F477348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 721 | 251 | 1442 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300005345|Ga0070692_10063638|Ga0070692_100636383 |
| Length | 174 |
| Sequence | MEGDRKYRQRGYNDSDRPPENGTFRRDERPRPQGPRPPIDITGPRLPRMVQAVTASRCYNCSTMLGEGTDFKGHCPKCGTALHCCKQCAHFEPSTRFQCLKPIVARVPVKDQANECELFNPRVTVARDVHHPAATVPAGNGVISGPGPIEPRNASDARAAFDSLFRKSDPDGQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 92 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 185 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 1.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.55 |
| Rhizosphere | 97.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070692_10063638 | 3300005345 | Unclassified | 1949 |
| 2 | Ga0070658_10013005 | 3300005327 | Bacteria | 6679 |
| 3 | Ga0070658_10095970 | 3300005327 | Bacteria | 2448 |
| 4 | Ga0070658_10339728 | 3300005327 | Bacteria | 1284 |
| 5 | Ga0070658_10561170 | 3300005327 | Bacteria | 988 |
| 6 | Ga0070658_11044247 | 3300005327 | Unclassified | 711 |
| 7 | Ga0070676_11074629 | 3300005328 | Unclassified | 607 |
| 8 | Ga0070683_100000012 | 3300005329 | Bacteria | 274646 |
| 9 | Ga0070683_100012585 | 3300005329 | Bacteria | 7356 |
| 10 | Ga0070683_100015704 | 3300005329 | Bacteria | 6655 |
| 11 | Ga0070683_100044124 | 3300005329 | Bacteria | 4110 |
| 12 | Ga0070683_100067141 | 3300005329 | Unclassified | 3340 |
| 13 | Ga0070683_100068898 | 3300005329 | Unclassified | 3297 |
| 14 | Ga0070683_100160486 | 3300005329 | Bacteria | 2133 |
| 15 | Ga0070683_101010036 | 3300005329 | Unclassified | 799 |
| 16 | Ga0070670_101066321 | 3300005331 | Unclassified | 736 |
| 17 | Ga0070666_10006790 | 3300005335 | Bacteria | 7049 |
| 18 | Ga0070680_100173583 | 3300005336 | Bacteria | 1814 |
| 19 | Ga0070682_100378417 | 3300005337 | Unclassified | 1064 |
| 20 | Ga0068868_100087314 | 3300005338 | Bacteria | 2508 |
| 21 | Ga0068868_100115933 | 3300005338 | Bacteria | 2181 |
| 22 | Ga0068868_101289433 | 3300005338 | Bacteria | 678 |
| 23 | Ga0070660_100004853 | 3300005339 | Bacteria | 9288 |
| 24 | Ga0070660_100046637 | 3300005339 | Bacteria | 3322 |
| 25 | Ga0070660_100215593 | 3300005339 | Bacteria | 1559 |
| 26 | Ga0070661_100705897 | 3300005344 | Unclassified | 822 |
| 27 | Ga0070668_100552784 | 3300005347 | Bacteria | 1002 |
| 28 | Ga0070669_101042334 | 3300005353 | Unclassified | 703 |
| 29 | Ga0070675_100209190 | 3300005354 | Bacteria | 1695 |
| 30 | Ga0070675_100606188 | 3300005354 | Unclassified | 993 |
| 31 | Ga0070671_100062671 | 3300005355 | Unclassified | 3096 |
| 32 | Ga0070671_100399257 | 3300005355 | Bacteria | 1176 |
| 33 | Ga0070673_100154899 | 3300005364 | Unclassified | 1944 |
| 34 | Ga0070659_100045635 | 3300005366 | Unclassified | 3433 |
| 35 | Ga0070667_100018357 | 3300005367 | Bacteria | 5801 |
| 36 | Ga0070709_10010363 | 3300005434 | Bacteria | 5160 |
| 37 | Ga0070714_100125612 | 3300005435 | Bacteria | 2287 |
| 38 | Ga0070714_100554765 | 3300005435 | Bacteria | 1100 |
| 39 | Ga0070713_100008242 | 3300005436 | Bacteria | 7388 |
| 40 | Ga0070713_100078359 | 3300005436 | Bacteria | 2813 |
| 41 | Ga0070713_100138685 | 3300005436 | Bacteria | 2152 |
| 42 | Ga0070713_100292608 | 3300005436 | Bacteria | 1497 |
| 43 | Ga0070713_100361954 | 3300005436 | Bacteria | 1348 |
| 44 | Ga0070713_100897711 | 3300005436 | Unclassified | 852 |
| 45 | Ga0070710_10210541 | 3300005437 | Unclassified | 1232 |
| 46 | Ga0070710_11543189 | 3300005437 | Unclassified | 500 |
| 47 | Ga0070711_100075155 | 3300005439 | Unclassified | 2392 |
| 48 | Ga0070711_100193618 | 3300005439 | Unclassified | 1564 |
| 49 | Ga0070711_100340741 | 3300005439 | Bacteria | 1203 |
| 50 | Ga0070708_100661266 | 3300005445 | Unclassified | 984 |
| 51 | Ga0070678_100057344 | 3300005456 | Bacteria | 2853 |
| 52 | Ga0070662_100009879 | 3300005457 | Bacteria | 6252 |
| 53 | Ga0070681_10001902 | 3300005458 | Bacteria | 18829 |
| 54 | Ga0070681_10033570 | 3300005458 | Bacteria | 5151 |
| 55 | Ga0070681_10085379 | 3300005458 | Bacteria | 3109 |
| 56 | Ga0070681_10446168 | 3300005458 | Unclassified | 1206 |
| 57 | Ga0070681_10883266 | 3300005458 | Unclassified | 812 |
| 58 | Ga0070681_11241175 | 3300005458 | Unclassified | 668 |
| 59 | Ga0068867_100024317 | 3300005459 | Bacteria | 4339 |
| 60 | Ga0068867_100076246 | 3300005459 | Bacteria | 2517 |
| 61 | Ga0068867_100251980 | 3300005459 | Bacteria | 1436 |
| 62 | Ga0068867_100399598 | 3300005459 | Bacteria | 1159 |
| 63 | Ga0068867_101297323 | 3300005459 | Unclassified | 672 |
| 64 | Ga0070685_10230856 | 3300005466 | Unclassified | 1217 |
