F477785

General Info

Members Datasets Scaffolds Average Seq Length
728 215 1454 74

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100224475|Ga0070706_1002244752
Length 72
Sequence MNGWPALDRFLQTDPRDVGCAEAMEMLHVYVDVVAADDAEERYPGIAAHLRARGPCGEDFEALLAVVRDAAG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
67 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
68 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
69 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
70 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
126 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.08
Rhizosphere 92.99
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100224475 3300005467 Bacteria 1753
2 rootL2_10305074 3300003322 Bacteria 1830
3 Ga0070683_100651670 3300005329 Bacteria 1008
4 Ga0070683_101627384 3300005329 Bacteria 621
5 Ga0068869_100522917 3300005334 Bacteria 993
6 Ga0070682_100105719 3300005337 Bacteria 1867
7 Ga0070682_100196869 3300005337 Bacteria 1419
8 Ga0068868_100688428 3300005338 Bacteria 914
9 Ga0070660_100187053 3300005339 Bacteria 1677
10 Ga0070691_10115977 3300005341 Bacteria 1344
11 Ga0070691_10140032 3300005341 Bacteria 1232
12 Ga0070691_10189615 3300005341 Bacteria 1075
13 Ga0070692_10813421 3300005345 Unclassified 639
14 Ga0070673_102175308 3300005364 Bacteria 527
15 Ga0070709_10001308 3300005434 Bacteria 13567
16 Ga0070709_10003483 3300005434 Bacteria 8451
17 Ga0070709_10015591 3300005434 Bacteria 4327
18 Ga0070709_10021601 3300005434 Bacteria 3751
19 Ga0070709_10050627 3300005434 Bacteria 2603
20 Ga0070709_10054202 3300005434 Bacteria 2527
21 Ga0070709_10235159 3300005434 Bacteria 1313
22 Ga0070709_10295557 3300005434 Bacteria 1181
23 Ga0070709_10306891 3300005434 Bacteria 1160
24 Ga0070709_10530790 3300005434 Bacteria 898
25 Ga0070709_10700564 3300005434 Bacteria 788
26 Ga0070714_100002416 3300005435 Bacteria 13760
27 Ga0070714_100010534 3300005435 Bacteria 7312
28 Ga0070714_100014931 3300005435 Bacteria 6243
29 Ga0070714_100015351 3300005435 Bacteria 6163
30 Ga0070714_100018863 3300005435 Bacteria 5612
31 Ga0070714_100024450 3300005435 Bacteria 4975
32 Ga0070714_100055084 3300005435 Unclassified 3399
33 Ga0070714_100081569 3300005435 Bacteria 2816
34 Ga0070714_100092381 3300005435 Bacteria 2652
35 Ga0070714_100101329 3300005435 Bacteria 2537
36 Ga0070714_100122631 3300005435 Bacteria 2313
37 Ga0070714_100162364 3300005435 Bacteria 2022
38 Ga0070714_100255576 3300005435 Bacteria 1621
39 Ga0070714_100348375 3300005435 Bacteria 1391
40 Ga0070714_100359654 3300005435 Bacteria 1368
41 Ga0070714_100761351 3300005435 Bacteria 936
42 Ga0070714_102050545 3300005435 Unclassified 558
43 Ga0070713_100007135 3300005436 Bacteria 7814
44 Ga0070713_100010221 3300005436 Bacteria 6773
45 Ga0070713_100021615 3300005436 Bacteria 4953
46 Ga0070713_100045334 3300005436 Bacteria 3602
47 Ga0070713_100048300 3300005436 Bacteria 3503
48 Ga0070713_100067321 3300005436 Bacteria 3015
49 Ga0070713_100087968 3300005436 Bacteria 2665
50 Ga0070713_100089729 3300005436 Bacteria 2641
51 Ga0070713_100165751 3300005436 Bacteria 1976
52 Ga0070713_100191232 3300005436 Bacteria 1844
53 Ga0070713_100354735 3300005436 Bacteria 1361
54 Ga0070713_100535866 3300005436 Unclassified 1107
55 Ga0070710_10003477 3300005437 Bacteria 7461
56 Ga0070710_10005876 3300005437 Bacteria 5859
57 Ga0070710_10029188 3300005437 Bacteria 2957
58 Ga0070710_10030636 3300005437 Bacteria 2896
59 Ga0070710_10037532 3300005437 Bacteria 2656
60 Ga0070710_10041287 3300005437 Bacteria 2546
61 Ga0070710_10070782 3300005437 Bacteria 2009
62 Ga0070710_10073191 3300005437 Bacteria 1980
63 Ga0070710_10107521 3300005437 Bacteria 1671
64 Ga0070710_10142771 3300005437 Bacteria 1470
65 Ga0070710_10270689 3300005437 Bacteria 1098
66 Ga0070710_10428193 3300005437 Bacteria 892
67 Ga0070710_10884206 3300005437 Bacteria 644
68 Ga0070701_10379252 3300005438 Unclassified 891
69 Ga0070701_10955806 3300005438 Bacteria 595
70 Ga0070711_100005045 3300005439 Bacteria 7857
71 Ga0070711_100005175 3300005439 Bacteria 7779
72 Ga0070711_100006549 3300005439 Bacteria 7026
73 Ga0070711_100022890 3300005439 Bacteria 4056
74 Ga0070711_100036378 3300005439 Bacteria 3298
75 Ga0070711_100038980 3300005439 Bacteria 3197
76 Ga0070711_100066239 3300005439 Bacteria 2529
77 Ga0070711_100138501 3300005439 Unclassified 1822
78 Ga0070711_100254335 3300005439 Bacteria 1379
79 Ga0070711_100326532 3300005439 Bacteria 1227
80 Ga0070711_100497721 3300005439 Unclassified 1004
81 Ga0070711_101371091 3300005439 Bacteria 615
82 Ga0070705_100866827 3300005440 Bacteria 724
83 Ga0070708_100013515 3300005445 Bacteria 6688
84 Ga0070708_100022543 3300005445 Bacteria 5341
85 Ga0070708_100268514 3300005445 Unclassified 1604
86 Ga0070708_100423588 3300005445 Bacteria 1255
87 Ga0070708_100503323 3300005445 Bacteria 1143
88 Ga0070708_100624698 3300005445 Unclassified 1015
89 Ga0070708_100744047 3300005445 Bacteria 922
90 Ga0070708_100924591 3300005445 Bacteria 819
91 Ga0070708_101257853 3300005445 Unclassified 692
92 Ga0070708_101566692 3300005445 Unclassified 613
93 Ga0070663_100044264 3300005455 Bacteria 3137
94 Ga0070678_100050890 3300005456 Bacteria 2999
95 Ga0070681_10015898 3300005458 Bacteria 7503
96 Ga0070681_10789854 3300005458 Bacteria 866
97 Ga0070681_11047629 3300005458 Bacteria 736
98 Ga0070706_100003320 3300005467 Bacteria 15886
99 Ga0070706_100005175 3300005467 Bacteria 12446
100 Ga0070706_100005271 3300005467 Bacteria 12333
101 Ga0070706_100028773 3300005467 Bacteria 5118
102 Ga0070706_100029849 3300005467 Bacteria 5022
103 Ga0070706_100042633 3300005467 Bacteria 4193
104 Ga0070706_100084077 3300005467 Unclassified 2949
105 Ga0070706_100090637 3300005467 Bacteria 2835
106 Ga0070706_100116203 3300005467 Bacteria 2492
107 Ga0070706_100475390 3300005467 Bacteria 1163
108 Ga0070707_100000797 3300005468 Bacteria 31116
109 Ga0070707_100006125 3300005468 Bacteria 11207
110 Ga0070707_100022798 3300005468 Bacteria 5920
111 Ga0070707_100097494 3300005468 Bacteria 2847
112 Ga0070707_100111888 3300005468 Bacteria 2648
113 Ga0070707_100140166 3300005468 Unclassified 2353
114 Ga0070707_100178302 3300005468 Bacteria 2071
115 Ga0070707_100228080 3300005468 Bacteria 1814
116 Ga0070707_100380356 3300005468 Unclassified 1371
117 Ga0070707_100397359 3300005468 Bacteria 1338
118 Ga0070707_100410371 3300005468 Unclassified 1315
119 Ga0070707_100549939 3300005468 Bacteria 1117
120 Ga0070707_100565975 3300005468 Bacteria 1098
121 Ga0070707_100609064 3300005468 Bacteria 1055
122 Ga0070707_100673666 3300005468 Bacteria 997
123 Ga0070707_100937208 3300005468 Bacteria 831
124 Ga0070698_100002141 3300005471 Bacteria 21908
125 Ga0070698_100004780 3300005471 Bacteria 14870
126 Ga0070698_100010564 3300005471 Bacteria 9840
127 Ga0070698_100012138 3300005471 Bacteria 9128
