F477348

General Info

Members Datasets Scaffolds Average Seq Length
721 251 1442 157

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10063638|Ga0070692_100636383
Length 174
Sequence MEGDRKYRQRGYNDSDRPPENGTFRRDERPRPQGPRPPIDITGPRLPRMVQAVTASRCYNCSTMLGEGTDFKGHCPKCGTALHCCKQCAHFEPSTRFQCLKPIVARVPVKDQANECELFNPRVTVARDVHHPAATVPAGNGVISGPGPIEPRNASDARAAFDSLFRKSDPDGQA

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 33.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10063638 3300005345 Unclassified 1949
2 Ga0070658_10013005 3300005327 Bacteria 6679
3 Ga0070658_10095970 3300005327 Bacteria 2448
4 Ga0070658_10339728 3300005327 Bacteria 1284
5 Ga0070658_10561170 3300005327 Bacteria 988
6 Ga0070658_11044247 3300005327 Unclassified 711
7 Ga0070676_11074629 3300005328 Unclassified 607
8 Ga0070683_100000012 3300005329 Bacteria 274646
9 Ga0070683_100012585 3300005329 Bacteria 7356
10 Ga0070683_100015704 3300005329 Bacteria 6655
11 Ga0070683_100044124 3300005329 Bacteria 4110
12 Ga0070683_100067141 3300005329 Unclassified 3340
13 Ga0070683_100068898 3300005329 Unclassified 3297
14 Ga0070683_100160486 3300005329 Bacteria 2133
15 Ga0070683_101010036 3300005329 Unclassified 799
16 Ga0070670_101066321 3300005331 Unclassified 736
17 Ga0070666_10006790 3300005335 Bacteria 7049
18 Ga0070680_100173583 3300005336 Bacteria 1814
19 Ga0070682_100378417 3300005337 Unclassified 1064
20 Ga0068868_100087314 3300005338 Bacteria 2508
21 Ga0068868_100115933 3300005338 Bacteria 2181
22 Ga0068868_101289433 3300005338 Bacteria 678
23 Ga0070660_100004853 3300005339 Bacteria 9288
24 Ga0070660_100046637 3300005339 Bacteria 3322
25 Ga0070660_100215593 3300005339 Bacteria 1559
26 Ga0070661_100705897 3300005344 Unclassified 822
27 Ga0070668_100552784 3300005347 Bacteria 1002
28 Ga0070669_101042334 3300005353 Unclassified 703
29 Ga0070675_100209190 3300005354 Bacteria 1695
30 Ga0070675_100606188 3300005354 Unclassified 993
31 Ga0070671_100062671 3300005355 Unclassified 3096
32 Ga0070671_100399257 3300005355 Bacteria 1176
33 Ga0070673_100154899 3300005364 Unclassified 1944
34 Ga0070659_100045635 3300005366 Unclassified 3433
35 Ga0070667_100018357 3300005367 Bacteria 5801
36 Ga0070709_10010363 3300005434 Bacteria 5160
37 Ga0070714_100125612 3300005435 Bacteria 2287
38 Ga0070714_100554765 3300005435 Bacteria 1100
39 Ga0070713_100008242 3300005436 Bacteria 7388
40 Ga0070713_100078359 3300005436 Bacteria 2813
41 Ga0070713_100138685 3300005436 Bacteria 2152
42 Ga0070713_100292608 3300005436 Bacteria 1497
43 Ga0070713_100361954 3300005436 Bacteria 1348
44 Ga0070713_100897711 3300005436 Unclassified 852
45 Ga0070710_10210541 3300005437 Unclassified 1232
46 Ga0070710_11543189 3300005437 Unclassified 500
47 Ga0070711_100075155 3300005439 Unclassified 2392
48 Ga0070711_100193618 3300005439 Unclassified 1564
49 Ga0070711_100340741 3300005439 Bacteria 1203
50 Ga0070708_100661266 3300005445 Unclassified 984
51 Ga0070678_100057344 3300005456 Bacteria 2853
52 Ga0070662_100009879 3300005457 Bacteria 6252
53 Ga0070681_10001902 3300005458 Bacteria 18829
54 Ga0070681_10033570 3300005458 Bacteria 5151
55 Ga0070681_10085379 3300005458 Bacteria 3109
56 Ga0070681_10446168 3300005458 Unclassified 1206
57 Ga0070681_10883266 3300005458 Unclassified 812
58 Ga0070681_11241175 3300005458 Unclassified 668
59 Ga0068867_100024317 3300005459 Bacteria 4339
60 Ga0068867_100076246 3300005459 Bacteria 2517
61 Ga0068867_100251980 3300005459 Bacteria 1436
62 Ga0068867_100399598 3300005459 Bacteria 1159
63 Ga0068867_101297323 3300005459 Unclassified 672
64 Ga0070685_10230856 3300005466 Unclassified 1217
65 Ga0070685_10362337 3300005466 Unclassified 994
66 Ga0070679_100289914 3300005530 Unclassified 1588
67 Ga0070679_100350680 3300005530 Unclassified 1423
68 Ga0070684_100000013 3300005535 Bacteria 167281
69 Ga0070684_100011633 3300005535 Bacteria 7013
70 Ga0070684_100033990 3300005535 Bacteria 4357
71 Ga0070684_100043429 3300005535 Unclassified 3882
72 Ga0070684_100069552 3300005535 Bacteria 3096
73 Ga0070684_100168846 3300005535 Unclassified 1987
74 Ga0070697_100164058 3300005536 Bacteria 1878
75 Ga0070697_100265244 3300005536 Unclassified 1471
76 Ga0070697_100580970 3300005536 Unclassified 984
77 Ga0068853_100017965 3300005539 Bacteria 5845
78 Ga0068853_100088088 3300005539 Bacteria 2724
79 Ga0070672_100284751 3300005543 Bacteria 1398
80 Ga0070672_100412369 3300005543 Unclassified 1159
81 Ga0070695_100313307 3300005545 Bacteria 1164
82 Ga0070696_100000050 3300005546 Bacteria 54623
83 Ga0070693_100005014 3300005547 Bacteria 6327
84 Ga0070693_100614901 3300005547 Bacteria 786
85 Ga0070665_100151511 3300005548 Bacteria 2322
86 Ga0070665_100409164 3300005548 Unclassified 1365
87 Ga0070665_100611536 3300005548 Bacteria 1103
88 Ga0068855_100003939 3300005563 Bacteria 18121
89 Ga0068855_100004073 3300005563 Bacteria 17833
90 Ga0068855_100010695 3300005563 Bacteria 11073
91 Ga0068855_100021220 3300005563 Bacteria 7786
92 Ga0068855_100056422 3300005563 Unclassified 4609
93 Ga0068855_100088064 3300005563 Bacteria 3587
94 Ga0068855_100143830 3300005563 Bacteria 2716
95 Ga0068855_100151103 3300005563 Bacteria 2641
96 Ga0068855_100177795 3300005563 Unclassified 2407
97 Ga0068855_100402687 3300005563 Bacteria 1499
98 Ga0068855_100973897 3300005563 Bacteria 892
99 Ga0070664_100008200 3300005564 Bacteria 8448
100 Ga0070664_100910018 3300005564 Unclassified 825
101 Ga0068857_100003867 3300005577 Bacteria 12606
102 Ga0068857_100018807 3300005577 Viruses 6063
103 Ga0068857_100089179 3300005577 Bacteria 2759
104 Ga0068857_100355101 3300005577 Bacteria 1358
105 Ga0068856_100020144 3300005614 Bacteria 6480
106 Ga0068856_100037499 3300005614 Bacteria 4756
107 Ga0068856_100212556 3300005614 Unclassified 1949
108 Ga0068856_100247702 3300005614 Bacteria 1797
109 Ga0068856_100291547 3300005614 Bacteria 1649
110 Ga0068856_100317163 3300005614 Bacteria 1576
111 Ga0068856_100861895 3300005614 Bacteria 925
112 Ga0068852_100035376 3300005616 Bacteria 4166
113 Ga0068852_100161349 3300005616 Bacteria 2093
114 Ga0068852_100339823 3300005616 Bacteria 1463
115 Ga0068852_100818692 3300005616 Unclassified 946
116 Ga0068859_100016202 3300005617 Bacteria 7487
117 Ga0068859_100201699 3300005617 Bacteria 2074
118 Ga0068859_100296810 3300005617 Bacteria 1709
119 Ga0068859_100401498 3300005617 Bacteria 1467
120 Ga0068859_100429608 3300005617 Unclassified 1417
121 Ga0068864_100010390 3300005618 Bacteria 7687
122 Ga0068864_100086771 3300005618 Bacteria 2754
123 Ga0068864_100341500 3300005618 Bacteria 1411
124 Ga0068866_10649702 3300005718 Unclassified 718
125 Ga0068861_100215675 3300005719 Bacteria 1619