| 65 | Ga0070685_10362337 | 3300005466 | Unclassified | 994 |
| 66 | Ga0070679_100289914 | 3300005530 | Unclassified | 1588 |
| 67 | Ga0070679_100350680 | 3300005530 | Unclassified | 1423 |
| 68 | Ga0070684_100000013 | 3300005535 | Bacteria | 167281 |
| 69 | Ga0070684_100011633 | 3300005535 | Bacteria | 7013 |
| 70 | Ga0070684_100033990 | 3300005535 | Bacteria | 4357 |
| 71 | Ga0070684_100043429 | 3300005535 | Unclassified | 3882 |
| 72 | Ga0070684_100069552 | 3300005535 | Bacteria | 3096 |
| 73 | Ga0070684_100168846 | 3300005535 | Unclassified | 1987 |
| 74 | Ga0070697_100164058 | 3300005536 | Bacteria | 1878 |
| 75 | Ga0070697_100265244 | 3300005536 | Unclassified | 1471 |
| 76 | Ga0070697_100580970 | 3300005536 | Unclassified | 984 |
| 77 | Ga0068853_100017965 | 3300005539 | Bacteria | 5845 |
| 78 | Ga0068853_100088088 | 3300005539 | Bacteria | 2724 |
| 79 | Ga0070672_100284751 | 3300005543 | Bacteria | 1398 |
| 80 | Ga0070672_100412369 | 3300005543 | Unclassified | 1159 |
| 81 | Ga0070695_100313307 | 3300005545 | Bacteria | 1164 |
| 82 | Ga0070696_100000050 | 3300005546 | Bacteria | 54623 |
| 83 | Ga0070693_100005014 | 3300005547 | Bacteria | 6327 |
| 84 | Ga0070693_100614901 | 3300005547 | Bacteria | 786 |
| 85 | Ga0070665_100151511 | 3300005548 | Bacteria | 2322 |
| 86 | Ga0070665_100409164 | 3300005548 | Unclassified | 1365 |
| 87 | Ga0070665_100611536 | 3300005548 | Bacteria | 1103 |
| 88 | Ga0068855_100003939 | 3300005563 | Bacteria | 18121 |
| 89 | Ga0068855_100004073 | 3300005563 | Bacteria | 17833 |
| 90 | Ga0068855_100010695 | 3300005563 | Bacteria | 11073 |
| 91 | Ga0068855_100021220 | 3300005563 | Bacteria | 7786 |
| 92 | Ga0068855_100056422 | 3300005563 | Unclassified | 4609 |
| 93 | Ga0068855_100088064 | 3300005563 | Bacteria | 3587 |
| 94 | Ga0068855_100143830 | 3300005563 | Bacteria | 2716 |
| 95 | Ga0068855_100151103 | 3300005563 | Bacteria | 2641 |
| 96 | Ga0068855_100177795 | 3300005563 | Unclassified | 2407 |
| 97 | Ga0068855_100402687 | 3300005563 | Bacteria | 1499 |
| 98 | Ga0068855_100973897 | 3300005563 | Bacteria | 892 |
| 99 | Ga0070664_100008200 | 3300005564 | Bacteria | 8448 |
| 100 | Ga0070664_100910018 | 3300005564 | Unclassified | 825 |
| 101 | Ga0068857_100003867 | 3300005577 | Bacteria | 12606 |
| 102 | Ga0068857_100018807 | 3300005577 | Viruses | 6063 |
| 103 | Ga0068857_100089179 | 3300005577 | Bacteria | 2759 |
| 104 | Ga0068857_100355101 | 3300005577 | Bacteria | 1358 |
| 105 | Ga0068856_100020144 | 3300005614 | Bacteria | 6480 |
| 106 | Ga0068856_100037499 | 3300005614 | Bacteria | 4756 |
| 107 | Ga0068856_100212556 | 3300005614 | Unclassified | 1949 |
| 108 | Ga0068856_100247702 | 3300005614 | Bacteria | 1797 |
| 109 | Ga0068856_100291547 | 3300005614 | Bacteria | 1649 |
| 110 | Ga0068856_100317163 | 3300005614 | Bacteria | 1576 |
| 111 | Ga0068856_100861895 | 3300005614 | Bacteria | 925 |
| 112 | Ga0068852_100035376 | 3300005616 | Bacteria | 4166 |
| 113 | Ga0068852_100161349 | 3300005616 | Bacteria | 2093 |
| 114 | Ga0068852_100339823 | 3300005616 | Bacteria | 1463 |
| 115 | Ga0068852_100818692 | 3300005616 | Unclassified | 946 |
| 116 | Ga0068859_100016202 | 3300005617 | Bacteria | 7487 |
| 117 | Ga0068859_100201699 | 3300005617 | Bacteria | 2074 |
| 118 | Ga0068859_100296810 | 3300005617 | Bacteria | 1709 |
| 119 | Ga0068859_100401498 | 3300005617 | Bacteria | 1467 |
| 120 | Ga0068859_100429608 | 3300005617 | Unclassified | 1417 |
| 121 | Ga0068864_100010390 | 3300005618 | Bacteria | 7687 |
| 122 | Ga0068864_100086771 | 3300005618 | Bacteria | 2754 |
| 123 | Ga0068864_100341500 | 3300005618 | Bacteria | 1411 |
| 124 | Ga0068866_10649702 | 3300005718 | Unclassified | 718 |
| 125 | Ga0068861_100215675 | 3300005719 | Bacteria | 1619 |
| 126 | Ga0068863_100028052 | 3300005841 | Bacteria | 5374 |
| 127 | Ga0068858_100015361 | 3300005842 | Bacteria | 7201 |
| 128 | Ga0068858_100020764 | 3300005842 | Bacteria | 6136 |
| 129 | Ga0068858_100051849 | 3300005842 | Bacteria | 3796 |
| 130 | Ga0068858_100242210 | 3300005842 | Bacteria | 1711 |
| 131 | Ga0068858_100515642 | 3300005842 | Unclassified | 1156 |
| 132 | Ga0068858_100664202 | 3300005842 | Bacteria | 1013 |
| 133 | Ga0068858_100854395 | 3300005842 | Bacteria | 889 |
| 134 | Ga0068858_101029505 | 3300005842 | Bacteria | 807 |
| 135 | Ga0068858_101378756 | 3300005842 | Unclassified | 694 |
| 136 | Ga0068860_100005436 | 3300005843 | Bacteria | 12917 |
| 137 | Ga0068860_100489466 | 3300005843 | Bacteria | 1227 |
| 138 | Ga0068860_100546055 | 3300005843 | Unclassified | 1161 |