128 Ga0070698_100033781 3300005471 Bacteria 5298
129 Ga0070698_100040557 3300005471 Bacteria 4784
130 Ga0070698_100047243 3300005471 Bacteria 4401
131 Ga0070698_100149337 3300005471 Bacteria 2285
132 Ga0070698_100155462 3300005471 Bacteria 2232
133 Ga0070698_100201431 3300005471 Bacteria 1926
134 Ga0070698_100515738 3300005471 Bacteria 1134
135 Ga0070698_100946688 3300005471 Unclassified 807
136 Ga0070698_101470320 3300005471 Unclassified 632
137 Ga0070699_100033186 3300005518 Bacteria 4459
138 Ga0070699_100128806 3300005518 Bacteria 2230
139 Ga0070699_100609752 3300005518 Bacteria 995
140 Ga0070699_100900221 3300005518 Bacteria 810
141 Ga0070699_101227758 3300005518 Bacteria 688
142 Ga0070699_101529913 3300005518 Bacteria 611
143 Ga0070684_100049430 3300005535 Bacteria 3650
144 Ga0070684_100449151 3300005535 Bacteria 1191
145 Ga0070684_100667029 3300005535 Bacteria 969
146 Ga0070684_100900284 3300005535 Unclassified 829
147 Ga0070697_100011162 3300005536 Bacteria 7021
148 Ga0070697_100405281 3300005536 Bacteria 1184
149 Ga0070697_100416047 3300005536 Bacteria 1168
150 Ga0070697_100937791 3300005536 Bacteria 768
151 Ga0070697_101299165 3300005536 Bacteria 649
152 Ga0070697_102024171 3300005536 Bacteria 515
153 Ga0070695_100287138 3300005545 Bacteria 1211
154 Ga0070693_100640677 3300005547 Bacteria 772
155 Ga0070665_100576890 3300005548 Bacteria 1138
156 Ga0070665_100801748 3300005548 Bacteria 955
157 Ga0070704_100619080 3300005549 Bacteria 953
158 Ga0070704_101767270 3300005549 Bacteria 572
159 Ga0068855_100743722 3300005563 Bacteria 1046
160 Ga0068855_100891532 3300005563 Bacteria 940
161 Ga0068855_101831287 3300005563 Bacteria 616
162 Ga0070664_100239999 3300005564 Bacteria 1627
163 Ga0068857_101152233 3300005577 Bacteria 750
164 Ga0068856_100036279 3300005614 Bacteria 4834
165 Ga0068856_100263710 3300005614 Bacteria 1738
166 Ga0068856_101783639 3300005614 Bacteria 627
167 Ga0068856_102500895 3300005614 Unclassified 523
168 Ga0070702_100350688 3300005615 Bacteria 1039
169 Ga0070702_101366685 3300005615 Bacteria 578
170 Ga0068852_100198567 3300005616 Bacteria 1897
171 Ga0068852_100597213 3300005616 Bacteria 1108
172 Ga0068864_100131737 3300005618 Unclassified 2247
173 Ga0068864_100400784 3300005618 Bacteria 1304
174 Ga0068870_10330373 3300005840 Bacteria 972
175 Ga0068863_101044302 3300005841 Bacteria 821
176 Ga0068858_100143200 3300005842 Bacteria 2245
177 Ga0068858_100251579 3300005842 Bacteria 1678
178 Ga0068858_102291744 3300005842 Bacteria 534
179 Ga0068860_101187183 3300005843 Bacteria 783
180 Ga0068860_101649572 3300005843 Bacteria 663
181 Ga0068862_101652562 3300005844 Bacteria 648
182 Ga0070717_10024071 3300006028 Bacteria 4832
183 Ga0070717_10024515 3300006028 Bacteria 4791
184 Ga0070717_10030886 3300006028 Bacteria 4305
185 Ga0070717_10037778 3300006028 Bacteria 3922
186 Ga0070717_10041100 3300006028 Bacteria 3769
187 Ga0070717_10046328 3300006028 Bacteria 3558
188 Ga0070717_10058261 3300006028 Bacteria 3194
189 Ga0070717_10080188 3300006028 Bacteria 2738
190 Ga0070717_10094715 3300006028 Bacteria 2526
191 Ga0070717_10132880 3300006028 Unclassified 2141
192 Ga0070717_10135646 3300006028 Bacteria 2119
193 Ga0070717_10136534 3300006028 Unclassified 2112
194 Ga0070717_10136672 3300006028 Bacteria 2111
195 Ga0070717_10183029 3300006028 Bacteria 1827
196 Ga0070717_10200511 3300006028 Bacteria 1748
197 Ga0070717_10298579 3300006028 Bacteria 1432
198 Ga0070717_10305994 3300006028 Bacteria 1413
199 Ga0070717_10427064 3300006028 Bacteria 1192
200 Ga0070717_10453118 3300006028 Bacteria 1156
201 Ga0070717_10460736 3300006028 Unclassified 1146
202 Ga0070717_11239383 3300006028 Bacteria 679
203 Ga0070717_11534769 3300006028 Bacteria 604
204 Ga0070717_11782383 3300006028 Bacteria 556
205 Ga0070717_11805235 3300006028 Bacteria 553
206 Ga0070715_10015935 3300006163 Bacteria 2813
207 Ga0070715_10022407 3300006163 Bacteria 2463
208 Ga0070715_10044870 3300006163 Bacteria 1871
209 Ga0070715_10050091 3300006163 Unclassified 1792
210 Ga0070715_10057420 3300006163 Bacteria 1696
211 Ga0070715_10121240 3300006163 Unclassified 1247
212 Ga0070715_10297742 3300006163 Unclassified 862
213 Ga0070715_10395255 3300006163 Bacteria 767
214 Ga0070715_10564853 3300006163 Bacteria 662
215 Ga0070716_100000694 3300006173 Bacteria 14314
216 Ga0070716_100004040 3300006173 Bacteria 6963
217 Ga0070716_100005449 3300006173 Bacteria 6166
218 Ga0070716_100013700 3300006173 Bacteria 4137
219 Ga0070716_100015264 3300006173 Bacteria 3943
220 Ga0070716_100030257 3300006173 Bacteria 2935
221 Ga0070716_100141103 3300006173 Bacteria 1536
222 Ga0070716_100635422 3300006173 Bacteria 807
223 Ga0070716_100952241 3300006173 Bacteria 676
224 Ga0070716_101622463 3300006173 Bacteria 532
225 Ga0070712_100003183 3300006175 Bacteria 10111
226 Ga0070712_100005797 3300006175 Bacteria 7634
227 Ga0070712_100008271 3300006175 Bacteria 6536
228 Ga0070712_100023338 3300006175 Bacteria 4085
229 Ga0070712_100026140 3300006175 Bacteria 3885
230 Ga0070712_100048233 3300006175 Unclassified 2951
231 Ga0070712_100053480 3300006175 Bacteria 2819
232 Ga0070712_100063030 3300006175 Bacteria 2623
233 Ga0070712_100111243 3300006175 Bacteria 2044
234 Ga0070712_100153160 3300006175 Bacteria 1772
235 Ga0070712_100164729 3300006175 Bacteria 1715
236 Ga0070712_100367465 3300006175 Bacteria 1181
237 Ga0070712_100453253 3300006175 Bacteria 1068
238 Ga0070712_100475344 3300006175 Unclassified 1044
239 Ga0070712_100716785 3300006175 Unclassified 854
240 Ga0070712_101463291 3300006175 Bacteria 597
241 Ga0070712_101723188 3300006175 Bacteria 548
242 Ga0070712_102053883 3300006175 Bacteria 500
243 Ga0097621_100108529 3300006237 Bacteria 2343
244 Ga0068871_100195071 3300006358 Bacteria 1746
245 Ga0068871_100281941 3300006358 Bacteria 1454
246 Ga0068871_101000710 3300006358 Bacteria 778
247 Ga0075433_10257481 3300006852 Bacteria 1548
248 Ga0075433_10604307 3300006852 Bacteria 963
249 Ga0075433_11680922 3300006852 Bacteria 547
250 Ga0075433_11833321 3300006852 Bacteria 521
251 Ga0075434_100022313 3300006871 Bacteria 6166
252 Ga0075434_100039011 3300006871 Bacteria 4706
253 Ga0075434_100039042 3300006871 Bacteria 4704
254 Ga0075434_100440565 3300006871 Bacteria 1324
255 Ga0075434_100959103 3300006871 Bacteria 869
256 Ga0075434_101575299 3300006871 Unclassified 666
257 Ga0075434_101593884 3300006871 Unclassified 661
258 Ga0075436_100015540 3300006914 Bacteria 5210
259 Ga0075436_100076137 3300006914 Bacteria 2323
260 Ga0075436_100222884 3300006914 Bacteria 1338
261 Ga0075436_100236065 3300006914 Bacteria 1299
262 Ga0075436_100334840 3300006914 Unclassified 1089
263 Ga0075436_100399630 3300006914 Bacteria 995
264 Ga0075435_100006435 3300007076 Bacteria 8305
265 Ga0075435_100209433 3300007076 Bacteria 1653
266 Ga0075435_100228314 3300007076 Bacteria 1581
267 Ga0075435_100402173 3300007076 Bacteria 1178