126 Ga0068863_100028052 3300005841 Bacteria 5374
127 Ga0068858_100015361 3300005842 Bacteria 7201
128 Ga0068858_100020764 3300005842 Bacteria 6136
129 Ga0068858_100051849 3300005842 Bacteria 3796
130 Ga0068858_100242210 3300005842 Bacteria 1711
131 Ga0068858_100515642 3300005842 Unclassified 1156
132 Ga0068858_100664202 3300005842 Bacteria 1013
133 Ga0068858_100854395 3300005842 Bacteria 889
134 Ga0068858_101029505 3300005842 Bacteria 807
135 Ga0068858_101378756 3300005842 Unclassified 694
136 Ga0068860_100005436 3300005843 Bacteria 12917
137 Ga0068860_100489466 3300005843 Bacteria 1227
138 Ga0068860_100546055 3300005843 Unclassified 1161
139 Ga0070717_10107359 3300006028 Bacteria 2378
140 Ga0070717_10222557 3300006028 Unclassified 1659
141 Ga0070717_10427371 3300006028 Unclassified 1192
142 Ga0070717_10819033 3300006028 Unclassified 847
143 Ga0070715_10633314 3300006163 Bacteria 631
144 Ga0070716_100129714 3300006173 Bacteria 1592
145 Ga0070716_101455247 3300006173 Unclassified 559
146 Ga0070712_101218283 3300006175 Bacteria 655
147 Ga0097621_100008838 3300006237 Bacteria 7282
148 Ga0097621_100017903 3300006237 Bacteria 5395
149 Ga0097621_100018740 3300006237 Bacteria 5295
150 Ga0097621_100050518 3300006237 Bacteria 3382
151 Ga0097621_100097086 3300006237 Unclassified 2473
152 Ga0068871_100003974 3300006358 Bacteria 10216
153 Ga0068871_100013203 3300006358 Bacteria 6127
154 Ga0068871_100027475 3300006358 Unclassified 4451
155 Ga0068871_100194431 3300006358 Unclassified 1749
156 Ga0068871_100316102 3300006358 Bacteria 1374
157 Ga0068871_100323177 3300006358 Unclassified 1359
158 Ga0068871_100903382 3300006358 Unclassified 819
159 Ga0068871_101109734 3300006358 Unclassified 740
160 Ga0068871_101156349 3300006358 Unclassified 725
161 Ga0075430_100547266 3300006846 Unclassified 955
162 Ga0075431_100927921 3300006847 Unclassified 839
163 Ga0075433_10222829 3300006852 Bacteria 1675
164 Ga0075434_100395153 3300006871 Unclassified 1404
165 Ga0068865_100032759 3300006881 Bacteria 3475
166 Ga0075436_100008326 3300006914 Bacteria 7091
167 Ga0075436_100180253 3300006914 Bacteria 1493
168 Ga0075436_100766734 3300006914 Unclassified 717
169 Ga0097620_100016202 3300006931 Bacteria 7487
170 Ga0097620_100201717 3300006931 Bacteria 2074
171 Ga0097620_100296803 3300006931 Bacteria 1709
172 Ga0097620_100401484 3300006931 Bacteria 1467
173 Ga0097620_100429629 3300006931 Unclassified 1417
174 Ga0105240_10001553 3300009093 Bacteria 38971
175 Ga0105240_10003003 3300009093 Bacteria 26548
176 Ga0105240_10004561 3300009093 Bacteria 21018
177 Ga0105240_10106554 3300009093 Unclassified 3399
178 Ga0105240_10164160 3300009093 Bacteria 2636
179 Ga0105240_10219956 3300009093 Unclassified 2213
180 Ga0105240_10236496 3300009093 Bacteria 2120
181 Ga0105240_10304419 3300009093 Bacteria 1822
182 Ga0105240_10545090 3300009093 Bacteria 1284
183 Ga0105240_10718466 3300009093 Bacteria 1089
184 Ga0111539_11586767 3300009094 Unclassified 759
185 Ga0105245_10005491 3300009098 Bacteria 11137
186 Ga0105245_10005572 3300009098 Bacteria 11065
187 Ga0105245_10007447 3300009098 Bacteria 9585
188 Ga0105245_10009917 3300009098 Bacteria 8296
189 Ga0105245_10173896 3300009098 Bacteria 2052
190 Ga0105245_10408905 3300009098 Bacteria 1358
191 Ga0105245_10417860 3300009098 Bacteria 1344
192 Ga0105245_10494377 3300009098 Bacteria 1238
193 Ga0105245_10607520 3300009098 Unclassified 1121
194 Ga0105245_11198740 3300009098 Bacteria 807
195 Ga0105245_11803997 3300009098 Bacteria 664
196 Ga0105247_10064005 3300009101 Bacteria 2284
197 Ga0105247_10435543 3300009101 Unclassified 942
198 Ga0114129_10155295 3300009147 Unclassified 3130
199 Ga0114129_12169972 3300009147 Unclassified 669
200 Ga0105243_10035599 3300009148 Unclassified 3860
201 Ga0105243_10422713 3300009148 Bacteria 1243
202 Ga0105243_10616827 3300009148 Bacteria 1046
203 Ga0105241_10001612 3300009174 Bacteria 17193
204 Ga0105241_10006980 3300009174 Bacteria 8309
205 Ga0105241_10024647 3300009174 Unclassified 4468
206 Ga0105241_10091330 3300009174 Unclassified 2402
207 Ga0105241_10258487 3300009174 Bacteria 1479
208 Ga0105241_10772895 3300009174 Bacteria 882
209 Ga0105242_10008962 3300009176 Bacteria 7681
210 Ga0105242_10033108 3300009176 Bacteria 4137
211 Ga0105242_10131113 3300009176 Bacteria 2164
212 Ga0105242_10150758 3300009176 Bacteria 2027
213 Ga0105242_11065509 3300009176 Unclassified 820
214 Ga0105242_11640765 3300009176 Unclassified 678
215 Ga0105248_10008015 3300009177 Bacteria 11601
216 Ga0105248_10009926 3300009177 Bacteria 10482
217 Ga0105248_10014462 3300009177 Bacteria 8687
218 Ga0105248_10082213 3300009177 Unclassified 3621
219 Ga0105248_10124599 3300009177 Bacteria 2907
220 Ga0105248_10156917 3300009177 Unclassified 2568
221 Ga0105248_10170725 3300009177 Bacteria 2451
222 Ga0105248_10332466 3300009177 Bacteria 1711
223 Ga0105248_10555737 3300009177 Unclassified 1295
224 Ga0105248_10637869 3300009177 Unclassified 1202
225 Ga0105248_11222643 3300009177 Unclassified 849
226 Ga0105248_12358296 3300009177 Bacteria 606
227 Ga0105237_10003328 3300009545 Bacteria 19137
228 Ga0105237_10009562 3300009545 Bacteria 10379
229 Ga0105237_10011412 3300009545 Bacteria 9398
230 Ga0105237_10187991 3300009545 Unclassified 2065
231 Ga0105237_10210700 3300009545 Bacteria 1943
232 Ga0105237_10879665 3300009545 Bacteria 903
233 Ga0105237_10897678 3300009545 Unclassified 893
234 Ga0105238_10002748 3300009551 Bacteria 17541
235 Ga0105238_10002897 3300009551 Bacteria 17138
236 Ga0105238_10002962 3300009551 Bacteria 16952
237 Ga0105238_10022218 3300009551 Bacteria 6468
238 Ga0105238_10022657 3300009551 Bacteria 6402
239 Ga0105238_10039484 3300009551 Bacteria 4787
240 Ga0105238_10043198 3300009551 Unclassified 4561
241 Ga0105238_10202443 3300009551 Unclassified 1961
242 Ga0105238_10322120 3300009551 Bacteria 1532
243 Ga0105238_10467764 3300009551 Bacteria 1259
244 Ga0105238_10668942 3300009551 Bacteria 1049
245 Ga0105238_10817560 3300009551 Bacteria 948
246 Ga0105238_11221095 3300009551 Unclassified 776
247 Ga0105249_10008277 3300009553 Bacteria 9058
248 Ga0105249_10394464 3300009553 Bacteria 1413
249 Ga0105249_10539059 3300009553 Bacteria 1216
250 Ga0105239_10004459 3300010375 Bacteria 16734
251 Ga0105239_10006516 3300010375 Bacteria 13532
252 Ga0105239_10006798 3300010375 Bacteria 13201
253 Ga0105239_10010535 3300010375 Bacteria 10336
254 Ga0105239_10083921 3300010375 Bacteria 3509
255 Ga0105239_10089374 3300010375 Unclassified 3397
256 Ga0105239_10177949 3300010375 Bacteria 2379
257 Ga0105239_10182154 3300010375 Unclassified 2350
258 Ga0105239_10393767 3300010375 Bacteria 1567