| 139 | Ga0070717_10107359 | 3300006028 | Bacteria | 2378 |
| 140 | Ga0070717_10222557 | 3300006028 | Unclassified | 1659 |
| 141 | Ga0070717_10427371 | 3300006028 | Unclassified | 1192 |
| 142 | Ga0070717_10819033 | 3300006028 | Unclassified | 847 |
| 143 | Ga0070715_10633314 | 3300006163 | Bacteria | 631 |
| 144 | Ga0070716_100129714 | 3300006173 | Bacteria | 1592 |
| 145 | Ga0070716_101455247 | 3300006173 | Unclassified | 559 |
| 146 | Ga0070712_101218283 | 3300006175 | Bacteria | 655 |
| 147 | Ga0097621_100008838 | 3300006237 | Bacteria | 7282 |
| 148 | Ga0097621_100017903 | 3300006237 | Bacteria | 5395 |
| 149 | Ga0097621_100018740 | 3300006237 | Bacteria | 5295 |
| 150 | Ga0097621_100050518 | 3300006237 | Bacteria | 3382 |
| 151 | Ga0097621_100097086 | 3300006237 | Unclassified | 2473 |
| 152 | Ga0068871_100003974 | 3300006358 | Bacteria | 10216 |
| 153 | Ga0068871_100013203 | 3300006358 | Bacteria | 6127 |
| 154 | Ga0068871_100027475 | 3300006358 | Unclassified | 4451 |
| 155 | Ga0068871_100194431 | 3300006358 | Unclassified | 1749 |
| 156 | Ga0068871_100316102 | 3300006358 | Bacteria | 1374 |
| 157 | Ga0068871_100323177 | 3300006358 | Unclassified | 1359 |
| 158 | Ga0068871_100903382 | 3300006358 | Unclassified | 819 |
| 159 | Ga0068871_101109734 | 3300006358 | Unclassified | 740 |
| 160 | Ga0068871_101156349 | 3300006358 | Unclassified | 725 |
| 161 | Ga0075430_100547266 | 3300006846 | Unclassified | 955 |
| 162 | Ga0075431_100927921 | 3300006847 | Unclassified | 839 |
| 163 | Ga0075433_10222829 | 3300006852 | Bacteria | 1675 |
| 164 | Ga0075434_100395153 | 3300006871 | Unclassified | 1404 |
| 165 | Ga0068865_100032759 | 3300006881 | Bacteria | 3475 |
| 166 | Ga0075436_100008326 | 3300006914 | Bacteria | 7091 |
| 167 | Ga0075436_100180253 | 3300006914 | Bacteria | 1493 |
| 168 | Ga0075436_100766734 | 3300006914 | Unclassified | 717 |
| 169 | Ga0097620_100016202 | 3300006931 | Bacteria | 7487 |
| 170 | Ga0097620_100201717 | 3300006931 | Bacteria | 2074 |
| 171 | Ga0097620_100296803 | 3300006931 | Bacteria | 1709 |
| 172 | Ga0097620_100401484 | 3300006931 | Bacteria | 1467 |
| 173 | Ga0097620_100429629 | 3300006931 | Unclassified | 1417 |
| 174 | Ga0105240_10001553 | 3300009093 | Bacteria | 38971 |
| 175 | Ga0105240_10003003 | 3300009093 | Bacteria | 26548 |
| 176 | Ga0105240_10004561 | 3300009093 | Bacteria | 21018 |
| 177 | Ga0105240_10106554 | 3300009093 | Unclassified | 3399 |
| 178 | Ga0105240_10164160 | 3300009093 | Bacteria | 2636 |
| 179 | Ga0105240_10219956 | 3300009093 | Unclassified | 2213 |
| 180 | Ga0105240_10236496 | 3300009093 | Bacteria | 2120 |
| 181 | Ga0105240_10304419 | 3300009093 | Bacteria | 1822 |
| 182 | Ga0105240_10545090 | 3300009093 | Bacteria | 1284 |
| 183 | Ga0105240_10718466 | 3300009093 | Bacteria | 1089 |
| 184 | Ga0111539_11586767 | 3300009094 | Unclassified | 759 |
| 185 | Ga0105245_10005491 | 3300009098 | Bacteria | 11137 |
| 186 | Ga0105245_10005572 | 3300009098 | Bacteria | 11065 |
| 187 | Ga0105245_10007447 | 3300009098 | Bacteria | 9585 |
| 188 | Ga0105245_10009917 | 3300009098 | Bacteria | 8296 |
| 189 | Ga0105245_10173896 | 3300009098 | Bacteria | 2052 |
| 190 | Ga0105245_10408905 | 3300009098 | Bacteria | 1358 |
| 191 | Ga0105245_10417860 | 3300009098 | Bacteria | 1344 |
| 192 | Ga0105245_10494377 | 3300009098 | Bacteria | 1238 |
| 193 | Ga0105245_10607520 | 3300009098 | Unclassified | 1121 |
| 194 | Ga0105245_11198740 | 3300009098 | Bacteria | 807 |
| 195 | Ga0105245_11803997 | 3300009098 | Bacteria | 664 |
| 196 | Ga0105247_10064005 | 3300009101 | Bacteria | 2284 |
| 197 | Ga0105247_10435543 | 3300009101 | Unclassified | 942 |
| 198 | Ga0114129_10155295 | 3300009147 | Unclassified | 3130 |
| 199 | Ga0114129_12169972 | 3300009147 | Unclassified | 669 |
| 200 | Ga0105243_10035599 | 3300009148 | Unclassified | 3860 |
| 201 | Ga0105243_10422713 | 3300009148 | Bacteria | 1243 |
| 202 | Ga0105243_10616827 | 3300009148 | Bacteria | 1046 |
| 203 | Ga0105241_10001612 | 3300009174 | Bacteria | 17193 |
| 204 | Ga0105241_10006980 | 3300009174 | Bacteria | 8309 |
| 205 | Ga0105241_10024647 | 3300009174 | Unclassified | 4468 |
| 206 | Ga0105241_10091330 | 3300009174 | Unclassified | 2402 |
| 207 | Ga0105241_10258487 | 3300009174 | Bacteria | 1479 |
| 208 | Ga0105241_10772895 | 3300009174 | Bacteria | 882 |
| 209 | Ga0105242_10008962 | 3300009176 | Bacteria | 7681 |
| 210 | Ga0105242_10033108 | 3300009176 | Bacteria | 4137 |
| 211 | Ga0105242_10131113 | 3300009176 | Bacteria | 2164 |
| 212 | Ga0105242_10150758 | 3300009176 | Bacteria | 2027 |