268 Ga0075435_100421514 3300007076 Bacteria 1149
269 Ga0075435_100729146 3300007076 Bacteria 862
270 Ga0075435_100819456 3300007076 Bacteria 810
271 Ga0075435_101838012 3300007076 Bacteria 532
272 Ga0099794_10079302 3300007265 Bacteria 1617
273 Ga0099794_10581927 3300007265 Bacteria 592
274 Ga0099795_10067739 3300007788 Bacteria 1340
275 Ga0105240_10629598 3300009093 Bacteria 1178
276 Ga0105245_10095249 3300009098 Bacteria 2746
277 Ga0105245_10144557 3300009098 Bacteria 2243
278 Ga0105247_10223359 3300009101 Bacteria 1276
279 Ga0105247_10530292 3300009101 Bacteria 863
280 Ga0114129_10326423 3300009147 Bacteria 2039
281 Ga0114129_11056395 3300009147 Bacteria 1019
282 Ga0114129_12058423 3300009147 Bacteria 689
283 Ga0105243_11532317 3300009148 Bacteria 691
284 Ga0105243_12452967 3300009148 Bacteria 560
285 Ga0105241_10340812 3300009174 Bacteria 1299
286 Ga0105241_12237929 3300009174 Bacteria 543
287 Ga0105248_10456512 3300009177 Bacteria 1440
288 Ga0105248_11193810 3300009177 Bacteria 860
289 Ga0105238_10624498 3300009551 Bacteria 1086
290 Ga0105238_11229876 3300009551 Bacteria 774
291 Ga0105249_11189127 3300009553 Bacteria 833
292 Ga0105239_10293074 3300010375 Bacteria 1832
293 Ga0105239_11420309 3300010375 Bacteria 801
294 Ga0105239_11851395 3300010375 Bacteria 700
295 Ga0105246_11296989 3300011119 Bacteria 675
296 Ga0157344_1033162 3300012476 Unclassified 505
297 Ga0157320_1011162 3300012481 Bacteria 704
298 Ga0157341_1015272 3300012494 Bacteria 705
299 Ga0157341_1032182 3300012494 Bacteria 572
300 Ga0157314_1010984 3300012500 Unclassified 792
301 Ga0157338_1024247 3300012515 Bacteria 730
302 Ga0157370_10125863 3300013104 Bacteria 2392
303 Ga0157370_10184963 3300013104 Bacteria 1935
304 Ga0157370_10390236 3300013104 Bacteria 1282
305 Ga0157369_10303618 3300013105 Bacteria 1660
306 Ga0157369_10459719 3300013105 Bacteria 1318
307 Ga0157369_10953896 3300013105 Bacteria 879
308 Ga0157369_11314684 3300013105 Bacteria 737
309 Ga0157374_10030142 3300013296 Bacteria 4922
310 Ga0157374_10397861 3300013296 Bacteria 1374
311 Ga0157378_11605728 3300013297 Bacteria 696
312 Ga0163162_10088995 3300013306 Unclassified 3167
313 Ga0157372_10383230 3300013307 Bacteria 1638
314 Ga0157372_10574139 3300013307 Bacteria 1314
315 Ga0157372_10894406 3300013307 Bacteria 1030
316 Ga0157372_11420603 3300013307 Bacteria 800
317 Ga0157375_10069903 3300013308 Bacteria 3519
318 Ga0157375_12748022 3300013308 Bacteria 588
319 Ga0163163_10255044 3300014325 Unclassified 1805
320 Ga0163163_10402701 3300014325 Bacteria 1427
321 Ga0163163_10769479 3300014325 Bacteria 1026
322 Ga0163163_12252514 3300014325 Unclassified 604
323 Ga0157377_10590726 3300014745 Bacteria 790
324 Ga0157379_10423671 3300014968 Bacteria 1226
325 Ga0157379_10659122 3300014968 Bacteria 980
326 Ga0157376_11460070 3300014969 Bacteria 716
327 Ga0157376_11834416 3300014969 Bacteria 643
328 Ga0197907_10612842 3300020069 Bacteria 994
329 Ga0206353_10564429 3300020082 Bacteria 6651
330 Ga0213874_10409977 3300021377 Bacteria 529
331 Ga0213876_10077074 3300021384 Unclassified 1761
332 Ga0213875_10085630 3300021388 Bacteria 1470
333 Ga0224712_10026104 3300022467 Bacteria 2061
334 Ga0224712_10153157 3300022467 Bacteria 1023
335 Ga0207692_10001407 3300025898 Bacteria 9007
336 Ga0207692_10002870 3300025898 Bacteria 6668
337 Ga0207692_10008289 3300025898 Bacteria 4299
338 Ga0207692_10020297 3300025898 Bacteria 3019
339 Ga0207692_10030109 3300025898 Bacteria 2585
340 Ga0207692_10034353 3300025898 Bacteria 2454
341 Ga0207692_10083229 3300025898 Bacteria 1716
342 Ga0207692_10103551 3300025898 Bacteria 1567
343 Ga0207692_10278374 3300025898 Bacteria 1011
344 Ga0207692_10347535 3300025898 Bacteria 913
345 Ga0207692_10553196 3300025898 Bacteria 735
346 Ga0207680_10209813 3300025903 Bacteria 1331
347 Ga0207685_10010901 3300025905 Bacteria 2708
348 Ga0207685_10017524 3300025905 Bacteria 2318
349 Ga0207685_10018221 3300025905 Bacteria 2287
350 Ga0207685_10286256 3300025905 Bacteria 810
351 Ga0207699_10000928 3300025906 Bacteria 13978
352 Ga0207699_10002023 3300025906 Bacteria 9573
353 Ga0207699_10007157 3300025906 Bacteria 5443
354 Ga0207699_10013512 3300025906 Bacteria 4182
355 Ga0207699_10013828 3300025906 Bacteria 4143
356 Ga0207699_10028070 3300025906 Bacteria 3123
357 Ga0207699_10041747 3300025906 Bacteria 2652
358 Ga0207699_10108535 3300025906 Bacteria 1775
359 Ga0207699_10120869 3300025906 Bacteria 1694
360 Ga0207699_10187727 3300025906 Bacteria 1393
361 Ga0207699_10198425 3300025906 Bacteria 1358
362 Ga0207699_10213824 3300025906 Bacteria 1313
363 Ga0207699_10476121 3300025906 Bacteria 899
364 Ga0207699_11429912 3300025906 Unclassified 511
365 Ga0207643_10420345 3300025908 Bacteria 847
366 Ga0207684_10001685 3300025910 Bacteria 23498
367 Ga0207684_10001702 3300025910 Bacteria 23359
368 Ga0207684_10004499 3300025910 Bacteria 13107
369 Ga0207684_10025235 3300025910 Bacteria 5067
370 Ga0207684_10029856 3300025910 Bacteria 4642
371 Ga0207684_10034535 3300025910 Bacteria 4296
372 Ga0207684_10041417 3300025910 Bacteria 3906
373 Ga0207684_10084930 3300025910 Bacteria 2696
374 Ga0207684_10189293 3300025910 Bacteria 1775
375 Ga0207684_10547693 3300025910 Bacteria 990
376 Ga0207684_10575407 3300025910 Bacteria 963
377 Ga0207654_10073711 3300025911 Bacteria 2035
378 Ga0207654_11373643 3300025911 Unclassified 515
379 Ga0207707_10008466 3300025912 Bacteria 8918
380 Ga0207707_10436886 3300025912 Bacteria 1121
381 Ga0207695_10801051 3300025913 Bacteria 822
382 Ga0207693_10014220 3300025915 Bacteria 6403
383 Ga0207693_10015006 3300025915 Bacteria 6219
384 Ga0207693_10015797 3300025915 Bacteria 6048
385 Ga0207693_10029162 3300025915 Bacteria 4361
386 Ga0207693_10032341 3300025915 Bacteria 4129
387 Ga0207693_10040085 3300025915 Bacteria 3688
388 Ga0207693_10041514 3300025915 Bacteria 3621
389 Ga0207693_10073175 3300025915 Bacteria 2683
390 Ga0207693_10088196 3300025915 Bacteria 2431
391 Ga0207693_10093673 3300025915 Unclassified 2355
392 Ga0207693_10233908 3300025915 Bacteria 1443
393 Ga0207693_10377319 3300025915 Unclassified 1109
394 Ga0207693_10380673 3300025915 Bacteria 1104
395 Ga0207693_10430188 3300025915 Bacteria 1032
396 Ga0207693_10493597 3300025915 Unclassified 956
397 Ga0207693_10754889 3300025915 Unclassified 751
398 Ga0207663_10004140 3300025916 Bacteria 7181
399 Ga0207663_10015297 3300025916 Bacteria 4231
400 Ga0207663_10050608 3300025916 Bacteria 2582
401 Ga0207663_10062245 3300025916 Bacteria 2371
402 Ga0207663_10113792 3300025916 Bacteria 1840
403 Ga0207663_10204981 3300025916 Bacteria 1425
404 Ga0207663_10232675 3300025916 Bacteria 1347
405 Ga0207663_10255280 3300025916 Bacteria 1292
406 Ga0207663_10258768 3300025916 Bacteria 1284
407 Ga0207663_10324920 3300025916 Bacteria 1157
408 Ga0207663_10393133 3300025916 Bacteria 1059