259 Ga0105239_10464802 3300010375 Bacteria 1436
260 Ga0105246_10002236 3300011119 Bacteria 11676
261 Ga0105246_10046176 3300011119 Bacteria 2970
262 Ga0105246_10047658 3300011119 Bacteria 2927
263 Ga0105246_10123487 3300011119 Bacteria 1922
264 Ga0157370_10003269 3300013104 Bacteria 19101
265 Ga0157370_10005361 3300013104 Bacteria 14397
266 Ga0157370_10005815 3300013104 Bacteria 13780
267 Ga0157370_10011955 3300013104 Bacteria 9047
268 Ga0157370_10052168 3300013104 Bacteria 3905
269 Ga0157370_11119180 3300013104 Unclassified 711
270 Ga0157369_10001386 3300013105 Bacteria 29854
271 Ga0157369_10038688 3300013105 Bacteria 5216
272 Ga0157369_10055382 3300013105 Unclassified 4281
273 Ga0157369_10123947 3300013105 Bacteria 2741
274 Ga0157369_10152926 3300013105 Bacteria 2439
275 Ga0157369_10258931 3300013105 Bacteria 1815
276 Ga0157369_10711197 3300013105 Bacteria 1034
277 Ga0157369_11386613 3300013105 Unclassified 716
278 Ga0157374_10002706 3300013296 Bacteria 14907
279 Ga0157374_10032316 3300013296 Bacteria 4763
280 Ga0157374_10228341 3300013296 Unclassified 1828
281 Ga0157374_10288512 3300013296 Viruses 1621
282 Ga0157374_10489155 3300013296 Bacteria 1234
283 Ga0157374_10680636 3300013296 Bacteria 1041
284 Ga0157378_10003111 3300013297 Bacteria 14750
285 Ga0157378_10046322 3300013297 Bacteria 3866
286 Ga0157378_10076701 3300013297 Bacteria 3012
287 Ga0157378_10393935 3300013297 Bacteria 1363
288 Ga0157378_10487230 3300013297 Bacteria 1230
289 Ga0157378_11071778 3300013297 Unclassified 842
290 Ga0163162_10030661 3300013306 Bacteria 5329
291 Ga0163162_10067948 3300013306 Bacteria 3615
292 Ga0163162_10123450 3300013306 Viruses 2695
293 Ga0163162_10147225 3300013306 Bacteria 2471
294 Ga0163162_10284161 3300013306 Bacteria 1786
295 Ga0163162_10668454 3300013306 Unclassified 1162
296 Ga0163162_11925696 3300013306 Unclassified 677
297 Ga0157372_10000940 3300013307 Bacteria 31773
298 Ga0157372_10004118 3300013307 Bacteria 15587
299 Ga0157372_10074591 3300013307 Unclassified 3826
300 Ga0157372_10076927 3300013307 Bacteria 3769
301 Ga0157372_10251607 3300013307 Bacteria 2051
302 Ga0157372_10337808 3300013307 Bacteria 1754
303 Ga0157375_10008481 3300013308 Bacteria 9001
304 Ga0157375_10036509 3300013308 Bacteria 4702
305 Ga0157375_11084215 3300013308 Unclassified 937
306 Ga0157375_11319587 3300013308 Bacteria 849
307 Ga0157375_11444423 3300013308 Unclassified 811
308 Ga0157375_11451561 3300013308 Bacteria 809
309 Ga0157375_12580063 3300013308 Unclassified 607
310 Ga0163163_10008943 3300014325 Bacteria 8921
311 Ga0163163_10023757 3300014325 Viruses 5824
312 Ga0163163_10045702 3300014325 Bacteria 4299
313 Ga0163163_10223101 3300014325 Bacteria 1934
314 Ga0163163_10506156 3300014325 Bacteria 1270
315 Ga0163163_10729299 3300014325 Bacteria 1054
316 Ga0163163_11182197 3300014325 Unclassified 827
317 Ga0163163_11544532 3300014325 Unclassified 725
318 Ga0157380_11980900 3300014326 Unclassified 644
319 Ga0157379_10133217 3300014968 Unclassified 2238
320 Ga0157379_10169469 3300014968 Bacteria 1971
321 Ga0157376_10008361 3300014969 Bacteria 7463
322 Ga0157376_10024410 3300014969 Unclassified 4746
323 Ga0157376_10039132 3300014969 Bacteria 3864
324 Ga0157376_10572272 3300014969 Unclassified 1121
325 Ga0157376_11081516 3300014969 Unclassified 827
326 Ga0157376_12058066 3300014969 Unclassified 609
327 Ga0157376_12182027 3300014969 Unclassified 592
328 Ga0197907_10306262 3300020069 Unclassified 773
329 Ga0206356_10299373 3300020070 Unclassified 746
330 Ga0206356_10741037 3300020070 Unclassified 615
331 Ga0206355_1273913 3300020076 Unclassified 967
332 Ga0206355_1496514 3300020076 Unclassified 823
333 Ga0206355_1611549 3300020076 Unclassified 791
334 Ga0206352_10211364 3300020078 Bacteria 1525
335 Ga0213874_10191108 3300021377 Unclassified 732
336 Ga0213876_10252057 3300021384 Bacteria 938
337 Ga0213875_10003217 3300021388 Bacteria 9379
338 Ga0224712_10078853 3300022467 Bacteria 1355
339 Ga0207656_10230483 3300025321 Bacteria 903
340 Ga0207692_10607158 3300025898 Unclassified 704
341 Ga0207642_10076852 3300025899 Bacteria 1609
342 Ga0207680_10023532 3300025903 Bacteria 3366
343 Ga0207699_10081662 3300025906 Bacteria 2006
344 Ga0207643_10459317 3300025908 Bacteria 811
345 Ga0207705_10126838 3300025909 Bacteria 1897
346 Ga0207705_11232893 3300025909 Unclassified 573
347 Ga0207654_10003898 3300025911 Bacteria 7520
348 Ga0207654_10005400 3300025911 Bacteria 6461
349 Ga0207654_10014963 3300025911 Bacteria 4017
350 Ga0207654_10056621 3300025911 Bacteria 2275
351 Ga0207654_10234301 3300025911 Bacteria 1224
352 Ga0207707_10001064 3300025912 Bacteria 26311
353 Ga0207707_10069823 3300025912 Bacteria 3062
354 Ga0207707_10106835 3300025912 Bacteria 2447
355 Ga0207707_10143225 3300025912 Viruses 2089
356 Ga0207707_10233997 3300025912 Bacteria 1598
357 Ga0207707_10361312 3300025912 Unclassified 1250
358 Ga0207707_10669140 3300025912 Bacteria 874
359 Ga0207695_10000736 3300025913 Bacteria 63434
360 Ga0207695_10006825 3300025913 Bacteria 14701
361 Ga0207695_10009719 3300025913 Bacteria 11840
362 Ga0207695_10024452 3300025913 Bacteria 6797
363 Ga0207695_10036777 3300025913 Bacteria 5289
364 Ga0207695_10092564 3300025913 Unclassified 3033
365 Ga0207695_10192162 3300025913 Bacteria 1959
366 Ga0207695_10237607 3300025913 Bacteria 1724
367 Ga0207695_10263549 3300025913 Unclassified 1620
368 Ga0207695_10386203 3300025913 Bacteria 1285
369 Ga0207695_10400962 3300025913 Bacteria 1256
370 Ga0207671_10028988 3300025914 Bacteria 4135
371 Ga0207671_10032809 3300025914 Unclassified 3864
372 Ga0207671_10066169 3300025914 Unclassified 2690
373 Ga0207671_10188773 3300025914 Bacteria 1606
374 Ga0207671_10283352 3300025914 Bacteria 1307
375 Ga0207693_10822660 3300025915 Unclassified 715
376 Ga0207663_10124017 3300025916 Bacteria 1774
377 Ga0207663_10268789 3300025916 Unclassified 1262
378 Ga0207663_10510416 3300025916 Unclassified 935
379 Ga0207660_10001472 3300025917 Bacteria 15850
380 Ga0207660_10010369 3300025917 Bacteria 6045
381 Ga0207660_10037948 3300025917 Unclassified 3360
382 Ga0207660_10358655 3300025917 Viruses 1169
383 Ga0207657_10002373 3300025919 Bacteria 20369
384 Ga0207657_10058904 3300025919 Bacteria 3303
385 Ga0207657_10106806 3300025919 Unclassified 2316
386 Ga0207657_10340660 3300025919 Bacteria 1183
387 Ga0207657_10476877 3300025919 Bacteria 978
388 Ga0207649_10248645 3300025920 Unclassified 1280
389 Ga0207649_10744332 3300025920 Unclassified 762
390 Ga0207652_10004167 3300025921 Bacteria 11795
391 Ga0207652_10194845 3300025921 Viruses 1823
392 Ga0207652_10332783 3300025921 Bacteria 1371
393 Ga0207694_10000596 3300025924 Bacteria 32639