| 213 | Ga0105242_11065509 | 3300009176 | Unclassified | 820 |
| 214 | Ga0105242_11640765 | 3300009176 | Unclassified | 678 |
| 215 | Ga0105248_10008015 | 3300009177 | Bacteria | 11601 |
| 216 | Ga0105248_10009926 | 3300009177 | Bacteria | 10482 |
| 217 | Ga0105248_10014462 | 3300009177 | Bacteria | 8687 |
| 218 | Ga0105248_10082213 | 3300009177 | Unclassified | 3621 |
| 219 | Ga0105248_10124599 | 3300009177 | Bacteria | 2907 |
| 220 | Ga0105248_10156917 | 3300009177 | Unclassified | 2568 |
| 221 | Ga0105248_10170725 | 3300009177 | Bacteria | 2451 |
| 222 | Ga0105248_10332466 | 3300009177 | Bacteria | 1711 |
| 223 | Ga0105248_10555737 | 3300009177 | Unclassified | 1295 |
| 224 | Ga0105248_10637869 | 3300009177 | Unclassified | 1202 |
| 225 | Ga0105248_11222643 | 3300009177 | Unclassified | 849 |
| 226 | Ga0105248_12358296 | 3300009177 | Bacteria | 606 |
| 227 | Ga0105237_10003328 | 3300009545 | Bacteria | 19137 |
| 228 | Ga0105237_10009562 | 3300009545 | Bacteria | 10379 |
| 229 | Ga0105237_10011412 | 3300009545 | Bacteria | 9398 |
| 230 | Ga0105237_10187991 | 3300009545 | Unclassified | 2065 |
| 231 | Ga0105237_10210700 | 3300009545 | Bacteria | 1943 |
| 232 | Ga0105237_10879665 | 3300009545 | Bacteria | 903 |
| 233 | Ga0105237_10897678 | 3300009545 | Unclassified | 893 |
| 234 | Ga0105238_10002748 | 3300009551 | Bacteria | 17541 |
| 235 | Ga0105238_10002897 | 3300009551 | Bacteria | 17138 |
| 236 | Ga0105238_10002962 | 3300009551 | Bacteria | 16952 |
| 237 | Ga0105238_10022218 | 3300009551 | Bacteria | 6468 |
| 238 | Ga0105238_10022657 | 3300009551 | Bacteria | 6402 |
| 239 | Ga0105238_10039484 | 3300009551 | Bacteria | 4787 |
| 240 | Ga0105238_10043198 | 3300009551 | Unclassified | 4561 |
| 241 | Ga0105238_10202443 | 3300009551 | Unclassified | 1961 |
| 242 | Ga0105238_10322120 | 3300009551 | Bacteria | 1532 |
| 243 | Ga0105238_10467764 | 3300009551 | Bacteria | 1259 |
| 244 | Ga0105238_10668942 | 3300009551 | Bacteria | 1049 |
| 245 | Ga0105238_10817560 | 3300009551 | Bacteria | 948 |
| 246 | Ga0105238_11221095 | 3300009551 | Unclassified | 776 |
| 247 | Ga0105249_10008277 | 3300009553 | Bacteria | 9058 |
| 248 | Ga0105249_10394464 | 3300009553 | Bacteria | 1413 |
| 249 | Ga0105249_10539059 | 3300009553 | Bacteria | 1216 |
| 250 | Ga0105239_10004459 | 3300010375 | Bacteria | 16734 |
| 251 | Ga0105239_10006516 | 3300010375 | Bacteria | 13532 |
| 252 | Ga0105239_10006798 | 3300010375 | Bacteria | 13201 |
| 253 | Ga0105239_10010535 | 3300010375 | Bacteria | 10336 |
| 254 | Ga0105239_10083921 | 3300010375 | Bacteria | 3509 |
| 255 | Ga0105239_10089374 | 3300010375 | Unclassified | 3397 |
| 256 | Ga0105239_10177949 | 3300010375 | Bacteria | 2379 |
| 257 | Ga0105239_10182154 | 3300010375 | Unclassified | 2350 |
| 258 | Ga0105239_10393767 | 3300010375 | Bacteria | 1567 |
| 259 | Ga0105239_10464802 | 3300010375 | Bacteria | 1436 |
| 260 | Ga0105246_10002236 | 3300011119 | Bacteria | 11676 |
| 261 | Ga0105246_10046176 | 3300011119 | Bacteria | 2970 |
| 262 | Ga0105246_10047658 | 3300011119 | Bacteria | 2927 |
| 263 | Ga0105246_10123487 | 3300011119 | Bacteria | 1922 |
| 264 | Ga0157370_10003269 | 3300013104 | Bacteria | 19101 |
| 265 | Ga0157370_10005361 | 3300013104 | Bacteria | 14397 |
| 266 | Ga0157370_10005815 | 3300013104 | Bacteria | 13780 |
| 267 | Ga0157370_10011955 | 3300013104 | Bacteria | 9047 |
| 268 | Ga0157370_10052168 | 3300013104 | Bacteria | 3905 |
| 269 | Ga0157370_11119180 | 3300013104 | Unclassified | 711 |
| 270 | Ga0157369_10001386 | 3300013105 | Bacteria | 29854 |
| 271 | Ga0157369_10038688 | 3300013105 | Bacteria | 5216 |
| 272 | Ga0157369_10055382 | 3300013105 | Unclassified | 4281 |
| 273 | Ga0157369_10123947 | 3300013105 | Bacteria | 2741 |
| 274 | Ga0157369_10152926 | 3300013105 | Bacteria | 2439 |
| 275 | Ga0157369_10258931 | 3300013105 | Bacteria | 1815 |
| 276 | Ga0157369_10711197 | 3300013105 | Bacteria | 1034 |
| 277 | Ga0157369_11386613 | 3300013105 | Unclassified | 716 |
| 278 | Ga0157374_10002706 | 3300013296 | Bacteria | 14907 |
| 279 | Ga0157374_10032316 | 3300013296 | Bacteria | 4763 |
| 280 | Ga0157374_10228341 | 3300013296 | Unclassified | 1828 |
| 281 | Ga0157374_10288512 | 3300013296 | Viruses | 1621 |
| 282 | Ga0157374_10489155 | 3300013296 | Bacteria | 1234 |
| 283 | Ga0157374_10680636 | 3300013296 | Bacteria | 1041 |
| 284 | Ga0157378_10003111 | 3300013297 | Bacteria | 14750 |
| 285 | Ga0157378_10046322 | 3300013297 | Bacteria | 3866 |
| 286 | Ga0157378_10076701 | 3300013297 | Bacteria | 3012 |
