
1395 nmdc:mga05p37_296117_c1
1396 nmdc:mga05p37_511413_c1
1397 nmdc:mga05p37_70327_c1
1398 nmdc:mga05p37_780222_c1
1399 nmdc:mga09592_21615_c2
1400 nmdc:mga09592_493833_c1
1401 nmdc:mga09592_933250_c1
1402 nmdc:mga06r32_118024_c1
1403 nmdc:mga06r32_238483_c1
1404 nmdc:mga06r32_63954_c1
1405 nmdc:mga08y16_1274313_c1
1406 nmdc:mga08y16_18129_c1
1407 nmdc:mga08y16_1978066_c1
1408 nmdc:mga08y16_21_c1
1409 nmdc:mga08y16_340131_c1
1410 nmdc:mga08y16_37358_c1
1411 nmdc:mga08y16_716563_c1
1412 nmdc:mga0n895_10_c1
1413 nmdc:mga0n895_174577_c1
1414 nmdc:mga0n895_254453_c1
1415 nmdc:mga0n895_372908_c1
1416 nmdc:mga0n895_38575_c1
1417 nmdc:mga0n895_39426_c1
1418 nmdc:mga0n895_439219_c1
1419 nmdc:mga0n895_476758_c1
1420 nmdc:mga0n895_499117_c1
1421 nmdc:mga0n895_549338_c1
1422 nmdc:mga0rr50_103167_c1
1423 nmdc:mga0rr50_124049_c1
1424 nmdc:mga0rr50_137975_c1
1425 nmdc:mga0rr50_1670720_c1
1426 nmdc:mga0rr50_1933_c1
1427 nmdc:mga0rr50_20_c1
1428 nmdc:mga0rr50_240957_c1
1429 nmdc:mga0rr50_299275_c1
1430 nmdc:mga0rr50_60767_c1
1431 nmdc:mga08x19_121175_c1
1432 nmdc:mga08x19_1236768_c1
1433 nmdc:mga08x19_155532_c1
1434 nmdc:mga08x19_24787_c1
1435 nmdc:mga08x19_319_c1
1436 nmdc:mga08x19_38503_c1
1437 nmdc:mga08x19_388156_c1
1438 nmdc:mga08x19_695905_c1
1439 nmdc:mga08x19_7727_c1
1440 nmdc:mga0a205_16668_c1
1441 nmdc:mga0a205_191661_c1
1442 nmdc:mga0a205_652307_c1
1443 nmdc:mga0a205_825211_c1
1444 nmdc:mga0a205_87111_c1
1445 Ga0495601_0138533
1446 Ga0495601_0148880
1447 Ga0495601_0279647
1448 Ga0495601_0455427
1449 Ga0495612_0319906
1450 Ga0495595_0056068
1451 Ga0495595_0076666
1452 Ga0495595_0150828
1453 Ga0495619_0010785
1454 Ga0495619_0103811
1455 Ga0500658_0300173
1456 Ga0501084_0185310
1457 Ga0530510_0227236
1458 Ga0530510_1219117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

25

100

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qao-assembly1.cif.gz_A-2 the crystal structure of the n-terminal domain of a merr-like transcriptional regulator from listeria monocytogenes egd-e 0.8344 4 78
6jni-assembly4.cif.gz_G crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8131 7 85
6jni-assembly3.cif.gz_E crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8121 7 85
6jni-assembly4.cif.gz_H crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8115 7 85
1jbg-assembly1.cif.gz_A-2 crystal structure of mtan, the bacillus subtilis multidrug transporter activator, n-terminus 0.8114 7 78
ID Description Score Start End Superfamily
3d6zA01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8385 6 76 1.10.1660.10
1r8dA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8338 6 80 1.10.1660.10
af_Q2FVM8_3_134_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8094 6 76 1.10.1660.10
af_Q2G2L8_2_138_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.7971 6 85 1.10.1660.10
1exjA02 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.7911 4 76 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A843SY63-F1-model_v4 MerR family transcriptional regulator 0.9609 1 153 GO:0003677
GO:0006355
AF-A0A843SY63-F1-model_v4 MerR family transcriptional regulator 0.9552 1 153 GO:0003677
GO:0006355
AF-A0A381S194-F1-model_v4 HTH merR-type domain-containing protein 0.952 1 152 GO:0003677
GO:0003700
AF-A0A2E4W978-F1-model_v4 HTH merR-type domain-containing protein 0.9419 1 153 GO:0003677
GO:0003700
AF-A0A381S194-F1-model_v4 HTH merR-type domain-containing protein 0.94 1 152 GO:0003677
GO:0003700

Map