394 Ga0207694_10009372 3300025924 Bacteria 7384
395 Ga0207694_10019850 3300025924 Bacteria 5084
396 Ga0207694_10041862 3300025924 Bacteria 3531
397 Ga0207694_10256961 3300025924 Bacteria 1430
398 Ga0207694_10262071 3300025924 Unclassified 1416
399 Ga0207694_10329727 3300025924 Bacteria 1261
400 Ga0207659_10484304 3300025926 Bacteria 1045
401 Ga0207687_10003886 3300025927 Bacteria 10030
402 Ga0207687_10007395 3300025927 Bacteria 7230
403 Ga0207687_10008651 3300025927 Bacteria 6653
404 Ga0207687_10011455 3300025927 Bacteria 5796
405 Ga0207687_10319671 3300025927 Unclassified 1256
406 Ga0207687_10342340 3300025927 Bacteria 1216
407 Ga0207687_10370136 3300025927 Bacteria 1171
408 Ga0207687_10423832 3300025927 Bacteria 1098
409 Ga0207700_10083365 3300025928 Bacteria 2503
410 Ga0207700_10209603 3300025928 Unclassified 1647
411 Ga0207664_10019746 3300025929 Unclassified 4988
412 Ga0207664_10856278 3300025929 Unclassified 817
413 Ga0207644_10113967 3300025931 Bacteria 2048
414 Ga0207644_10242278 3300025931 Unclassified 1436
415 Ga0207644_10413376 3300025931 Unclassified 1104
416 Ga0207690_10343530 3300025932 Unclassified 1179
417 Ga0207706_10061616 3300025933 Bacteria 3303
418 Ga0207686_10039780 3300025934 Unclassified 2854
419 Ga0207686_10069356 3300025934 Bacteria 2261
420 Ga0207686_10158359 3300025934 Bacteria 1584
421 Ga0207686_10956932 3300025934 Unclassified 693
422 Ga0207709_10009378 3300025935 Bacteria 5385
423 Ga0207709_10030995 3300025935 Unclassified 3117
424 Ga0207669_11203932 3300025937 Unclassified 642
425 Ga0207704_10047044 3300025938 Unclassified 2576
426 Ga0207704_10872033 3300025938 Unclassified 755
427 Ga0207691_10280822 3300025940 Bacteria 1433
428 Ga0207691_10339044 3300025940 Bacteria 1287
429 Ga0207711_10002369 3300025941 Bacteria 16871
430 Ga0207711_10005641 3300025941 Bacteria 10577
431 Ga0207711_10024130 3300025941 Bacteria 5090
432 Ga0207711_10207666 3300025941 Bacteria 1789
433 Ga0207711_10213401 3300025941 Bacteria 1763
434 Ga0207711_10378150 3300025941 Bacteria 1314
435 Ga0207711_10442611 3300025941 Unclassified 1209
436 Ga0207711_10453750 3300025941 Bacteria 1193
437 Ga0207711_10860792 3300025941 Bacteria 843
438 Ga0207711_11431294 3300025941 Bacteria 634
439 Ga0207689_10020007 3300025942 Bacteria 5638
440 Ga0207689_10267167 3300025942 Bacteria 1416
441 Ga0207689_10325405 3300025942 Unclassified 1276
442 Ga0207689_11005614 3300025942 Unclassified 703
443 Ga0207661_10000034 3300025944 Bacteria 154138
444 Ga0207661_10005010 3300025944 Bacteria 9286
445 Ga0207661_10022058 3300025944 Unclassified 4786
446 Ga0207661_10129392 3300025944 Bacteria 2160
447 Ga0207661_10219924 3300025944 Bacteria 1678
448 Ga0207661_10695457 3300025944 Unclassified 935
449 Ga0207661_10917688 3300025944 Bacteria 807
450 Ga0207679_10340032 3300025945 Unclassified 1305
451 Ga0207679_10957802 3300025945 Unclassified 784
452 Ga0207679_10997973 3300025945 Unclassified 767
453 Ga0207667_10000286 3300025949 Bacteria 69623
454 Ga0207667_10002312 3300025949 Bacteria 23885
455 Ga0207667_10006895 3300025949 Bacteria 13724
456 Ga0207667_10013803 3300025949 Bacteria 9229
457 Ga0207667_10015881 3300025949 Bacteria 8527
458 Ga0207667_10050549 3300025949 Unclassified 4385
459 Ga0207667_10117880 3300025949 Unclassified 2736
460 Ga0207667_10134311 3300025949 Unclassified 2548
461 Ga0207667_10171762 3300025949 Unclassified 2228
462 Ga0207667_10212101 3300025949 Bacteria 1985
463 Ga0207651_10043824 3300025960 Unclassified 2989
464 Ga0207651_11058634 3300025960 Bacteria 726
465 Ga0207712_10091979 3300025961 Unclassified 2235
466 Ga0207712_10282552 3300025961 Bacteria 1355
467 Ga0207712_10941366 3300025961 Unclassified 765
468 Ga0207640_10011159 3300025981 Bacteria 5081
469 Ga0207658_10383032 3300025986 Unclassified 1232
470 Ga0207677_10047405 3300026023 Unclassified 2885
471 Ga0207677_10059654 3300026023 Unclassified 2632
472 Ga0207677_10487105 3300026023 Bacteria 1064
473 Ga0207703_10005985 3300026035 Bacteria 9745
474 Ga0207703_10114605 3300026035 Bacteria 2305
475 Ga0207703_10225387 3300026035 Bacteria 1678
476 Ga0207703_10342353 3300026035 Unclassified 1375
477 Ga0207703_10602125 3300026035 Unclassified 1039
478 Ga0207703_10737801 3300026035 Bacteria 938
479 Ga0207703_11307607 3300026035 Bacteria 697
480 Ga0207639_10011143 3300026041 Bacteria 6238
481 Ga0207639_10069567 3300026041 Bacteria 2747
482 Ga0207639_10069804 3300026041 Unclassified 2742
483 Ga0207639_10223018 3300026041 Bacteria 1629
484 Ga0207702_10066028 3300026078 Bacteria 3100
485 Ga0207702_10159328 3300026078 Bacteria 2060
486 Ga0207702_10436860 3300026078 Bacteria 1268
487 Ga0207702_10461738 3300026078 Bacteria 1233
488 Ga0207702_10526009 3300026078 Bacteria 1155
489 Ga0207702_10804003 3300026078 Unclassified 929
490 Ga0207702_10959475 3300026078 Bacteria 848
491 Ga0207702_11052111 3300026078 Unclassified 808
492 Ga0207641_10107739 3300026088 Unclassified 2465
493 Ga0207641_10115286 3300026088 Bacteria 2389
494 Ga0207641_10276618 3300026088 Bacteria 1577
495 Ga0207648_10081127 3300026089 Viruses 2830
496 Ga0207648_10084152 3300026089 Bacteria 2774
497 Ga0207648_10095543 3300026089 Bacteria 2600
498 Ga0207676_10045779 3300026095 Unclassified 3382
499 Ga0207676_10524561 3300026095 Bacteria 1128
500 Ga0207676_10660176 3300026095 Bacteria 1010
501 Ga0207676_10843511 3300026095 Bacteria 896
502 Ga0207676_11906650 3300026095 Unclassified 593
503 Ga0207674_10000598 3300026116 Bacteria 47476
504 Ga0207674_10002054 3300026116 Bacteria 25559
505 Ga0207674_10007040 3300026116 Bacteria 13150
506 Ga0207674_10016379 3300026116 Bacteria 8116
507 Ga0207674_10029344 3300026116 Bacteria 5790
508 Ga0207674_10149267 3300026116 Bacteria 2295
509 Ga0207683_10072584 3300026121 Bacteria 3044
510 Ga0207698_10011678 3300026142 Bacteria 5707
511 Ga0207698_10020874 3300026142 Unclassified 4518
512 Ga0207698_10388397 3300026142 Unclassified 1330
513 Ga0207698_10621521 3300026142 Unclassified 1067
514 Ga0268266_11033028 3300028379 Bacteria 795
515 Ga0268265_11552167 3300028380 Unclassified 666
516 Ga0268264_10022204 3300028381 Bacteria 5181
517 Ga0268264_10847643 3300028381 Unclassified 915
518 Ga0268264_10955840 3300028381 Bacteria 862
519 Ga0265338_10447312 3300028800 Bacteria 915
520 Ga0265332_10266379 3300031238 Bacteria 708
521 Ga0265325_10007620 3300031241 Bacteria 6472
522 Ga0265340_10191775 3300031247 Unclassified 921
523 Ga0265340_10257000 3300031247 Bacteria 778
524 Ga0265339_10097048 3300031249 Bacteria 1538
525 Ga0265339_10114933 3300031249 Bacteria 1389
526 Ga0265331_10060690 3300031250 Bacteria 1786
527 Ga0265331_10125460 3300031250 Bacteria 1173