| 287 | Ga0157378_10393935 | 3300013297 | Bacteria | 1363 |
| 288 | Ga0157378_10487230 | 3300013297 | Bacteria | 1230 |
| 289 | Ga0157378_11071778 | 3300013297 | Unclassified | 842 |
| 290 | Ga0163162_10030661 | 3300013306 | Bacteria | 5329 |
| 291 | Ga0163162_10067948 | 3300013306 | Bacteria | 3615 |
| 292 | Ga0163162_10123450 | 3300013306 | Viruses | 2695 |
| 293 | Ga0163162_10147225 | 3300013306 | Bacteria | 2471 |
| 294 | Ga0163162_10284161 | 3300013306 | Bacteria | 1786 |
| 295 | Ga0163162_10668454 | 3300013306 | Unclassified | 1162 |
| 296 | Ga0163162_11925696 | 3300013306 | Unclassified | 677 |
| 297 | Ga0157372_10000940 | 3300013307 | Bacteria | 31773 |
| 298 | Ga0157372_10004118 | 3300013307 | Bacteria | 15587 |
| 299 | Ga0157372_10074591 | 3300013307 | Unclassified | 3826 |
| 300 | Ga0157372_10076927 | 3300013307 | Bacteria | 3769 |
| 301 | Ga0157372_10251607 | 3300013307 | Bacteria | 2051 |
| 302 | Ga0157372_10337808 | 3300013307 | Bacteria | 1754 |
| 303 | Ga0157375_10008481 | 3300013308 | Bacteria | 9001 |
| 304 | Ga0157375_10036509 | 3300013308 | Bacteria | 4702 |
| 305 | Ga0157375_11084215 | 3300013308 | Unclassified | 937 |
| 306 | Ga0157375_11319587 | 3300013308 | Bacteria | 849 |
| 307 | Ga0157375_11444423 | 3300013308 | Unclassified | 811 |
| 308 | Ga0157375_11451561 | 3300013308 | Bacteria | 809 |
| 309 | Ga0157375_12580063 | 3300013308 | Unclassified | 607 |
| 310 | Ga0163163_10008943 | 3300014325 | Bacteria | 8921 |
| 311 | Ga0163163_10023757 | 3300014325 | Viruses | 5824 |
| 312 | Ga0163163_10045702 | 3300014325 | Bacteria | 4299 |
| 313 | Ga0163163_10223101 | 3300014325 | Bacteria | 1934 |
| 314 | Ga0163163_10506156 | 3300014325 | Bacteria | 1270 |
| 315 | Ga0163163_10729299 | 3300014325 | Bacteria | 1054 |
| 316 | Ga0163163_11182197 | 3300014325 | Unclassified | 827 |
| 317 | Ga0163163_11544532 | 3300014325 | Unclassified | 725 |
| 318 | Ga0157380_11980900 | 3300014326 | Unclassified | 644 |
| 319 | Ga0157379_10133217 | 3300014968 | Unclassified | 2238 |
| 320 | Ga0157379_10169469 | 3300014968 | Bacteria | 1971 |
| 321 | Ga0157376_10008361 | 3300014969 | Bacteria | 7463 |
| 322 | Ga0157376_10024410 | 3300014969 | Unclassified | 4746 |
| 323 | Ga0157376_10039132 | 3300014969 | Bacteria | 3864 |
| 324 | Ga0157376_10572272 | 3300014969 | Unclassified | 1121 |
| 325 | Ga0157376_11081516 | 3300014969 | Unclassified | 827 |
| 326 | Ga0157376_12058066 | 3300014969 | Unclassified | 609 |
| 327 | Ga0157376_12182027 | 3300014969 | Unclassified | 592 |
| 328 | Ga0197907_10306262 | 3300020069 | Unclassified | 773 |
| 329 | Ga0206356_10299373 | 3300020070 | Unclassified | 746 |
| 330 | Ga0206356_10741037 | 3300020070 | Unclassified | 615 |
| 331 | Ga0206355_1273913 | 3300020076 | Unclassified | 967 |
| 332 | Ga0206355_1496514 | 3300020076 | Unclassified | 823 |
| 333 | Ga0206355_1611549 | 3300020076 | Unclassified | 791 |
| 334 | Ga0206352_10211364 | 3300020078 | Bacteria | 1525 |
| 335 | Ga0213874_10191108 | 3300021377 | Unclassified | 732 |
| 336 | Ga0213876_10252057 | 3300021384 | Bacteria | 938 |
| 337 | Ga0213875_10003217 | 3300021388 | Bacteria | 9379 |
| 338 | Ga0224712_10078853 | 3300022467 | Bacteria | 1355 |
| 339 | Ga0207656_10230483 | 3300025321 | Bacteria | 903 |
| 340 | Ga0207692_10607158 | 3300025898 | Unclassified | 704 |
| 341 | Ga0207642_10076852 | 3300025899 | Bacteria | 1609 |
| 342 | Ga0207680_10023532 | 3300025903 | Bacteria | 3366 |
| 343 | Ga0207699_10081662 | 3300025906 | Bacteria | 2006 |
| 344 | Ga0207643_10459317 | 3300025908 | Bacteria | 811 |
| 345 | Ga0207705_10126838 | 3300025909 | Bacteria | 1897 |
| 346 | Ga0207705_11232893 | 3300025909 | Unclassified | 573 |
| 347 | Ga0207654_10003898 | 3300025911 | Bacteria | 7520 |
| 348 | Ga0207654_10005400 | 3300025911 | Bacteria | 6461 |
| 349 | Ga0207654_10014963 | 3300025911 | Bacteria | 4017 |
| 350 | Ga0207654_10056621 | 3300025911 | Bacteria | 2275 |
| 351 | Ga0207654_10234301 | 3300025911 | Bacteria | 1224 |
| 352 | Ga0207707_10001064 | 3300025912 | Bacteria | 26311 |
| 353 | Ga0207707_10069823 | 3300025912 | Bacteria | 3062 |
| 354 | Ga0207707_10106835 | 3300025912 | Bacteria | 2447 |
| 355 | Ga0207707_10143225 | 3300025912 | Viruses | 2089 |
| 356 | Ga0207707_10233997 | 3300025912 | Bacteria | 1598 |
| 357 | Ga0207707_10361312 | 3300025912 | Unclassified | 1250 |
| 358 | Ga0207707_10669140 | 3300025912 | Bacteria | 874 |
| 359 | Ga0207695_10000736 | 3300025913 | Bacteria | 63434 |
| 360 | Ga0207695_10006825 | 3300025913 | Bacteria | 14701 |
| 361 | Ga0207695_10009719 | 3300025913 | Bacteria | 11840 |