409 Ga0207663_10657598 3300025916 Unclassified 827
410 Ga0207663_10700248 3300025916 Bacteria 802
411 Ga0207663_11103197 3300025916 Bacteria 638
412 Ga0207663_11229527 3300025916 Bacteria 603
413 Ga0207663_11299686 3300025916 Bacteria 586
414 Ga0207660_10042667 3300025917 Bacteria 3185
415 Ga0207660_10832626 3300025917 Bacteria 753
416 Ga0207657_10032857 3300025919 Bacteria 4683
417 Ga0207652_10060617 3300025921 Bacteria 3264
418 Ga0207646_10000388 3300025922 Bacteria 59041
419 Ga0207646_10005932 3300025922 Bacteria 12743
420 Ga0207646_10006751 3300025922 Bacteria 11814
421 Ga0207646_10021660 3300025922 Bacteria 5934
422 Ga0207646_10084045 3300025922 Bacteria 2848
423 Ga0207646_10120081 3300025922 Unclassified 2361
424 Ga0207646_10130429 3300025922 Bacteria 2262
425 Ga0207646_10148676 3300025922 Bacteria 2112
426 Ga0207646_10211850 3300025922 Bacteria 1750
427 Ga0207646_10212331 3300025922 Bacteria 1748
428 Ga0207646_10252457 3300025922 Bacteria 1593
429 Ga0207646_10282765 3300025922 Unclassified 1499
430 Ga0207646_10531677 3300025922 Bacteria 1058
431 Ga0207646_10549629 3300025922 Unclassified 1038
432 Ga0207646_10632002 3300025922 Bacteria 960
433 Ga0207646_10822954 3300025922 Bacteria 826
434 Ga0207694_10617884 3300025924 Bacteria 912
435 Ga0207694_11296928 3300025924 Bacteria 616
436 Ga0207687_10433913 3300025927 Bacteria 1087
437 Ga0207700_10000639 3300025928 Bacteria 20435
438 Ga0207700_10003143 3300025928 Bacteria 9530
439 Ga0207700_10006088 3300025928 Bacteria 7269
440 Ga0207700_10011095 3300025928 Bacteria 5730
441 Ga0207700_10068449 3300025928 Bacteria 2721
442 Ga0207700_10111828 3300025928 Bacteria 2199
443 Ga0207700_10128220 3300025928 Bacteria 2067
444 Ga0207700_10156818 3300025928 Bacteria 1887
445 Ga0207700_10235459 3300025928 Bacteria 1559
446 Ga0207700_10253002 3300025928 Bacteria 1506
447 Ga0207700_10273916 3300025928 Bacteria 1449
448 Ga0207700_10276000 3300025928 Bacteria 1444
449 Ga0207700_10295509 3300025928 Bacteria 1397
450 Ga0207700_10554569 3300025928 Unclassified 1020
451 Ga0207700_10580877 3300025928 Bacteria 996
452 Ga0207700_11011856 3300025928 Unclassified 744
453 Ga0207700_11471394 3300025928 Unclassified 605
454 Ga0207700_11490604 3300025928 Bacteria 600
455 Ga0207664_10000755 3300025929 Bacteria 21979
456 Ga0207664_10001740 3300025929 Bacteria 14336
457 Ga0207664_10001947 3300025929 Bacteria 13584
458 Ga0207664_10007688 3300025929 Bacteria 7482
459 Ga0207664_10013423 3300025929 Bacteria 5880
460 Ga0207664_10027081 3300025929 Bacteria 4341
461 Ga0207664_10040610 3300025929 Bacteria 3619
462 Ga0207664_10067660 3300025929 Bacteria 2867
463 Ga0207664_10093657 3300025929 Bacteria 2468
464 Ga0207664_10104808 3300025929 Bacteria 2342
465 Ga0207664_10133000 3300025929 Bacteria 2096
466 Ga0207664_10201902 3300025929 Bacteria 1717
467 Ga0207664_10207590 3300025929 Bacteria 1693
468 Ga0207664_10251584 3300025929 Bacteria 1542
469 Ga0207664_10366421 3300025929 Bacteria 1277
470 Ga0207664_10393786 3300025929 Bacteria 1231
471 Ga0207664_10471700 3300025929 Bacteria 1122
472 Ga0207664_11727081 3300025929 Bacteria 548
473 Ga0207664_11765407 3300025929 Bacteria 541
474 Ga0207644_10069766 3300025931 Bacteria 2567
475 Ga0207709_11114864 3300025935 Bacteria 648
476 Ga0207665_10001497 3300025939 Bacteria 15699
477 Ga0207665_10005955 3300025939 Bacteria 8113
478 Ga0207665_10018822 3300025939 Bacteria 4539
479 Ga0207665_10025379 3300025939 Bacteria 3910
480 Ga0207665_10043450 3300025939 Bacteria 3005
481 Ga0207665_10045581 3300025939 Bacteria 2936
482 Ga0207665_10411242 3300025939 Bacteria 1032
483 Ga0207665_10996226 3300025939 Bacteria 666
484 Ga0207665_11514473 3300025939 Bacteria 533
485 Ga0207711_10546912 3300025941 Bacteria 1080
486 Ga0207711_11432534 3300025941 Bacteria 633
487 Ga0207679_10097120 3300025945 Bacteria 2294
488 Ga0207679_10295778 3300025945 Bacteria 1393
489 Ga0207679_10938685 3300025945 Bacteria 792
490 Ga0207667_11029369 3300025949 Bacteria 809
491 Ga0207667_11465209 3300025949 Bacteria 655
492 Ga0207651_10228910 3300025960 Bacteria 1508
493 Ga0207712_11283500 3300025961 Bacteria 654
494 Ga0207677_10131061 3300026023 Bacteria 1904
495 Ga0207703_10152226 3300026035 Bacteria 2018
496 Ga0207703_10380300 3300026035 Bacteria 1306
497 Ga0207678_10065504 3300026067 Bacteria 3120
498 Ga0207702_10180748 3300026078 Bacteria 1942
499 Ga0207702_11346098 3300026078 Bacteria 708
500 Ga0207641_10263562 3300026088 Bacteria 1615
501 Ga0207641_10754113 3300026088 Bacteria 961
502 Ga0207676_10213180 3300026095 Bacteria 1715
503 Ga0207676_10387405 3300026095 Bacteria 1303
504 Ga0207683_10098341 3300026121 Bacteria 2611
505 Ga0207698_10062458 3300026142 Bacteria 2909
506 Ga0207698_10278669 3300026142 Bacteria 1545
507 Ga0268266_10372981 3300028379 Bacteria 1344
508 Ga0268266_10477409 3300028379 Bacteria 1188
509 Ga0268266_11782563 3300028379 Bacteria 590
510 Ga0268264_11914188 3300028381 Bacteria 603
511 Ga0268264_12528743 3300028381 Unclassified 518
512 Ga0316214_1005907 3300033545 Bacteria 1611
513 Ga0373959_0148815 3300034820 Bacteria 591
514 Ga0373938_0160293 3300034957 Unclassified 604
515 Ga0373926_0000048 3300035083 Bacteria 20173
516 Ga0373940_0073958 3300035088 Bacteria 997
517 Ga0373944_0002393 3300035089 Bacteria 4776
518 Ga0373951_0205782 3300035091 Unclassified 575
519 Ga0373923_0064851 3300035111 Bacteria 1558
520 Ga0373923_0351326 3300035111 Bacteria 704
521 Ga0373923_0530161 3300035111 Bacteria 576
522 Ga0373923_0639815 3300035111 Unclassified 525
523 Ga0373936_0001179 3300035113 Bacteria 9392
524 Ga0373936_0244887 3300035113 Bacteria 800
525 Ga0373936_0408940 3300035113 Bacteria 624
526 Ga0373945_0000342 3300035116 Bacteria 13322
527 Ga0373945_0233176 3300035116 Bacteria 773
528 Ga0373954_0187793 3300035118 Bacteria 1014
529 Ga0373954_0644885 3300035118 Unclassified 525
530 Ga0373956_0209081 3300035119 Bacteria 925
531 Ga0373943_0000151 3300035170 Bacteria 26911
532 Ga0373943_0309707 3300035170 Bacteria 898
533 Ga0373943_0471866 3300035170 Bacteria 731
534 Ga0373943_0502560 3300035170 Bacteria 708
535 Ga0373943_0522155 3300035170 Bacteria 695
536 Ga0373946_0000178 3300035171 Bacteria 19473
537 Ga0373946_0016887 3300035171 Bacteria 2787
538 Ga0373946_0133526 3300035171 Bacteria 1144
539 Ga0373955_0054966 3300035172 Bacteria 2179
540 Ga0373924_0522214 3300035410 Unclassified 534
541 Ga0373931_0189873 3300035691 Bacteria 1222
542 Ga0373931_0800183 3300035691 Bacteria 628
543 Ga0373935_0000566 3300035692 Bacteria 19296
544 Ga0373935_0029563 3300035692 Bacteria 3392
545 Ga0373935_0184978 3300035692 Bacteria 1432
546 Ga0373935_0280086 3300035692 Bacteria 1174
547 Ga0373935_0357560 3300035692 Bacteria 1042
548 Ga0373935_0429948 3300035692 Bacteria 951
549 Ga0373927_0001004 3300035695 Bacteria 21497
550 Ga0373927_0064583 3300035695 Bacteria 2368
551 Ga0373933_0015780 3300035724 Bacteria 4214