528 Ga0265331_10139093 3300031250 Unclassified 1105
529 Ga0265331_10302811 3300031250 Unclassified 716
530 Ga0265316_10003417 3300031344 Bacteria 16066
531 Ga0265316_10003861 3300031344 Bacteria 15027
532 Ga0265316_10051590 3300031344 Bacteria 3230
533 Ga0265316_10056432 3300031344 Bacteria 3067
534 Ga0265316_10086751 3300031344 Bacteria 2392
535 Ga0265316_10088282 3300031344 Bacteria 2368
536 Ga0265316_10118687 3300031344 Bacteria 1999
537 Ga0265316_10239243 3300031344 Bacteria 1335
538 Ga0265316_10252549 3300031344 Bacteria 1294
539 Ga0265316_10298882 3300031344 Bacteria 1173
540 Ga0265313_10041165 3300031595 Bacteria 2279
541 Ga0265313_10159814 3300031595 Unclassified 958
542 Ga0265313_10167425 3300031595 Bacteria 930
543 Ga0265313_10327543 3300031595 Bacteria 611
544 Ga0265314_10002505 3300031711 Bacteria 18734
545 Ga0265314_10006404 3300031711 Bacteria 10431
546 Ga0265314_10032317 3300031711 Bacteria 3850
547 Ga0373926_0030072 3300035083 Bacteria 1911
548 Ga0373926_0240760 3300035083 Unclassified 700
549 Ga0373934_0000702 3300035086 Bacteria 11971
550 Ga0373944_0360586 3300035089 Unclassified 554
551 Ga0373945_0070509 3300035116 Bacteria 1322
552 Ga0373953_0007112 3300035117 Bacteria 3730
553 Ga0373953_0009909 3300035117 Bacteria 3300
554 Ga0373953_0365451 3300035117 Unclassified 633
555 Ga0373954_0003460 3300035118 Bacteria 6696
556 Ga0373954_0070698 3300035118 Unclassified 1658
557 Ga0373954_0107145 3300035118 Bacteria 1350
558 Ga0373956_0014046 3300035119 Bacteria 3340
559 Ga0373956_0071812 3300035119 Bacteria 1580
560 Ga0373957_0204554 3300035120 Bacteria 823
561 Ga0373960_0295682 3300035121 Unclassified 601
562 Ga0373943_0027185 3300035170 Bacteria 2686
563 Ga0373943_0067611 3300035170 Unclassified 1802
564 Ga0373946_0037373 3300035171 Bacteria 1973
565 Ga0373946_0268748 3300035171 Unclassified 836
566 Ga0373946_0568274 3300035171 Unclassified 586
567 Ga0373955_0025520 3300035172 Bacteria 3036
568 Ga0373955_0044205 3300035172 Bacteria 2398
569 Ga0373955_0188268 3300035172 Bacteria 1226
570 Ga0373955_0188343 3300035172 Unclassified 1226
571 Ga0373924_0008858 3300035410 Bacteria 3672
572 Ga0373935_0104847 3300035692 Bacteria 1869
573 Ga0373935_0126018 3300035692 Bacteria 1716
574 Ga0373935_0310383 3300035692 Bacteria 1117
575 Ga0373935_0786176 3300035692 Bacteria 702
576 Ga0373927_0000406 3300035695 Bacteria 33145
577 Ga0373927_0054900 3300035695 Bacteria 2577
578 Ga0373927_0172438 3300035695 Unclassified 1418
579 Ga0373927_0265530 3300035695 Bacteria 1129
580 Ga0373933_0245451 3300035724 Bacteria 1152
581 Ga0373933_0387255 3300035724 Unclassified 911
582 Ga0373933_0637630 3300035724 Unclassified 700
583 Ga0373947_0000515 3300035725 Bacteria 22532
584 Ga0373947_0107903 3300035725 Bacteria 1756
585 Ga0373947_0384445 3300035725 Bacteria 945
586 Ga0373947_0970635 3300035725 Bacteria 580
587 Ga0373937_0007859 3300036401 Bacteria 9246
588 Ga0373937_0100915 3300036401 Bacteria 2678
589 Ga0373937_0226283 3300036401 Bacteria 1761
590 Ga0373937_0427729 3300036401 Unclassified 1257
591 Ga0373937_1275379 3300036401 Unclassified 683
592 Ga0373925_0000805 3300037068 Bacteria 28892
593 Ga0373925_0055110 3300037068 Bacteria 2975
594 Ga0373925_0068515 3300037068 Bacteria 2679
595 Ga0373925_0070049 3300037068 Bacteria 2650
596 Ga0373925_0099470 3300037068 Bacteria 2234
597 Ga0373925_0172656 3300037068 Bacteria 1707
598 Ga0373925_0282067 3300037068 Bacteria 1338
599 Ga0395900_0336524 3300037418 Bacteria 1486
600 Ga0395905_0659466 3300037471 Unclassified 948
601 Ga0395905_0725780 3300037471 Unclassified 896
602 Ga0436364_0114467 3300037853 Bacteria 1057
603 Ga0436364_0250279 3300037853 Bacteria 6471
604 Ga0436365_0303955 3300039437 Bacteria 1372
605 Ga0436365_0851550 3300039437 Bacteria 1736
606 Ga0436365_1891567 3300039437 Bacteria 1044
607 Ga0436360_0254837 3300039438 Bacteria 7127
608 Ga0436363_0266634 3300039450 Unclassified 1099
609 Ga0436363_1006948 3300039450 Bacteria 2382
610 Ga0436362_0210836 3300039453 Bacteria 1413
611 Ga0436362_0871999 3300039453 Bacteria 3070
612 Ga0439448_0064983 3300042005 Unclassified 1209
613 Ga0451577_1142871 3300042876 Bacteria 696
614 Ga0466965_0302852 3300044683 Unclassified 868
615 Ga0466963_0277080 3300044694 Unclassified 1179
616 Ga0466963_0606627 3300044694 Unclassified 773
617 Ga0453684_0412689 3300044712 Bacteria 1510
618 Ga0451576_0021663 3300045051 Bacteria 6983
619 Ga0451576_0540860 3300045051 Bacteria 1224
620 Ga0466958_0332441 3300045836 Unclassified 977
621 Ga0466967_0812123 3300045976 Unclassified 929
622 Ga0495651_0191308 3300046462 Unclassified 1440
623 Ga0495651_0642030 3300046462 Bacteria 666
624 Ga0495651_0771833 3300046462 Unclassified 595
625 Ga0495580_0005431 3300046472 Bacteria 10532
626 Ga0495580_0066450 3300046472 Unclassified 2524
627 Ga0495580_0111752 3300046472 Bacteria 1897
628 Ga0495580_0353183 3300046472 Unclassified 996
629 Ga0495582_0022975 3300046473 Bacteria 3411
630 Ga0495582_0256932 3300046473 Bacteria 1002
631 Ga0495662_0091200 3300046476 Bacteria 1486
632 Ga0495664_0138984 3300046477 Bacteria 1472
633 Ga0495664_0165478 3300046477 Bacteria 1342
634 Ga0495594_0200956 3300046499 Bacteria 1136
635 Ga0495594_0227115 3300046499 Bacteria 1064
636 Ga0495628_0539293 3300046516 Unclassified 839
637 Ga0495630_0445287 3300046517 Bacteria 992
638 Ga0495630_0579652 3300046517 Unclassified 860
639 Ga0495666_0355740 3300046526 Bacteria 659
640 Ga0495642_0308479 3300046528 Bacteria 694
641 Ga0495652_0275021 3300046529 Bacteria 1236
642 Ga0495652_0467981 3300046529 Bacteria 879
643 Ga0495652_0995512 3300046529 Unclassified 549
644 Ga0495665_0047438 3300046531 Bacteria 2278
645 Ga0495640_0443953 3300046533 Unclassified 793
646 Ga0495586_0183776 3300046535 Unclassified 1183
647 Ga0495586_0355964 3300046535 Unclassified 841
648 Ga0495587_0001072 3300046536 Bacteria 17978
649 Ga0495587_0060907 3300046536 Bacteria 2212
650 Ga0495587_0093310 3300046536 Unclassified 1738
651 Ga0495645_0041606 3300046543 Bacteria 3351
652 Ga0495645_0626639 3300046543 Unclassified 659
653 Ga0495667_0167919 3300046559 Unclassified 1410
654 Ga0495635_0330020 3300046663 Bacteria 1020
655 Ga0495635_0366984 3300046663 Unclassified 959
656 Ga0495635_0848131 3300046663 Unclassified 587
657 Ga0495657_0458197 3300046675 Unclassified 746
658 Ga0495599_0613013 3300046678 Bacteria 633
659 Ga0495623_0049848 3300046679 Unclassified 2653
660 Ga0495623_0189417 3300046679 Bacteria 1190
661 Ga0495623_0252054 3300046679 Bacteria 992
662 Ga0495658_0045585 3300046683 Bacteria 2461
663 Ga0495658_0958793 3300046683 Unclassified 546
664 Ga0495613_0226259 3300046689 Bacteria 1312