| 362 | Ga0207695_10024452 | 3300025913 | Bacteria | 6797 |
| 363 | Ga0207695_10036777 | 3300025913 | Bacteria | 5289 |
| 364 | Ga0207695_10092564 | 3300025913 | Unclassified | 3033 |
| 365 | Ga0207695_10192162 | 3300025913 | Bacteria | 1959 |
| 366 | Ga0207695_10237607 | 3300025913 | Bacteria | 1724 |
| 367 | Ga0207695_10263549 | 3300025913 | Unclassified | 1620 |
| 368 | Ga0207695_10386203 | 3300025913 | Bacteria | 1285 |
| 369 | Ga0207695_10400962 | 3300025913 | Bacteria | 1256 |
| 370 | Ga0207671_10028988 | 3300025914 | Bacteria | 4135 |
| 371 | Ga0207671_10032809 | 3300025914 | Unclassified | 3864 |
| 372 | Ga0207671_10066169 | 3300025914 | Unclassified | 2690 |
| 373 | Ga0207671_10188773 | 3300025914 | Bacteria | 1606 |
| 374 | Ga0207671_10283352 | 3300025914 | Bacteria | 1307 |
| 375 | Ga0207693_10822660 | 3300025915 | Unclassified | 715 |
| 376 | Ga0207663_10124017 | 3300025916 | Bacteria | 1774 |
| 377 | Ga0207663_10268789 | 3300025916 | Unclassified | 1262 |
| 378 | Ga0207663_10510416 | 3300025916 | Unclassified | 935 |
| 379 | Ga0207660_10001472 | 3300025917 | Bacteria | 15850 |
| 380 | Ga0207660_10010369 | 3300025917 | Bacteria | 6045 |
| 381 | Ga0207660_10037948 | 3300025917 | Unclassified | 3360 |
| 382 | Ga0207660_10358655 | 3300025917 | Viruses | 1169 |
| 383 | Ga0207657_10002373 | 3300025919 | Bacteria | 20369 |
| 384 | Ga0207657_10058904 | 3300025919 | Bacteria | 3303 |
| 385 | Ga0207657_10106806 | 3300025919 | Unclassified | 2316 |
| 386 | Ga0207657_10340660 | 3300025919 | Bacteria | 1183 |
| 387 | Ga0207657_10476877 | 3300025919 | Bacteria | 978 |
| 388 | Ga0207649_10248645 | 3300025920 | Unclassified | 1280 |
| 389 | Ga0207649_10744332 | 3300025920 | Unclassified | 762 |
| 390 | Ga0207652_10004167 | 3300025921 | Bacteria | 11795 |
| 391 | Ga0207652_10194845 | 3300025921 | Viruses | 1823 |
| 392 | Ga0207652_10332783 | 3300025921 | Bacteria | 1371 |
| 393 | Ga0207694_10000596 | 3300025924 | Bacteria | 32639 |
| 394 | Ga0207694_10009372 | 3300025924 | Bacteria | 7384 |
| 395 | Ga0207694_10019850 | 3300025924 | Bacteria | 5084 |
| 396 | Ga0207694_10041862 | 3300025924 | Bacteria | 3531 |
| 397 | Ga0207694_10256961 | 3300025924 | Bacteria | 1430 |
| 398 | Ga0207694_10262071 | 3300025924 | Unclassified | 1416 |
| 399 | Ga0207694_10329727 | 3300025924 | Bacteria | 1261 |
| 400 | Ga0207659_10484304 | 3300025926 | Bacteria | 1045 |
| 401 | Ga0207687_10003886 | 3300025927 | Bacteria | 10030 |
| 402 | Ga0207687_10007395 | 3300025927 | Bacteria | 7230 |
| 403 | Ga0207687_10008651 | 3300025927 | Bacteria | 6653 |
| 404 | Ga0207687_10011455 | 3300025927 | Bacteria | 5796 |
| 405 | Ga0207687_10319671 | 3300025927 | Unclassified | 1256 |
| 406 | Ga0207687_10342340 | 3300025927 | Bacteria | 1216 |
| 407 | Ga0207687_10370136 | 3300025927 | Bacteria | 1171 |
| 408 | Ga0207687_10423832 | 3300025927 | Bacteria | 1098 |
| 409 | Ga0207700_10083365 | 3300025928 | Bacteria | 2503 |
| 410 | Ga0207700_10209603 | 3300025928 | Unclassified | 1647 |
| 411 | Ga0207664_10019746 | 3300025929 | Unclassified | 4988 |
| 412 | Ga0207664_10856278 | 3300025929 | Unclassified | 817 |
| 413 | Ga0207644_10113967 | 3300025931 | Bacteria | 2048 |
| 414 | Ga0207644_10242278 | 3300025931 | Unclassified | 1436 |
| 415 | Ga0207644_10413376 | 3300025931 | Unclassified | 1104 |
| 416 | Ga0207690_10343530 | 3300025932 | Unclassified | 1179 |
| 417 | Ga0207706_10061616 | 3300025933 | Bacteria | 3303 |
| 418 | Ga0207686_10039780 | 3300025934 | Unclassified | 2854 |
| 419 | Ga0207686_10069356 | 3300025934 | Bacteria | 2261 |
| 420 | Ga0207686_10158359 | 3300025934 | Bacteria | 1584 |
| 421 | Ga0207686_10956932 | 3300025934 | Unclassified | 693 |
| 422 | Ga0207709_10009378 | 3300025935 | Bacteria | 5385 |
| 423 | Ga0207709_10030995 | 3300025935 | Unclassified | 3117 |
| 424 | Ga0207669_11203932 | 3300025937 | Unclassified | 642 |
| 425 | Ga0207704_10047044 | 3300025938 | Unclassified | 2576 |
| 426 | Ga0207704_10872033 | 3300025938 | Unclassified | 755 |
| 427 | Ga0207691_10280822 | 3300025940 | Bacteria | 1433 |
| 428 | Ga0207691_10339044 | 3300025940 | Bacteria | 1287 |
| 429 | Ga0207711_10002369 | 3300025941 | Bacteria | 16871 |
| 430 | Ga0207711_10005641 | 3300025941 | Bacteria | 10577 |
| 431 | Ga0207711_10024130 | 3300025941 | Bacteria | 5090 |
| 432 | Ga0207711_10207666 | 3300025941 | Bacteria | 1789 |
| 433 | Ga0207711_10213401 | 3300025941 | Bacteria | 1763 |
| 434 | Ga0207711_10378150 | 3300025941 | Bacteria | 1314 |
| 435 | Ga0207711_10442611 | 3300025941 | Unclassified | 1209 |