552 Ga0373947_0000240 3300035725 Bacteria 30951
553 Ga0373947_0174483 3300035725 Bacteria 1396
554 Ga0373947_0332047 3300035725 Bacteria 1018
555 Ga0373947_1034014 3300035725 Bacteria 560
556 Ga0373937_0233864 3300036401 Bacteria 1731
557 Ga0373937_0394230 3300036401 Bacteria 1313
558 Ga0373937_0597911 3300036401 Bacteria 1047
559 Ga0373937_0830069 3300036401 Unclassified 872
560 Ga0373925_0000231 3300037068 Bacteria 59007
561 Ga0373925_0001977 3300037068 Bacteria 16977
562 Ga0373925_0047108 3300037068 Bacteria 3208
563 Ga0373925_0049194 3300037068 Bacteria 3142
564 Ga0373925_0181969 3300037068 Bacteria 1664
565 Ga0373925_0594137 3300037068 Bacteria 911
566 Ga0373925_0722971 3300037068 Bacteria 821
567 Ga0373925_0756787 3300037068 Unclassified 801
568 Ga0436364_0517672 3300037853 Bacteria 667
569 Ga0436364_0775870 3300037853 Bacteria 3333
570 Ga0436365_0939288 3300039437 Bacteria 1568
571 Ga0436365_1360959 3300039437 Bacteria 677
572 Ga0436363_0037632 3300039450 Bacteria 959
573 Ga0436363_0120548 3300039450 Unclassified 2489
574 Ga0436363_0293201 3300039450 Bacteria 2726
575 Ga0436363_1544854 3300039450 Unclassified 3081
576 Ga0436362_0977051 3300039453 Unclassified 787
577 Ga0466963_0128170 3300044694 Bacteria 1751
578 Ga0466963_0137985 3300044694 Bacteria 1688
579 Ga0466964_0285779 3300044706 Bacteria 826
580 Ga0466968_0522468 3300044735 Bacteria 593
581 Ga0466957_0449456 3300044842 Bacteria 888
582 Ga0466958_0488874 3300045836 Bacteria 798
583 Ga0466967_0133300 3300045976 Bacteria 2308
584 Ga0466967_0650255 3300045976 Bacteria 1042
585 Ga0495592_0103559 3300046454 Bacteria 2025
586 Ga0495603_0558104 3300046455 Unclassified 656
587 Ga0495641_0022468 3300046461 Bacteria 3155
588 Ga0495641_0098156 3300046461 Bacteria 1307
589 Ga0495651_0036832 3300046462 Bacteria 3809
590 Ga0495653_0006648 3300046463 Bacteria 9488
591 Ga0495653_0115033 3300046463 Bacteria 1926
592 Ga0495582_0039674 3300046473 Bacteria 2592
593 Ga0495582_0220614 3300046473 Bacteria 1085
594 Ga0495639_0023699 3300046475 Bacteria 2699
595 Ga0495639_0525446 3300046475 Bacteria 605
596 Ga0495662_0022848 3300046476 Bacteria 3019
597 Ga0495662_0445524 3300046476 Bacteria 635
598 Ga0495664_0000340 3300046477 Bacteria 22606
599 Ga0495664_0218405 3300046477 Bacteria 1154
600 Ga0495608_0014557 3300046511 Bacteria 5457
601 Ga0495618_0085812 3300046514 Bacteria 2012
602 Ga0495618_0214979 3300046514 Bacteria 1214
603 Ga0495618_0296931 3300046514 Bacteria 1004
604 Ga0495618_0464748 3300046514 Bacteria 766
605 Ga0495628_0045435 3300046516 Bacteria 3492
606 Ga0495628_0229949 3300046516 Bacteria 1390
607 Ga0495630_0011356 3300046517 Bacteria 6447
608 Ga0495630_0136852 3300046517 Bacteria 1861
609 Ga0495630_1001060 3300046517 Bacteria 635
610 Ga0495652_0003039 3300046529 Bacteria 16815
611 Ga0495652_0250808 3300046529 Bacteria 1312
612 Ga0495665_0067578 3300046531 Bacteria 1885
613 Ga0495640_0755690 3300046533 Unclassified 581
614 Ga0495640_0823385 3300046533 Bacteria 552
615 Ga0495586_0723700 3300046535 Bacteria 574
616 Ga0495587_0052041 3300046536 Bacteria 2418
617 Ga0495587_0816117 3300046536 Unclassified 509
618 Ga0495645_0021875 3300046543 Bacteria 4625
619 Ga0495645_0046700 3300046543 Bacteria 3156
620 Ga0495645_0471436 3300046543 Bacteria 789
621 Ga0495645_0624589 3300046543 Unclassified 661
622 Ga0495667_0069065 3300046559 Bacteria 2306
623 Ga0495667_0195004 3300046559 Bacteria 1297
624 Ga0495667_0503009 3300046559 Bacteria 759
625 Ga0495634_0029616 3300046642 Bacteria 3789
626 Ga0495634_0411421 3300046642 Bacteria 802
627 Ga0495635_0000295 3300046663 Bacteria 32122
628 Ga0495635_0170889 3300046663 Bacteria 1478
629 Ga0495657_0023706 3300046675 Bacteria 4382
630 Ga0495599_0027896 3300046678 Bacteria 3537
631 Ga0495599_0891435 3300046678 Bacteria 504
632 Ga0495646_0025682 3300046680 Bacteria 3704
633 Ga0495613_0361051 3300046689 Unclassified 996
634 Ga0495624_0002299 3300046690 Bacteria 14548
635 Ga0495624_0604132 3300046690 Unclassified 654
636 Ga0495600_0245809 3300046809 Bacteria 1139
637 Ga0495581_0020096 3300047315 Bacteria 3877
638 Ga0495581_0798898 3300047315 Unclassified 541
639 Ga0495674_0001718 3300047319 Bacteria 21540
640 Ga0495674_0052849 3300047319 Bacteria 3573
641 Ga0495674_0244075 3300047319 Bacteria 1479
642 Ga0495674_0334224 3300047319 Bacteria 1232
643 Ga0495674_0526196 3300047319 Bacteria 943
644 Ga0495674_1358759 3300047319 Bacteria 531
645 Ga0495676_0010294 3300047321 Bacteria 8485
646 Ga0495676_0175359 3300047321 Bacteria 1506
647 Ga0495676_0353444 3300047321 Bacteria 982
648 Ga0495680_0021181 3300047322 Bacteria 5447
649 Ga0495680_0559502 3300047322 Bacteria 769
650 Ga0495684_0004475 3300047471 Bacteria 10918
651 Ga0495684_0342678 3300047471 Bacteria 1063
652 Ga0495684_0892320 3300047471 Bacteria 573
653 Ga0495593_0022357 3300047673 Bacteria 3524
654 Ga0495593_0593099 3300047673 Bacteria 556
655 Ga0496100_0235499 3300048903 Bacteria 1349
656 Ga0496101_0313999 3300048904 Bacteria 1229
657 Ga0496101_1533334 3300048904 Unclassified 518
658 Ga0496102_0219406 3300048905 Bacteria 1792
659 Ga0496102_0254574 3300048905 Bacteria 1655
660 Ga0496102_0798304 3300048905 Bacteria 866
661 Ga0496102_1472102 3300048905 Unclassified 600
662 Ga0496103_0748766 3300048906 Bacteria 618
663 Ga0496104_0021227 3300048907 Bacteria 5958
664 Ga0496104_0299043 3300048907 Bacteria 1521
665 Ga0496104_1060762 3300048907 Bacteria 714
666 Ga0496105_0044368 3300048908 Bacteria 3667
667 Ga0496105_0360254 3300048908 Bacteria 1160
668 Ga0496105_1251374 3300048908 Bacteria 544
669 Ga0496106_0332847 3300048909 Bacteria 1219
670 Ga0496106_0847571 3300048909 Bacteria 723
671 Ga0496107_0419323 3300048910 Bacteria 995
672 Ga0496108_0032610 3300048911 Bacteria 4327
673 Ga0496108_0135677 3300048911 Bacteria 2117
674 Ga0496108_0278796 3300048911 Bacteria 1455
675 Ga0496108_1237089 3300048911 Unclassified 630
676 Ga0496109_0045819 3300048912 Bacteria 3970
677 Ga0496109_0272316 3300048912 Bacteria 1595
678 Ga0496109_1152220 3300048912 Unclassified 712
679 Ga0496110_0132294 3300048913 Bacteria 2253
680 Ga0496110_1095994 3300048913 Bacteria 704
681 Ga0496110_1333731 3300048913 Unclassified 627
682 Ga0496111_0214965 3300048914 Bacteria 1428
683 Ga0496111_0292710 3300048914 Bacteria 1207
684 Ga0496111_0388231 3300048914 Bacteria 1032
685 Ga0496111_0968134 3300048914 Bacteria 611
686 Ga0496112_0030312 3300048915 Bacteria 5233
687 Ga0496112_0123873 3300048915 Bacteria 2556
688 Ga0496112_0603651 3300048915 Unclassified 1029
689 Ga0496112_1464487 3300048915 Bacteria 597
690 Ga0496113_0099423 3300048916 Bacteria 2253
691 Ga0496114_1639566 3300048917 Bacteria 531
692 Ga0496126_0957345 3300048929 Unclassified 645
693 nmdc:mga05p37_262839_c1 3300050507 Bacteria 2065
694 nmdc:mga05p37_813645_c1 3300050507 Bacteria 1020