665 Ga0495613_0484611 3300046689 Unclassified 834
666 Ga0495624_0120379 3300046690 Bacteria 1612
667 Ga0495624_0349819 3300046690 Unclassified 889
668 Ga0495600_0135942 3300046809 Unclassified 1597
669 Ga0495600_0515053 3300046809 Bacteria 734
670 Ga0495581_0581685 3300047315 Unclassified 649
671 Ga0495604_0037257 3300047317 Bacteria 3831
672 Ga0495604_0232804 3300047317 Bacteria 1263
673 Ga0495636_0077910 3300047318 Bacteria 1423
674 Ga0495674_0002309 3300047319 Bacteria 18707
675 Ga0495674_0124106 3300047319 Bacteria 2180
676 Ga0495680_0558457 3300047322 Bacteria 770
677 Ga0495675_0095092 3300047444 Bacteria 1868
678 Ga0495675_0177986 3300047444 Bacteria 1303
679 Ga0495675_0225385 3300047444 Unclassified 1133
680 Ga0495675_0320261 3300047444 Unclassified 917
681 Ga0495675_0616855 3300047444 Bacteria 614
682 Ga0495684_0014766 3300047471 Bacteria 6013
683 Ga0495684_0115406 3300047471 Bacteria 2024
684 Ga0495684_0570769 3300047471 Unclassified 767
685 Ga0495602_0135415 3300048088 Bacteria 1958
686 Ga0495602_0189689 3300048088 Unclassified 1577
687 Ga0495602_0717725 3300048088 Unclassified 677
688 Ga0495602_0795115 3300048088 Unclassified 636
689 Ga0496102_0898899 3300048905 Unclassified 807
690 Ga0496112_0169492 3300048915 Bacteria 2149
691 Ga0496115_0102945 3300048918 Bacteria 2342
692 Ga0496115_0269619 3300048918 Bacteria 1399
693 Ga0496126_0086318 3300048929 Bacteria 2766
694 Ga0501032_0108395 3300049569 Bacteria 1839
695 Ga0501034_0025207 3300049571 Bacteria 6053
696 Ga0501034_0737477 3300049571 Unclassified 881
697 Ga0501038_0222029 3300049574 Unclassified 1507
698 Ga0501039_0773422 3300049575 Unclassified 749
699 Ga0501043_0470366 3300049579 Unclassified 942
700 Ga0501046_0376811 3300049580 Unclassified 1028
701 Ga0501047_0047012 3300049581 Unclassified 4170
702 Ga0501047_0063717 3300049581 Bacteria 3556
703 Ga0501048_0457261 3300049582 Unclassified 914
704 Ga0501070_0019634 3300049586 Bacteria 5666
705 Ga0501073_0138869 3300049589 Unclassified 1684
706 Ga0501035_0008190 3300049822 Bacteria 9741
707 Ga0501044_0001789 3300049823 Bacteria 25105
708 Ga0501044_0002189 3300049823 Bacteria 22424
709 Ga0501044_0153711 3300049823 Bacteria 2282
710 Ga0501044_0574372 3300049823 Bacteria 1022
711 nmdc:mga05p37_886576_c1 3300050507 Bacteria 964
712 nmdc:mga0n895_535578_c1 3300050512 Bacteria 1178
713 nmdc:mga08x19_1007204_c1 3300050514 Bacteria 592
714 nmdc:mga0a205_348771_c1 3300050515 Bacteria 1348
715 Ga0495601_0383737 3300053077 Bacteria 912
716 Ga0495612_0278423 3300053078 Unclassified 747
717 Ga0495595_0343945 3300053084 Bacteria 752
718 Ga0495619_0874804 3300053085 Bacteria 605
719 Ga0587090_023332 3300059510 Unclassified 984
720 Ga0587092_031146 3300059512 Unclassified 883
721 Ga0587076_044897 3300059645 Unclassified 840
722 Ga0070692_10063638
723 Ga0070658_10013005
724 Ga0070658_10095970
725 Ga0070658_10339728
726 Ga0070658_10561170
727 Ga0070658_11044247
728 Ga0070676_11074629
729 Ga0070683_100000012
730 Ga0070683_100012585
731 Ga0070683_100015704
732 Ga0070683_100044124
733 Ga0070683_100067141
734 Ga0070683_100068898
735 Ga0070683_100160486
736 Ga0070683_101010036
737 Ga0070670_101066321
738 Ga0070666_10006790
739 Ga0070680_100173583
740 Ga0070682_100378417
741 Ga0068868_100087314
742 Ga0068868_100115933
743 Ga0068868_101289433
744 Ga0070660_100004853
745 Ga0070660_100046637
746 Ga0070660_100215593
747 Ga0070661_100705897
748 Ga0070668_100552784
749 Ga0070669_101042334
750 Ga0070675_100209190
751 Ga0070675_100606188
752 Ga0070671_100062671
753 Ga0070671_100399257
754 Ga0070673_100154899
755 Ga0070659_100045635
756 Ga0070667_100018357
757 Ga0070709_10010363
758 Ga0070714_100125612
759 Ga0070714_100554765
760 Ga0070713_100008242
761 Ga0070713_100078359
762 Ga0070713_100138685
763 Ga0070713_100292608
764 Ga0070713_100361954
765 Ga0070713_100897711
766 Ga0070710_10210541
767 Ga0070710_11543189
768 Ga0070711_100075155
769 Ga0070711_100193618
770 Ga0070711_100340741
771 Ga0070708_100661266
772 Ga0070678_100057344
773 Ga0070662_100009879
774 Ga0070681_10001902
775 Ga0070681_10033570
776 Ga0070681_10085379
777 Ga0070681_10446168
778 Ga0070681_10883266
779 Ga0070681_11241175
780 Ga0068867_100024317
781 Ga0068867_100076246
782 Ga0068867_100251980
783 Ga0068867_100399598
784 Ga0068867_101297323
785 Ga0070685_10230856
786 Ga0070685_10362337
787 Ga0070679_100289914
788 Ga0070679_100350680
789 Ga0070684_100000013
790 Ga0070684_100011633
791 Ga0070684_100033990
792 Ga0070684_100043429
793 Ga0070684_100069552
794 Ga0070684_100168846
795 Ga0070697_100164058
796 Ga0070697_100265244
797 Ga0070697_100580970
798 Ga0068853_100017965
799 Ga0068853_100088088
800 Ga0070672_100284751
801 Ga0070672_100412369
802 Ga0070695_100313307
803 Ga0070696_100000050
804 Ga0070693_100005014
805 Ga0070693_100614901
806 Ga0070665_100151511
807 Ga0070665_100409164
808 Ga0070665_100611536
809 Ga0068855_100003939
810 Ga0068855_100004073
811 Ga0068855_100010695
812 Ga0068855_100021220
813 Ga0068855_100056422
814 Ga0068855_100088064
815 Ga0068855_100143830
816 Ga0068855_100151103
817 Ga0068855_100177795
818 Ga0068855_100402687
819 Ga0068855_100973897
820 Ga0070664_100008200
821 Ga0070664_100910018
822 Ga0068857_100003867
823 Ga0068857_100018807
824 Ga0068857_100089179
825 Ga0068857_100355101
826 Ga0068856_100020144
827 Ga0068856_100037499
828 Ga0068856_100212556
829 Ga0068856_100247702
830 Ga0068856_100291547
831 Ga0068856_100317163
832 Ga0068856_100861895
833 Ga0068852_100035376
834 Ga0068852_100161349
835 Ga0068852_100339823
836 Ga0068852_100818692
837 Ga0068859_100016202
838 Ga0068859_100201699
839 Ga0068859_100296810
840 Ga0068859_100401498
841 Ga0068859_100429608
842 Ga0068864_100010390
843 Ga0068864_100086771
844 Ga0068864_100341500
845 Ga0068866_10649702
846 Ga0068861_100215675
847 Ga0068863_100028052
848 Ga0068858_100015361
849 Ga0068858_100020764
850 Ga0068858_100051849
851 Ga0068858_100242210
852 Ga0068858_100515642
853 Ga0068858_100664202
854 Ga0068858_100854395
855 Ga0068858_101029505
856 Ga0068858_101378756
857 Ga0068860_100005436
858 Ga0068860_100489466
859 Ga0068860_100546055
860 Ga0070717_10107359
861 Ga0070717_10222557
862 Ga0070717_10427371
863 Ga0070717_10819033
864 Ga0070715_10633314
865 Ga0070716_100129714
866 Ga0070716_101455247
867 Ga0070712_101218283
868 Ga0097621_100008838
869 Ga0097621_100017903
870 Ga0097621_100018740
871 Ga0097621_100050518
872 Ga0097621_100097086
873 Ga0068871_100003974
874 Ga0068871_100013203
875 Ga0068871_100027475
876 Ga0068871_100194431
877 Ga0068871_100316102
878 Ga0068871_100323177
879 Ga0068871_100903382
880 Ga0068871_101109734
881 Ga0068871_101156349
882 Ga0075430_100547266