| 436 | Ga0207711_10453750 | 3300025941 | Bacteria | 1193 |
| 437 | Ga0207711_10860792 | 3300025941 | Bacteria | 843 |
| 438 | Ga0207711_11431294 | 3300025941 | Bacteria | 634 |
| 439 | Ga0207689_10020007 | 3300025942 | Bacteria | 5638 |
| 440 | Ga0207689_10267167 | 3300025942 | Bacteria | 1416 |
| 441 | Ga0207689_10325405 | 3300025942 | Unclassified | 1276 |
| 442 | Ga0207689_11005614 | 3300025942 | Unclassified | 703 |
| 443 | Ga0207661_10000034 | 3300025944 | Bacteria | 154138 |
| 444 | Ga0207661_10005010 | 3300025944 | Bacteria | 9286 |
| 445 | Ga0207661_10022058 | 3300025944 | Unclassified | 4786 |
| 446 | Ga0207661_10129392 | 3300025944 | Bacteria | 2160 |
| 447 | Ga0207661_10219924 | 3300025944 | Bacteria | 1678 |
| 448 | Ga0207661_10695457 | 3300025944 | Unclassified | 935 |
| 449 | Ga0207661_10917688 | 3300025944 | Bacteria | 807 |
| 450 | Ga0207679_10340032 | 3300025945 | Unclassified | 1305 |
| 451 | Ga0207679_10957802 | 3300025945 | Unclassified | 784 |
| 452 | Ga0207679_10997973 | 3300025945 | Unclassified | 767 |
| 453 | Ga0207667_10000286 | 3300025949 | Bacteria | 69623 |
| 454 | Ga0207667_10002312 | 3300025949 | Bacteria | 23885 |
| 455 | Ga0207667_10006895 | 3300025949 | Bacteria | 13724 |
| 456 | Ga0207667_10013803 | 3300025949 | Bacteria | 9229 |
| 457 | Ga0207667_10015881 | 3300025949 | Bacteria | 8527 |
| 458 | Ga0207667_10050549 | 3300025949 | Unclassified | 4385 |
| 459 | Ga0207667_10117880 | 3300025949 | Unclassified | 2736 |
| 460 | Ga0207667_10134311 | 3300025949 | Unclassified | 2548 |
| 461 | Ga0207667_10171762 | 3300025949 | Unclassified | 2228 |
| 462 | Ga0207667_10212101 | 3300025949 | Bacteria | 1985 |
| 463 | Ga0207651_10043824 | 3300025960 | Unclassified | 2989 |
| 464 | Ga0207651_11058634 | 3300025960 | Bacteria | 726 |
| 465 | Ga0207712_10091979 | 3300025961 | Unclassified | 2235 |
| 466 | Ga0207712_10282552 | 3300025961 | Bacteria | 1355 |
| 467 | Ga0207712_10941366 | 3300025961 | Unclassified | 765 |
| 468 | Ga0207640_10011159 | 3300025981 | Bacteria | 5081 |
| 469 | Ga0207658_10383032 | 3300025986 | Unclassified | 1232 |
| 470 | Ga0207677_10047405 | 3300026023 | Unclassified | 2885 |
| 471 | Ga0207677_10059654 | 3300026023 | Unclassified | 2632 |
| 472 | Ga0207677_10487105 | 3300026023 | Bacteria | 1064 |
| 473 | Ga0207703_10005985 | 3300026035 | Bacteria | 9745 |
| 474 | Ga0207703_10114605 | 3300026035 | Bacteria | 2305 |
| 475 | Ga0207703_10225387 | 3300026035 | Bacteria | 1678 |
| 476 | Ga0207703_10342353 | 3300026035 | Unclassified | 1375 |
| 477 | Ga0207703_10602125 | 3300026035 | Unclassified | 1039 |
| 478 | Ga0207703_10737801 | 3300026035 | Bacteria | 938 |
| 479 | Ga0207703_11307607 | 3300026035 | Bacteria | 697 |
| 480 | Ga0207639_10011143 | 3300026041 | Bacteria | 6238 |
| 481 | Ga0207639_10069567 | 3300026041 | Bacteria | 2747 |
| 482 | Ga0207639_10069804 | 3300026041 | Unclassified | 2742 |
| 483 | Ga0207639_10223018 | 3300026041 | Bacteria | 1629 |
| 484 | Ga0207702_10066028 | 3300026078 | Bacteria | 3100 |
| 485 | Ga0207702_10159328 | 3300026078 | Bacteria | 2060 |
| 486 | Ga0207702_10436860 | 3300026078 | Bacteria | 1268 |
| 487 | Ga0207702_10461738 | 3300026078 | Bacteria | 1233 |
| 488 | Ga0207702_10526009 | 3300026078 | Bacteria | 1155 |
| 489 | Ga0207702_10804003 | 3300026078 | Unclassified | 929 |
| 490 | Ga0207702_10959475 | 3300026078 | Bacteria | 848 |
| 491 | Ga0207702_11052111 | 3300026078 | Unclassified | 808 |
| 492 | Ga0207641_10107739 | 3300026088 | Unclassified | 2465 |
| 493 | Ga0207641_10115286 | 3300026088 | Bacteria | 2389 |
| 494 | Ga0207641_10276618 | 3300026088 | Bacteria | 1577 |
| 495 | Ga0207648_10081127 | 3300026089 | Viruses | 2830 |
| 496 | Ga0207648_10084152 | 3300026089 | Bacteria | 2774 |
| 497 | Ga0207648_10095543 | 3300026089 | Bacteria | 2600 |
| 498 | Ga0207676_10045779 | 3300026095 | Unclassified | 3382 |
| 499 | Ga0207676_10524561 | 3300026095 | Bacteria | 1128 |
| 500 | Ga0207676_10660176 | 3300026095 | Bacteria | 1010 |
| 501 | Ga0207676_10843511 | 3300026095 | Bacteria | 896 |
| 502 | Ga0207676_11906650 | 3300026095 | Unclassified | 593 |
| 503 | Ga0207674_10000598 | 3300026116 | Bacteria | 47476 |
| 504 | Ga0207674_10002054 | 3300026116 | Bacteria | 25559 |
| 505 | Ga0207674_10007040 | 3300026116 | Bacteria | 13150 |
| 506 | Ga0207674_10016379 | 3300026116 | Bacteria | 8116 |
| 507 | Ga0207674_10029344 | 3300026116 | Bacteria | 5790 |
| 508 | Ga0207674_10149267 | 3300026116 | Bacteria | 2295 |
| 509 | Ga0207683_10072584 | 3300026121 | Bacteria | 3044 |
| 510 | Ga0207698_10011678 | 3300026142 | Bacteria | 5707 |