695 nmdc:mga0n895_100553_c1 3300050512 Bacteria 2901
696 nmdc:mga0n895_14514_c1 3300050512 Bacteria 7158
697 nmdc:mga0n895_1566421_c1 3300050512 Unclassified 624
698 nmdc:mga0n895_1998452_c1 3300050512 Bacteria 538
699 nmdc:mga0n895_2040630_c1 3300050512 Bacteria 531
700 nmdc:mga0n895_69247_c1 3300050512 Bacteria 3496
701 nmdc:mga0n895_77874_c1 3300050512 Bacteria 3299
702 nmdc:mga0n895_779275_c1 3300050512 Bacteria 948
703 nmdc:mga0rr50_1012002_c1 3300050513 Bacteria 708
704 nmdc:mga0rr50_1485767_c1 3300050513 Bacteria 573
705 nmdc:mga0rr50_211041_c1 3300050513 Bacteria 1600
706 nmdc:mga0rr50_279090_c1 3300050513 Bacteria 1394
707 nmdc:mga0rr50_4561_c1 3300050513 Bacteria 8152
708 nmdc:mga0rr50_483185_c1 3300050513 Bacteria 1052
709 nmdc:mga0rr50_59662_c1 3300050513 Bacteria 2866
710 nmdc:mga08x19_1146649_c1 3300050514 Bacteria 551
711 nmdc:mga08x19_20837_c1 3300050514 Bacteria 4040
712 nmdc:mga08x19_23195_c1 3300050514 Bacteria 3849
713 nmdc:mga08x19_271385_c1 3300050514 Bacteria 1174
714 nmdc:mga08x19_280865_c1 3300050514 Bacteria 1154
715 nmdc:mga08x19_288534_c1 3300050514 Bacteria 1138
716 nmdc:mga08x19_547101_c1 3300050514 Bacteria 819
717 nmdc:mga0a205_22506_c1 3300050515 Bacteria 5971
718 nmdc:mga0a205_563662_c1 3300050515 Bacteria 994
719 nmdc:mga0a205_773785_c1 3300050515 Bacteria 808
720 Ga0495601_0072591 3300053077 Bacteria 2199
721 Ga0495601_0106981 3300053077 Bacteria 1809
722 Ga0495601_0211193 3300053077 Bacteria 1268
723 Ga0495601_1062835 3300053077 Bacteria 507
724 Ga0495612_0132703 3300053078 Bacteria 1077
725 Ga0495612_0211380 3300053078 Bacteria 857
726 Ga0495612_0264761 3300053078 Bacteria 766
727 Ga0495619_0777396 3300053085 Bacteria 648
728 Ga0070706_100224475
729 rootL2_10305074
730 Ga0070683_100651670
731 Ga0070683_101627384
732 Ga0068869_100522917
733 Ga0070682_100105719
734 Ga0070682_100196869
735 Ga0068868_100688428
736 Ga0070660_100187053
737 Ga0070691_10115977
738 Ga0070691_10140032
739 Ga0070691_10189615
740 Ga0070692_10813421
741 Ga0070673_102175308
742 Ga0070709_10001308
743 Ga0070709_10003483
744 Ga0070709_10015591
745 Ga0070709_10021601
746 Ga0070709_10050627
747 Ga0070709_10054202
748 Ga0070709_10235159
749 Ga0070709_10295557
750 Ga0070709_10306891
751 Ga0070709_10530790
752 Ga0070709_10700564
753 Ga0070714_100002416
754 Ga0070714_100010534
755 Ga0070714_100014931
756 Ga0070714_100015351
757 Ga0070714_100018863
758 Ga0070714_100024450
759 Ga0070714_100055084
760 Ga0070714_100081569
761 Ga0070714_100092381
762 Ga0070714_100101329
763 Ga0070714_100122631
764 Ga0070714_100162364
765 Ga0070714_100255576
766 Ga0070714_100348375
767 Ga0070714_100359654
768 Ga0070714_100761351
769 Ga0070714_102050545
770 Ga0070713_100007135
771 Ga0070713_100010221
772 Ga0070713_100021615
773 Ga0070713_100045334
774 Ga0070713_100048300
775 Ga0070713_100067321
776 Ga0070713_100087968
777 Ga0070713_100089729
778 Ga0070713_100165751
779 Ga0070713_100191232
780 Ga0070713_100354735
781 Ga0070713_100535866
782 Ga0070710_10003477
783 Ga0070710_10005876
784 Ga0070710_10029188
785 Ga0070710_10030636
786 Ga0070710_10037532
787 Ga0070710_10041287
788 Ga0070710_10070782
789 Ga0070710_10073191
790 Ga0070710_10107521
791 Ga0070710_10142771
792 Ga0070710_10270689
793 Ga0070710_10428193
794 Ga0070710_10884206
795 Ga0070701_10379252
796 Ga0070701_10955806
797 Ga0070711_100005045
798 Ga0070711_100005175
799 Ga0070711_100006549
800 Ga0070711_100022890
801 Ga0070711_100036378
802 Ga0070711_100038980
803 Ga0070711_100066239
804 Ga0070711_100138501
805 Ga0070711_100254335
806 Ga0070711_100326532
807 Ga0070711_100497721
808 Ga0070711_101371091
809 Ga0070705_100866827
810 Ga0070708_100013515
811 Ga0070708_100022543
812 Ga0070708_100268514
813 Ga0070708_100423588
814 Ga0070708_100503323
815 Ga0070708_100624698
816 Ga0070708_100744047
817 Ga0070708_100924591
818 Ga0070708_101257853
819 Ga0070708_101566692
820 Ga0070663_100044264
821 Ga0070678_100050890
822 Ga0070681_10015898
823 Ga0070681_10789854
824 Ga0070681_11047629
825 Ga0070706_100003320
826 Ga0070706_100005175
827 Ga0070706_100005271
828 Ga0070706_100028773
829 Ga0070706_100029849
830 Ga0070706_100042633
831 Ga0070706_100084077
832 Ga0070706_100090637
833 Ga0070706_100116203
834 Ga0070706_100475390
835 Ga0070707_100000797
836 Ga0070707_100006125
837 Ga0070707_100022798
838 Ga0070707_100097494
839 Ga0070707_100111888
840 Ga0070707_100140166
841 Ga0070707_100178302
842 Ga0070707_100228080
843 Ga0070707_100380356
844 Ga0070707_100397359
845 Ga0070707_100410371
846 Ga0070707_100549939
847 Ga0070707_100565975
848 Ga0070707_100609064
849 Ga0070707_100673666
850 Ga0070707_100937208
851 Ga0070698_100002141
852 Ga0070698_100004780
853 Ga0070698_100010564
854 Ga0070698_100012138
855 Ga0070698_100033781
856 Ga0070698_100040557
857 Ga0070698_100047243
858 Ga0070698_100149337
859 Ga0070698_100155462
860 Ga0070698_100201431
861 Ga0070698_100515738
862 Ga0070698_100946688
863 Ga0070698_101470320
864 Ga0070699_100033186
865 Ga0070699_100128806
866 Ga0070699_100609752
867 Ga0070699_100900221
868 Ga0070699_101227758
869 Ga0070699_101529913
870 Ga0070684_100049430
871 Ga0070684_100449151
872 Ga0070684_100667029
873 Ga0070684_100900284
874 Ga0070697_100011162
875 Ga0070697_100405281
876 Ga0070697_100416047
877 Ga0070697_100937791
878 Ga0070697_101299165
879 Ga0070697_102024171
880 Ga0070695_100287138
881 Ga0070693_100640677
882 Ga0070665_100576890
883 Ga0070665_100801748
884 Ga0070704_100619080
885 Ga0070704_101767270
886 Ga0068855_100743722
887 Ga0068855_100891532
888 Ga0068855_101831287
889 Ga0070664_100239999
890 Ga0068857_101152233
891 Ga0068856_100036279
892 Ga0068856_100263710
893 Ga0068856_101783639
894 Ga0068856_102500895
895 Ga0070702_100350688
896 Ga0070702_101366685
897 Ga0068852_100198567
898 Ga0068852_100597213
899 Ga0068864_100131737
900 Ga0068864_100400784
901 Ga0068870_10330373
902 Ga0068863_101044302
903 Ga0068858_100143200
904 Ga0068858_100251579
905 Ga0068858_102291744
906 Ga0068860_101187183
907 Ga0068860_101649572
908 Ga0068862_101652562
909 Ga0070717_10024071
910 Ga0070717_10024515
911 Ga0070717_10030886
912 Ga0070717_10037778
913 Ga0070717_10041100
914 Ga0070717_10046328
915 Ga0070717_10058261
916 Ga0070717_10080188
917 Ga0070717_10094715
918 Ga0070717_10132880
919 Ga0070717_10135646
920 Ga0070717_10136534
921 Ga0070717_10136672
922 Ga0070717_10183029
923 Ga0070717_10200511
924 Ga0070717_10298579
925 Ga0070717_10305994
926 Ga0070717_10427064
927 Ga0070717_10453118
928 Ga0070717_10460736
929 Ga0070717_11239383
930 Ga0070717_11534769
931 Ga0070717_11782383
932 Ga0070717_11805235
933 Ga0070715_10015935
934 Ga0070715_10022407
935 Ga0070715_10044870
936 Ga0070715_10050091
937 Ga0070715_10057420
938 Ga0070715_10121240
939 Ga0070715_10297742
940 Ga0070715_10395255
941 Ga0070715_10564853
942 Ga0070716_100000694
943 Ga0070716_100004040
944 Ga0070716_100005449