883 Ga0075431_100927921
884 Ga0075433_10222829
885 Ga0075434_100395153
886 Ga0068865_100032759
887 Ga0075436_100008326
888 Ga0075436_100180253
889 Ga0075436_100766734
890 Ga0097620_100016202
891 Ga0097620_100201717
892 Ga0097620_100296803
893 Ga0097620_100401484
894 Ga0097620_100429629
895 Ga0105240_10001553
896 Ga0105240_10003003
897 Ga0105240_10004561
898 Ga0105240_10106554
899 Ga0105240_10164160
900 Ga0105240_10219956
901 Ga0105240_10236496
902 Ga0105240_10304419
903 Ga0105240_10545090
904 Ga0105240_10718466
905 Ga0111539_11586767
906 Ga0105245_10005491
907 Ga0105245_10005572
908 Ga0105245_10007447
909 Ga0105245_10009917
910 Ga0105245_10173896
911 Ga0105245_10408905
912 Ga0105245_10417860
913 Ga0105245_10494377
914 Ga0105245_10607520
915 Ga0105245_11198740
916 Ga0105245_11803997
917 Ga0105247_10064005
918 Ga0105247_10435543
919 Ga0114129_10155295
920 Ga0114129_12169972
921 Ga0105243_10035599
922 Ga0105243_10422713
923 Ga0105243_10616827
924 Ga0105241_10001612
925 Ga0105241_10006980
926 Ga0105241_10024647
927 Ga0105241_10091330
928 Ga0105241_10258487
929 Ga0105241_10772895
930 Ga0105242_10008962
931 Ga0105242_10033108
932 Ga0105242_10131113
933 Ga0105242_10150758
934 Ga0105242_11065509
935 Ga0105242_11640765
936 Ga0105248_10008015
937 Ga0105248_10009926
938 Ga0105248_10014462
939 Ga0105248_10082213
940 Ga0105248_10124599
941 Ga0105248_10156917
942 Ga0105248_10170725
943 Ga0105248_10332466
944 Ga0105248_10555737
945 Ga0105248_10637869
946 Ga0105248_11222643
947 Ga0105248_12358296
948 Ga0105237_10003328
949 Ga0105237_10009562
950 Ga0105237_10011412
951 Ga0105237_10187991
952 Ga0105237_10210700
953 Ga0105237_10879665
954 Ga0105237_10897678
955 Ga0105238_10002748
956 Ga0105238_10002897
957 Ga0105238_10002962
958 Ga0105238_10022218
959 Ga0105238_10022657
960 Ga0105238_10039484
961 Ga0105238_10043198
962 Ga0105238_10202443
963 Ga0105238_10322120
964 Ga0105238_10467764
965 Ga0105238_10668942
966 Ga0105238_10817560
967 Ga0105238_11221095
968 Ga0105249_10008277
969 Ga0105249_10394464
970 Ga0105249_10539059
971 Ga0105239_10004459
972 Ga0105239_10006516
973 Ga0105239_10006798
974 Ga0105239_10010535
975 Ga0105239_10083921
976 Ga0105239_10089374
977 Ga0105239_10177949
978 Ga0105239_10182154
979 Ga0105239_10393767
980 Ga0105239_10464802
981 Ga0105246_10002236
982 Ga0105246_10046176
983 Ga0105246_10047658
984 Ga0105246_10123487
985 Ga0157370_10003269
986 Ga0157370_10005361
987 Ga0157370_10005815
988 Ga0157370_10011955
989 Ga0157370_10052168
990 Ga0157370_11119180
991 Ga0157369_10001386
992 Ga0157369_10038688
993 Ga0157369_10055382
994 Ga0157369_10123947
995 Ga0157369_10152926
996 Ga0157369_10258931
997 Ga0157369_10711197
998 Ga0157369_11386613
999 Ga0157374_10002706
1000 Ga0157374_10032316
1001 Ga0157374_10228341
1002 Ga0157374_10288512
1003 Ga0157374_10489155
1004 Ga0157374_10680636
1005 Ga0157378_10003111
1006 Ga0157378_10046322
1007 Ga0157378_10076701
1008 Ga0157378_10393935
1009 Ga0157378_10487230
1010 Ga0157378_11071778
1011 Ga0163162_10030661
1012 Ga0163162_10067948
1013 Ga0163162_10123450
1014 Ga0163162_10147225
1015 Ga0163162_10284161
1016 Ga0163162_10668454
1017 Ga0163162_11925696
1018 Ga0157372_10000940
1019 Ga0157372_10004118
1020 Ga0157372_10074591
1021 Ga0157372_10076927
1022 Ga0157372_10251607
1023 Ga0157372_10337808
1024 Ga0157375_10008481
1025 Ga0157375_10036509
1026 Ga0157375_11084215
1027 Ga0157375_11319587
1028 Ga0157375_11444423
1029 Ga0157375_11451561
1030 Ga0157375_12580063
1031 Ga0163163_10008943
1032 Ga0163163_10023757
1033 Ga0163163_10045702
1034 Ga0163163_10223101
1035 Ga0163163_10506156
1036 Ga0163163_10729299
1037 Ga0163163_11182197
1038 Ga0163163_11544532
1039 Ga0157380_11980900
1040 Ga0157379_10133217
1041 Ga0157379_10169469
1042 Ga0157376_10008361
1043 Ga0157376_10024410
1044 Ga0157376_10039132
1045 Ga0157376_10572272
1046 Ga0157376_11081516
1047 Ga0157376_12058066
1048 Ga0157376_12182027
1049 Ga0197907_10306262
1050 Ga0206356_10299373
1051 Ga0206356_10741037
1052 Ga0206355_1273913
1053 Ga0206355_1496514
1054 Ga0206355_1611549
1055 Ga0206352_10211364
1056 Ga0213874_10191108
1057 Ga0213876_10252057
1058 Ga0213875_10003217
1059 Ga0224712_10078853
1060 Ga0207656_10230483
1061 Ga0207692_10607158
1062 Ga0207642_10076852
1063 Ga0207680_10023532
1064 Ga0207699_10081662
1065 Ga0207643_10459317
1066 Ga0207705_10126838
1067 Ga0207705_11232893
1068 Ga0207654_10003898
1069 Ga0207654_10005400
1070 Ga0207654_10014963
1071 Ga0207654_10056621
1072 Ga0207654_10234301
1073 Ga0207707_10001064
1074 Ga0207707_10069823
1075 Ga0207707_10106835
1076 Ga0207707_10143225
1077 Ga0207707_10233997
1078 Ga0207707_10361312
1079 Ga0207707_10669140
1080 Ga0207695_10000736
1081 Ga0207695_10006825
1082 Ga0207695_10009719
1083 Ga0207695_10024452
1084 Ga0207695_10036777
1085 Ga0207695_10092564
1086 Ga0207695_10192162
1087 Ga0207695_10237607
1088 Ga0207695_10263549
1089 Ga0207695_10386203
1090 Ga0207695_10400962
1091 Ga0207671_10028988
1092 Ga0207671_10032809
1093 Ga0207671_10066169
1094 Ga0207671_10188773
1095 Ga0207671_10283352
1096 Ga0207693_10822660
1097 Ga0207663_10124017
1098 Ga0207663_10268789
1099 Ga0207663_10510416
1100 Ga0207660_10001472
1101 Ga0207660_10010369
1102 Ga0207660_10037948
1103 Ga0207660_10358655
1104 Ga0207657_10002373
1105 Ga0207657_10058904
1106 Ga0207657_10106806
1107 Ga0207657_10340660
1108 Ga0207657_10476877
1109 Ga0207649_10248645
1110 Ga0207649_10744332
1111 Ga0207652_10004167
1112 Ga0207652_10194845
1113 Ga0207652_10332783
1114 Ga0207694_10000596
1115 Ga0207694_10009372
1116 Ga0207694_10019850
1117 Ga0207694_10041862
1118 Ga0207694_10256961
1119 Ga0207694_10262071
1120 Ga0207694_10329727
1121 Ga0207659_10484304
1122 Ga0207687_10003886
1123 Ga0207687_10007395
1124 Ga0207687_10008651
1125 Ga0207687_10011455
1126 Ga0207687_10319671
1127 Ga0207687_10342340
1128 Ga0207687_10370136
1129 Ga0207687_10423832
1130 Ga0207700_10083365
1131 Ga0207700_10209603
1132 Ga0207664_10019746
1133 Ga0207664_10856278
1134 Ga0207644_10113967
1135 Ga0207644_10242278
1136 Ga0207644_10413376
1137 Ga0207690_10343530
1138 Ga0207706_10061616
1139 Ga0207686_10039780
1140 Ga0207686_10069356
1141 Ga0207686_10158359
1142 Ga0207686_10956932
1143 Ga0207709_10009378
1144 Ga0207709_10030995
1145 Ga0207669_11203932
1146 Ga0207704_10047044
1147 Ga0207704_10872033
1148 Ga0207691_10280822
1149 Ga0207691_10339044
1150 Ga0207711_10002369
1151 Ga0207711_10005641
1152 Ga0207711_10024130
1153 Ga0207711_10207666
1154 Ga0207711_10213401
1155 Ga0207711_10378150
1156 Ga0207711_10442611
1157 Ga0207711_10453750
1158 Ga0207711_10860792
1159 Ga0207711_11431294
1160 Ga0207689_10020007
1161 Ga0207689_10267167
1162 Ga0207689_10325405