945 Ga0070716_100013700
946 Ga0070716_100015264
947 Ga0070716_100030257
948 Ga0070716_100141103
949 Ga0070716_100635422
950 Ga0070716_100952241
951 Ga0070716_101622463
952 Ga0070712_100003183
953 Ga0070712_100005797
954 Ga0070712_100008271
955 Ga0070712_100023338
956 Ga0070712_100026140
957 Ga0070712_100048233
958 Ga0070712_100053480
959 Ga0070712_100063030
960 Ga0070712_100111243
961 Ga0070712_100153160
962 Ga0070712_100164729
963 Ga0070712_100367465
964 Ga0070712_100453253
965 Ga0070712_100475344
966 Ga0070712_100716785
967 Ga0070712_101463291
968 Ga0070712_101723188
969 Ga0070712_102053883
970 Ga0097621_100108529
971 Ga0068871_100195071
972 Ga0068871_100281941
973 Ga0068871_101000710
974 Ga0075433_10257481
975 Ga0075433_10604307
976 Ga0075433_11680922
977 Ga0075433_11833321
978 Ga0075434_100022313
979 Ga0075434_100039011
980 Ga0075434_100039042
981 Ga0075434_100440565
982 Ga0075434_100959103
983 Ga0075434_101575299
984 Ga0075434_101593884
985 Ga0075436_100015540
986 Ga0075436_100076137
987 Ga0075436_100222884
988 Ga0075436_100236065
989 Ga0075436_100334840
990 Ga0075436_100399630
991 Ga0075435_100006435
992 Ga0075435_100209433
993 Ga0075435_100228314
994 Ga0075435_100402173
995 Ga0075435_100421514
996 Ga0075435_100729146
997 Ga0075435_100819456
998 Ga0075435_101838012
999 Ga0099794_10079302
1000 Ga0099794_10581927
1001 Ga0099795_10067739
1002 Ga0105240_10629598
1003 Ga0105245_10095249
1004 Ga0105245_10144557
1005 Ga0105247_10223359
1006 Ga0105247_10530292
1007 Ga0114129_10326423
1008 Ga0114129_11056395
1009 Ga0114129_12058423
1010 Ga0105243_11532317
1011 Ga0105243_12452967
1012 Ga0105241_10340812
1013 Ga0105241_12237929
1014 Ga0105248_10456512
1015 Ga0105248_11193810
1016 Ga0105238_10624498
1017 Ga0105238_11229876
1018 Ga0105249_11189127
1019 Ga0105239_10293074
1020 Ga0105239_11420309
1021 Ga0105239_11851395
1022 Ga0105246_11296989
1023 Ga0157344_1033162
1024 Ga0157320_1011162
1025 Ga0157341_1015272
1026 Ga0157341_1032182
1027 Ga0157314_1010984
1028 Ga0157338_1024247
1029 Ga0157370_10125863
1030 Ga0157370_10184963
1031 Ga0157370_10390236
1032 Ga0157369_10303618
1033 Ga0157369_10459719
1034 Ga0157369_10953896
1035 Ga0157369_11314684
1036 Ga0157374_10030142
1037 Ga0157374_10397861
1038 Ga0157378_11605728
1039 Ga0163162_10088995
1040 Ga0157372_10383230
1041 Ga0157372_10574139
1042 Ga0157372_10894406
1043 Ga0157372_11420603
1044 Ga0157375_10069903
1045 Ga0157375_12748022
1046 Ga0163163_10255044
1047 Ga0163163_10402701
1048 Ga0163163_10769479
1049 Ga0163163_12252514
1050 Ga0157377_10590726
1051 Ga0157379_10423671
1052 Ga0157379_10659122
1053 Ga0157376_11460070
1054 Ga0157376_11834416
1055 Ga0197907_10612842
1056 Ga0206353_10564429
1057 Ga0213874_10409977
1058 Ga0213876_10077074
1059 Ga0213875_10085630
1060 Ga0224712_10026104
1061 Ga0224712_10153157
1062 Ga0207692_10001407
1063 Ga0207692_10002870
1064 Ga0207692_10008289
1065 Ga0207692_10020297
1066 Ga0207692_10030109
1067 Ga0207692_10034353
1068 Ga0207692_10083229
1069 Ga0207692_10103551
1070 Ga0207692_10278374
1071 Ga0207692_10347535
1072 Ga0207692_10553196
1073 Ga0207680_10209813
1074 Ga0207685_10010901
1075 Ga0207685_10017524
1076 Ga0207685_10018221
1077 Ga0207685_10286256
1078 Ga0207699_10000928
1079 Ga0207699_10002023
1080 Ga0207699_10007157
1081 Ga0207699_10013512
1082 Ga0207699_10013828
1083 Ga0207699_10028070
1084 Ga0207699_10041747
1085 Ga0207699_10108535
1086 Ga0207699_10120869
1087 Ga0207699_10187727
1088 Ga0207699_10198425
1089 Ga0207699_10213824
1090 Ga0207699_10476121
1091 Ga0207699_11429912
1092 Ga0207643_10420345
1093 Ga0207684_10001685
1094 Ga0207684_10001702
1095 Ga0207684_10004499
1096 Ga0207684_10025235
1097 Ga0207684_10029856
1098 Ga0207684_10034535
1099 Ga0207684_10041417
1100 Ga0207684_10084930
1101 Ga0207684_10189293
1102 Ga0207684_10547693
1103 Ga0207684_10575407
1104 Ga0207654_10073711
1105 Ga0207654_11373643
1106 Ga0207707_10008466
1107 Ga0207707_10436886
1108 Ga0207695_10801051
1109 Ga0207693_10014220
1110 Ga0207693_10015006
1111 Ga0207693_10015797
1112 Ga0207693_10029162
1113 Ga0207693_10032341
1114 Ga0207693_10040085
1115 Ga0207693_10041514
1116 Ga0207693_10073175
1117 Ga0207693_10088196
1118 Ga0207693_10093673
1119 Ga0207693_10233908
1120 Ga0207693_10377319
1121 Ga0207693_10380673
1122 Ga0207693_10430188
1123 Ga0207693_10493597
1124 Ga0207693_10754889
1125 Ga0207663_10004140
1126 Ga0207663_10015297
1127 Ga0207663_10050608
1128 Ga0207663_10062245
1129 Ga0207663_10113792
1130 Ga0207663_10204981
1131 Ga0207663_10232675
1132 Ga0207663_10255280
1133 Ga0207663_10258768
1134 Ga0207663_10324920
1135 Ga0207663_10393133
1136 Ga0207663_10657598
1137 Ga0207663_10700248
1138 Ga0207663_11103197
1139 Ga0207663_11229527
1140 Ga0207663_11299686
1141 Ga0207660_10042667
1142 Ga0207660_10832626
1143 Ga0207657_10032857
1144 Ga0207652_10060617
1145 Ga0207646_10000388
1146 Ga0207646_10005932
1147 Ga0207646_10006751
1148 Ga0207646_10021660
1149 Ga0207646_10084045
1150 Ga0207646_10120081
1151 Ga0207646_10130429
1152 Ga0207646_10148676
1153 Ga0207646_10211850
1154 Ga0207646_10212331
1155 Ga0207646_10252457
1156 Ga0207646_10282765
1157 Ga0207646_10531677
1158 Ga0207646_10549629
1159 Ga0207646_10632002
1160 Ga0207646_10822954
1161 Ga0207694_10617884
1162 Ga0207694_11296928
1163 Ga0207687_10433913
1164 Ga0207700_10000639
1165 Ga0207700_10003143
1166 Ga0207700_10006088
1167 Ga0207700_10011095
1168 Ga0207700_10068449
1169 Ga0207700_10111828
1170 Ga0207700_10128220
1171 Ga0207700_10156818
1172 Ga0207700_10235459
1173 Ga0207700_10253002
1174 Ga0207700_10273916
1175 Ga0207700_10276000
1176 Ga0207700_10295509
1177 Ga0207700_10554569
1178 Ga0207700_10580877
1179 Ga0207700_11011856
1180 Ga0207700_11471394
1181 Ga0207700_11490604
1182 Ga0207664_10000755
1183 Ga0207664_10001740
1184 Ga0207664_10001947
1185 Ga0207664_10007688
1186 Ga0207664_10013423
1187 Ga0207664_10027081
1188 Ga0207664_10040610
1189 Ga0207664_10067660
1190 Ga0207664_10093657
1191 Ga0207664_10104808
1192 Ga0207664_10133000
1193 Ga0207664_10201902
1194 Ga0207664_10207590
1195 Ga0207664_10251584
1196 Ga0207664_10366421
1197 Ga0207664_10393786
1198 Ga0207664_10471700
1199 Ga0207664_11727081
1200 Ga0207664_11765407
1201 Ga0207644_10069766
1202 Ga0207709_11114864
1203 Ga0207665_10001497
1204 Ga0207665_10005955
1205 Ga0207665_10018822
1206 Ga0207665_10025379
1207 Ga0207665_10043450
1208 Ga0207665_10045581
1209 Ga0207665_10411242
1210 Ga0207665_10996226
1211 Ga0207665_11514473
1212 Ga0207711_10546912
1213 Ga0207711_11432534
1214 Ga0207679_10097120
1215 Ga0207679_10295778
1216 Ga0207679_10938685
1217 Ga0207667_11029369
1218 Ga0207667_11465209
1219 Ga0207651_10228910
1220 Ga0207712_11283500
1221 Ga0207677_10131061
1222 Ga0207703_10152226
1223 Ga0207703_10380300
1224 Ga0207678_10065504
1225 Ga0207702_10180748
1226 Ga0207702_11346098
1227 Ga0207641_10263562
1228 Ga0207641_10754113
1229 Ga0207676_10213180
1230 Ga0207676_10387405
1231 Ga0207683_10098341
1232 Ga0207698_10062458
1233 Ga0207698_10278669
1234 Ga0268266_10372981
1235 Ga0268266_10477409
1236 Ga0268266_11782563
1237 Ga0268264_11914188
1238 Ga0268264_12528743
1239 Ga0316214_1005907
1240 Ga0373959_0148815
1241 Ga0373938_0160293
1242 Ga0373926_0000048
1243 Ga0373940_0073958
1244 Ga0373944_0002393
1245 Ga0373951_0205782
1246 Ga0373923_0064851
1247 Ga0373923_0351326
1248 Ga0373923_0530161
1249 Ga0373923_0639815
1250 Ga0373936_0001179
1251 Ga0373936_0244887
1252 Ga0373936_0408940
1253 Ga0373945_0000342
1254 Ga0373945_0233176
1255 Ga0373954_0187793
1256 Ga0373954_0644885
1257 Ga0373956_0209081
1258 Ga0373943_0000151
1259 Ga0373943_0309707
1260 Ga0373943_0471866
1261 Ga0373943_0502560
1262 Ga0373943_0522155
1263 Ga0373946_0000178
1264 Ga0373946_0016887
1265 Ga0373946_0133526
1266 Ga0373955_0054966
1267 Ga0373924_0522214
1268 Ga0373931_0189873
1269 Ga0373931_0800183
1270 Ga0373935_0000566
1271 Ga0373935_0029563
1272 Ga0373935_0184978
1273 Ga0373935_0280086
1274 Ga0373935_0357560
1275 Ga0373935_0429948
1276 Ga0373927_0001004
1277 Ga0373927_0064583
1278 Ga0373933_0015780
1279 Ga0373947_0000240
1280 Ga0373947_0174483
1281 Ga0373947_0332047
1282 Ga0373947_1034014
1283 Ga0373937_0233864
1284 Ga0373937_0394230
1285 Ga0373937_0597911
1286 Ga0373937_0830069
1287 Ga0373925_0000231
1288 Ga0373925_0001977
1289 Ga0373925_0047108
1290 Ga0373925_0049194
1291 Ga0373925_0181969
1292 Ga0373925_0594137
1293 Ga0373925_0722971
1294 Ga0373925_0756787
1295 Ga0436364_0517672
1296 Ga0436364_0775870
1297 Ga0436365_0939288
1298 Ga0436365_1360959
1299 Ga0436363_0037632
1300 Ga0436363_0120548
1301 Ga0436363_0293201
1302 Ga0436363_1544854
1303 Ga0436362_0977051
1304 Ga0466963_0128170
1305 Ga0466963_0137985
1306 Ga0466964_0285779
1307 Ga0466968_0522468
1308 Ga0466957_0449456
1309 Ga0466958_0488874
1310 Ga0466967_0133300
1311 Ga0466967_0650255
1312 Ga0495592_0103559
1313 Ga0495603_0558104
1314 Ga0495641_0022468
1315 Ga0495641_0098156
1316 Ga0495651_0036832
1317 Ga0495653_0006648
1318 Ga0495653_0115033
1319 Ga0495582_0039674
1320 Ga0495582_0220614
1321 Ga0495639_0023699
1322 Ga0495639_0525446
1323 Ga0495662_0022848
1324 Ga0495662_0445524
1325 Ga0495664_0000340
1326 Ga0495664_0218405
1327 Ga0495608_0014557
1328 Ga0495618_0085812
1329 Ga0495618_0214979
1330 Ga0495618_0296931
1331 Ga0495618_0464748
1332 Ga0495628_0045435
1333 Ga0495628_0229949
1334 Ga0495630_0011356
1335 Ga0495630_0136852
1336 Ga0495630_1001060
1337 Ga0495652_0003039
1338 Ga0495652_0250808
1339 Ga0495665_0067578
1340 Ga0495640_0755690
1341 Ga0495640_0823385
1342 Ga0495586_0723700
1343 Ga0495587_0052041
1344 Ga0495587_0816117
1345 Ga0495645_0021875
1346 Ga0495645_0046700
1347 Ga0495645_0471436
1348 Ga0495645_0624589
1349 Ga0495667_0069065
1350 Ga0495667_0195004
1351 Ga0495667_0503009
1352 Ga0495634_0029616
1353 Ga0495634_0411421
1354 Ga0495635_0000295
1355 Ga0495635_0170889
1356 Ga0495657_0023706
1357 Ga0495599_0027896
1358 Ga0495599_0891435
1359 Ga0495646_0025682
1360 Ga0495613_0361051
1361 Ga0495624_0002299
1362 Ga0495624_0604132
1363 Ga0495600_0245809
1364 Ga0495581_0020096
1365 Ga0495581_0798898
1366 Ga0495674_0001718
1367 Ga0495674_0052849
1368 Ga0495674_0244075
1369 Ga0495674_0334224
1370 Ga0495674_0526196
1371 Ga0495674_1358759
1372 Ga0495676_0010294
1373 Ga0495676_0175359
1374 Ga0495676_0353444
1375 Ga0495680_0021181
1376 Ga0495680_0559502
1377 Ga0495684_0004475
1378 Ga0495684_0342678
1379 Ga0495684_0892320
1380 Ga0495593_0022357
1381 Ga0495593_0593099
1382 Ga0496100_0235499
1383 Ga0496101_0313999
1384 Ga0496101_1533334
1385 Ga0496102_0219406
1386 Ga0496102_0254574
1387 Ga0496102_0798304
1388 Ga0496102_1472102
1389 Ga0496103_0748766
1390 Ga0496104_0021227
1391 Ga0496104_0299043
1392 Ga0496104_1060762
1393 Ga0496105_0044368
1394 Ga0496105_0360254
1395 Ga0496105_1251374
1396 Ga0496106_0332847
1397 Ga0496106_0847571
1398 Ga0496107_0419323
1399 Ga0496108_0032610
1400 Ga0496108_0135677
1401 Ga0496108_0278796
1402 Ga0496108_1237089
1403 Ga0496109_0045819
1404 Ga0496109_0272316
1405 Ga0496109_1152220
1406 Ga0496110_0132294
1407 Ga0496110_1095994
1408 Ga0496110_1333731
1409 Ga0496111_0214965
1410 Ga0496111_0292710
1411 Ga0496111_0388231
1412 Ga0496111_0968134
1413 Ga0496112_0030312
1414 Ga0496112_0123873
1415 Ga0496112_0603651
1416 Ga0496112_1464487
1417 Ga0496113_0099423
1418 Ga0496114_1639566
1419 Ga0496126_0957345
1420 nmdc:mga05p37_262839_c1
1421 nmdc:mga05p37_813645_c1
1422 nmdc:mga0n895_100553_c1
1423 nmdc:mga0n895_14514_c1
1424 nmdc:mga0n895_1566421_c1
1425 nmdc:mga0n895_1998452_c1
1426 nmdc:mga0n895_2040630_c1
1427 nmdc:mga0n895_69247_c1
1428 nmdc:mga0n895_77874_c1
1429 nmdc:mga0n895_779275_c1
1430 nmdc:mga0rr50_1012002_c1
1431 nmdc:mga0rr50_1485767_c1
1432 nmdc:mga0rr50_211041_c1
1433 nmdc:mga0rr50_279090_c1
1434 nmdc:mga0rr50_4561_c1
1435 nmdc:mga0rr50_483185_c1
1436 nmdc:mga0rr50_59662_c1
1437 nmdc:mga08x19_1146649_c1
1438 nmdc:mga08x19_20837_c1
1439 nmdc:mga08x19_23195_c1
1440 nmdc:mga08x19_271385_c1
1441 nmdc:mga08x19_280865_c1
1442 nmdc:mga08x19_288534_c1
1443 nmdc:mga08x19_547101_c1
1444 nmdc:mga0a205_22506_c1
1445 nmdc:mga0a205_563662_c1
1446 nmdc:mga0a205_773785_c1
1447 Ga0495601_0072591
1448 Ga0495601_0106981
1449 Ga0495601_0211193
1450 Ga0495601_1062835
1451 Ga0495612_0132703
1452 Ga0495612_0211380
1453 Ga0495612_0264761
1454 Ga0495619_0777396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nwy-assembly1.cif.gz_J 2.9 a cryo-em structure of vemp-stalled ribosome-nascent chain complex 0.4088 2 69
5nwy-assembly1.cif.gz_J 2.9 a cryo-em structure of vemp-stalled ribosome-nascent chain complex 0.3863 2 69
5we4-assembly1.cif.gz_t 70s ribosome-ef-tu wt complex with gppnhp 0.3183 2 69
2lfb-assembly1.cif.gz_A homeodomain from rat liver lfb1/hnf1 transcription factor, nmr, 20 structures 0.3013 3 62
5we4-assembly1.cif.gz_t 70s ribosome-ef-tu wt complex with gppnhp 0.3009 2 69
ID Description Score Start End Superfamily
4nz0B03 Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A; 0.5175 4 32 1.20.960.20
af_A0A0P0VRN2_1_150_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.4985 7 36 3.80.10.10
af_K7K5D3_415_493_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4819 3 65 1.25.40.10
af_I1KG56_14_531_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4813 1 51 1.25.10.10
af_A0A096T7A0_17_130_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4498 4 66 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A136KV72-F1-model_v4 Zinc-finger domain-containing protein 0.9657 17 68
AF-A0A419E0M0-F1-model_v4 Zf-HC2 domain-containing protein 0.96 17 68
AF-A0A661W3Z6-F1-model_v4 Zinc-finger domain-containing protein 0.9093 14 68
AF-A0A6P2C7M5-F1-model_v4 Zf-HC2 domain-containing protein 0.9011 13 67
AF-A0A7C7RUS7-F1-model_v4 Zf-HC2 domain-containing protein 0.8968 13 68

Map