1163 Ga0207689_11005614
1164 Ga0207661_10000034
1165 Ga0207661_10005010
1166 Ga0207661_10022058
1167 Ga0207661_10129392
1168 Ga0207661_10219924
1169 Ga0207661_10695457
1170 Ga0207661_10917688
1171 Ga0207679_10340032
1172 Ga0207679_10957802
1173 Ga0207679_10997973
1174 Ga0207667_10000286
1175 Ga0207667_10002312
1176 Ga0207667_10006895
1177 Ga0207667_10013803
1178 Ga0207667_10015881
1179 Ga0207667_10050549
1180 Ga0207667_10117880
1181 Ga0207667_10134311
1182 Ga0207667_10171762
1183 Ga0207667_10212101
1184 Ga0207651_10043824
1185 Ga0207651_11058634
1186 Ga0207712_10091979
1187 Ga0207712_10282552
1188 Ga0207712_10941366
1189 Ga0207640_10011159
1190 Ga0207658_10383032
1191 Ga0207677_10047405
1192 Ga0207677_10059654
1193 Ga0207677_10487105
1194 Ga0207703_10005985
1195 Ga0207703_10114605
1196 Ga0207703_10225387
1197 Ga0207703_10342353
1198 Ga0207703_10602125
1199 Ga0207703_10737801
1200 Ga0207703_11307607
1201 Ga0207639_10011143
1202 Ga0207639_10069567
1203 Ga0207639_10069804
1204 Ga0207639_10223018
1205 Ga0207702_10066028
1206 Ga0207702_10159328
1207 Ga0207702_10436860
1208 Ga0207702_10461738
1209 Ga0207702_10526009
1210 Ga0207702_10804003
1211 Ga0207702_10959475
1212 Ga0207702_11052111
1213 Ga0207641_10107739
1214 Ga0207641_10115286
1215 Ga0207641_10276618
1216 Ga0207648_10081127
1217 Ga0207648_10084152
1218 Ga0207648_10095543
1219 Ga0207676_10045779
1220 Ga0207676_10524561
1221 Ga0207676_10660176
1222 Ga0207676_10843511
1223 Ga0207676_11906650
1224 Ga0207674_10000598
1225 Ga0207674_10002054
1226 Ga0207674_10007040
1227 Ga0207674_10016379
1228 Ga0207674_10029344
1229 Ga0207674_10149267
1230 Ga0207683_10072584
1231 Ga0207698_10011678
1232 Ga0207698_10020874
1233 Ga0207698_10388397
1234 Ga0207698_10621521
1235 Ga0268266_11033028
1236 Ga0268265_11552167
1237 Ga0268264_10022204
1238 Ga0268264_10847643
1239 Ga0268264_10955840
1240 Ga0265338_10447312
1241 Ga0265332_10266379
1242 Ga0265325_10007620
1243 Ga0265340_10191775
1244 Ga0265340_10257000
1245 Ga0265339_10097048
1246 Ga0265339_10114933
1247 Ga0265331_10060690
1248 Ga0265331_10125460
1249 Ga0265331_10139093
1250 Ga0265331_10302811
1251 Ga0265316_10003417
1252 Ga0265316_10003861
1253 Ga0265316_10051590
1254 Ga0265316_10056432
1255 Ga0265316_10086751
1256 Ga0265316_10088282
1257 Ga0265316_10118687
1258 Ga0265316_10239243
1259 Ga0265316_10252549
1260 Ga0265316_10298882
1261 Ga0265313_10041165
1262 Ga0265313_10159814
1263 Ga0265313_10167425
1264 Ga0265313_10327543
1265 Ga0265314_10002505
1266 Ga0265314_10006404
1267 Ga0265314_10032317
1268 Ga0373926_0030072
1269 Ga0373926_0240760
1270 Ga0373934_0000702
1271 Ga0373944_0360586
1272 Ga0373945_0070509
1273 Ga0373953_0007112
1274 Ga0373953_0009909
1275 Ga0373953_0365451
1276 Ga0373954_0003460
1277 Ga0373954_0070698
1278 Ga0373954_0107145
1279 Ga0373956_0014046
1280 Ga0373956_0071812
1281 Ga0373957_0204554
1282 Ga0373960_0295682
1283 Ga0373943_0027185
1284 Ga0373943_0067611
1285 Ga0373946_0037373
1286 Ga0373946_0268748
1287 Ga0373946_0568274
1288 Ga0373955_0025520
1289 Ga0373955_0044205
1290 Ga0373955_0188268
1291 Ga0373955_0188343
1292 Ga0373924_0008858
1293 Ga0373935_0104847
1294 Ga0373935_0126018
1295 Ga0373935_0310383
1296 Ga0373935_0786176
1297 Ga0373927_0000406
1298 Ga0373927_0054900
1299 Ga0373927_0172438
1300 Ga0373927_0265530
1301 Ga0373933_0245451
1302 Ga0373933_0387255
1303 Ga0373933_0637630
1304 Ga0373947_0000515
1305 Ga0373947_0107903
1306 Ga0373947_0384445
1307 Ga0373947_0970635
1308 Ga0373937_0007859
1309 Ga0373937_0100915
1310 Ga0373937_0226283
1311 Ga0373937_0427729
1312 Ga0373937_1275379
1313 Ga0373925_0000805
1314 Ga0373925_0055110
1315 Ga0373925_0068515
1316 Ga0373925_0070049
1317 Ga0373925_0099470
1318 Ga0373925_0172656
1319 Ga0373925_0282067
1320 Ga0395900_0336524
1321 Ga0395905_0659466
1322 Ga0395905_0725780
1323 Ga0436364_0114467
1324 Ga0436364_0250279
1325 Ga0436365_0303955
1326 Ga0436365_0851550
1327 Ga0436365_1891567
1328 Ga0436360_0254837
1329 Ga0436363_0266634
1330 Ga0436363_1006948
1331 Ga0436362_0210836
1332 Ga0436362_0871999
1333 Ga0439448_0064983
1334 Ga0451577_1142871
1335 Ga0466965_0302852
1336 Ga0466963_0277080
1337 Ga0466963_0606627
1338 Ga0453684_0412689
1339 Ga0451576_0021663
1340 Ga0451576_0540860
1341 Ga0466958_0332441
1342 Ga0466967_0812123
1343 Ga0495651_0191308
1344 Ga0495651_0642030
1345 Ga0495651_0771833
1346 Ga0495580_0005431
1347 Ga0495580_0066450
1348 Ga0495580_0111752
1349 Ga0495580_0353183
1350 Ga0495582_0022975
1351 Ga0495582_0256932
1352 Ga0495662_0091200
1353 Ga0495664_0138984
1354 Ga0495664_0165478
1355 Ga0495594_0200956
1356 Ga0495594_0227115
1357 Ga0495628_0539293
1358 Ga0495630_0445287
1359 Ga0495630_0579652
1360 Ga0495666_0355740
1361 Ga0495642_0308479
1362 Ga0495652_0275021
1363 Ga0495652_0467981
1364 Ga0495652_0995512
1365 Ga0495665_0047438
1366 Ga0495640_0443953
1367 Ga0495586_0183776
1368 Ga0495586_0355964
1369 Ga0495587_0001072
1370 Ga0495587_0060907
1371 Ga0495587_0093310
1372 Ga0495645_0041606
1373 Ga0495645_0626639
1374 Ga0495667_0167919
1375 Ga0495635_0330020
1376 Ga0495635_0366984
1377 Ga0495635_0848131
1378 Ga0495657_0458197
1379 Ga0495599_0613013
1380 Ga0495623_0049848
1381 Ga0495623_0189417
1382 Ga0495623_0252054
1383 Ga0495658_0045585
1384 Ga0495658_0958793
1385 Ga0495613_0226259
1386 Ga0495613_0484611
1387 Ga0495624_0120379
1388 Ga0495624_0349819
1389 Ga0495600_0135942
1390 Ga0495600_0515053
1391 Ga0495581_0581685
1392 Ga0495604_0037257
1393 Ga0495604_0232804
1394 Ga0495636_0077910
1395 Ga0495674_0002309
1396 Ga0495674_0124106
1397 Ga0495680_0558457
1398 Ga0495675_0095092
1399 Ga0495675_0177986
1400 Ga0495675_0225385
1401 Ga0495675_0320261
1402 Ga0495675_0616855
1403 Ga0495684_0014766
1404 Ga0495684_0115406
1405 Ga0495684_0570769
1406 Ga0495602_0135415
1407 Ga0495602_0189689
1408 Ga0495602_0717725
1409 Ga0495602_0795115
1410 Ga0496102_0898899
1411 Ga0496112_0169492
1412 Ga0496115_0102945
1413 Ga0496115_0269619
1414 Ga0496126_0086318
1415 Ga0501032_0108395
1416 Ga0501034_0025207
1417 Ga0501034_0737477
1418 Ga0501038_0222029
1419 Ga0501039_0773422
1420 Ga0501043_0470366
1421 Ga0501046_0376811
1422 Ga0501047_0047012
1423 Ga0501047_0063717
1424 Ga0501048_0457261
1425 Ga0501070_0019634
1426 Ga0501073_0138869
1427 Ga0501035_0008190
1428 Ga0501044_0001789
1429 Ga0501044_0002189
1430 Ga0501044_0153711
1431 Ga0501044_0574372
1432 nmdc:mga05p37_886576_c1
1433 nmdc:mga0n895_535578_c1
1434 nmdc:mga08x19_1007204_c1
1435 nmdc:mga0a205_348771_c1
1436 Ga0495601_0383737
1437 Ga0495612_0278423
1438 Ga0495595_0343945
1439 Ga0495619_0874804
1440 Ga0587090_023332
1441 Ga0587092_031146
1442 Ga0587076_044897

MSA Aligner

Family Sequences

Map