| 511 | Ga0207698_10020874 | 3300026142 | Unclassified | 4518 |
| 512 | Ga0207698_10388397 | 3300026142 | Unclassified | 1330 |
| 513 | Ga0207698_10621521 | 3300026142 | Unclassified | 1067 |
| 514 | Ga0268266_11033028 | 3300028379 | Bacteria | 795 |
| 515 | Ga0268265_11552167 | 3300028380 | Unclassified | 666 |
| 516 | Ga0268264_10022204 | 3300028381 | Bacteria | 5181 |
| 517 | Ga0268264_10847643 | 3300028381 | Unclassified | 915 |
| 518 | Ga0268264_10955840 | 3300028381 | Bacteria | 862 |
| 519 | Ga0265338_10447312 | 3300028800 | Bacteria | 915 |
| 520 | Ga0265332_10266379 | 3300031238 | Bacteria | 708 |
| 521 | Ga0265325_10007620 | 3300031241 | Bacteria | 6472 |
| 522 | Ga0265340_10191775 | 3300031247 | Unclassified | 921 |
| 523 | Ga0265340_10257000 | 3300031247 | Bacteria | 778 |
| 524 | Ga0265339_10097048 | 3300031249 | Bacteria | 1538 |
| 525 | Ga0265339_10114933 | 3300031249 | Bacteria | 1389 |
| 526 | Ga0265331_10060690 | 3300031250 | Bacteria | 1786 |
| 527 | Ga0265331_10125460 | 3300031250 | Bacteria | 1173 |
| 528 | Ga0265331_10139093 | 3300031250 | Unclassified | 1105 |
| 529 | Ga0265331_10302811 | 3300031250 | Unclassified | 716 |
| 530 | Ga0265316_10003417 | 3300031344 | Bacteria | 16066 |
| 531 | Ga0265316_10003861 | 3300031344 | Bacteria | 15027 |
| 532 | Ga0265316_10051590 | 3300031344 | Bacteria | 3230 |
| 533 | Ga0265316_10056432 | 3300031344 | Bacteria | 3067 |
| 534 | Ga0265316_10086751 | 3300031344 | Bacteria | 2392 |
| 535 | Ga0265316_10088282 | 3300031344 | Bacteria | 2368 |
| 536 | Ga0265316_10118687 | 3300031344 | Bacteria | 1999 |
| 537 | Ga0265316_10239243 | 3300031344 | Bacteria | 1335 |
| 538 | Ga0265316_10252549 | 3300031344 | Bacteria | 1294 |
| 539 | Ga0265316_10298882 | 3300031344 | Bacteria | 1173 |
| 540 | Ga0265313_10041165 | 3300031595 | Bacteria | 2279 |
| 541 | Ga0265313_10159814 | 3300031595 | Unclassified | 958 |
| 542 | Ga0265313_10167425 | 3300031595 | Bacteria | 930 |
| 543 | Ga0265313_10327543 | 3300031595 | Bacteria | 611 |
| 544 | Ga0265314_10002505 | 3300031711 | Bacteria | 18734 |
| 545 | Ga0265314_10006404 | 3300031711 | Bacteria | 10431 |
| 546 | Ga0265314_10032317 | 3300031711 | Bacteria | 3850 |
| 547 | Ga0373926_0030072 | 3300035083 | Bacteria | 1911 |
| 548 | Ga0373926_0240760 | 3300035083 | Unclassified | 700 |
| 549 | Ga0373934_0000702 | 3300035086 | Bacteria | 11971 |
| 550 | Ga0373944_0360586 | 3300035089 | Unclassified | 554 |
| 551 | Ga0373945_0070509 | 3300035116 | Bacteria | 1322 |
| 552 | Ga0373953_0007112 | 3300035117 | Bacteria | 3730 |
| 553 | Ga0373953_0009909 | 3300035117 | Bacteria | 3300 |
| 554 | Ga0373953_0365451 | 3300035117 | Unclassified | 633 |
| 555 | Ga0373954_0003460 | 3300035118 | Bacteria | 6696 |
| 556 | Ga0373954_0070698 | 3300035118 | Unclassified | 1658 |
| 557 | Ga0373954_0107145 | 3300035118 | Bacteria | 1350 |
| 558 | Ga0373956_0014046 | 3300035119 | Bacteria | 3340 |
| 559 | Ga0373956_0071812 | 3300035119 | Bacteria | 1580 |
| 560 | Ga0373957_0204554 | 3300035120 | Bacteria | 823 |
| 561 | Ga0373960_0295682 | 3300035121 | Unclassified | 601 |
| 562 | Ga0373943_0027185 | 3300035170 | Bacteria | 2686 |
| 563 | Ga0373943_0067611 | 3300035170 | Unclassified | 1802 |
| 564 | Ga0373946_0037373 | 3300035171 | Bacteria | 1973 |
| 565 | Ga0373946_0268748 | 3300035171 | Unclassified | 836 |
| 566 | Ga0373946_0568274 | 3300035171 | Unclassified | 586 |
| 567 | Ga0373955_0025520 | 3300035172 | Bacteria | 3036 |
| 568 | Ga0373955_0044205 | 3300035172 | Bacteria | 2398 |
| 569 | Ga0373955_0188268 | 3300035172 | Bacteria | 1226 |
| 570 | Ga0373955_0188343 | 3300035172 | Unclassified | 1226 |
| 571 | Ga0373924_0008858 | 3300035410 | Bacteria | 3672 |
| 572 | Ga0373935_0104847 | 3300035692 | Bacteria | 1869 |
| 573 | Ga0373935_0126018 | 3300035692 | Bacteria | 1716 |
| 574 | Ga0373935_0310383 | 3300035692 | Bacteria | 1117 |
| 575 | Ga0373935_0786176 | 3300035692 | Bacteria | 702 |
| 576 | Ga0373927_0000406 | 3300035695 | Bacteria | 33145 |
| 577 | Ga0373927_0054900 | 3300035695 | Bacteria | 2577 |
| 578 | Ga0373927_0172438 | 3300035695 | Unclassified | 1418 |
| 579 | Ga0373927_0265530 | 3300035695 | Bacteria | 1129 |
| 580 | Ga0373933_0245451 | 3300035724 | Bacteria | 1152 |
| 581 | Ga0373933_0387255 | 3300035724 | Unclassified | 911 |
| 582 | Ga0373933_0637630 | 3300035724 | Unclassified | 700 |
| 583 | Ga0373947_0000515 | 3300035725 | Bacteria | 22532 |
| 584 | Ga0373947_0107903 | 3300035725 | Bacteria | 1756 |
| 585 | Ga0373947_0384445 | 3300035725 | Bacteria | 945 |
| 586 | Ga0373947_0970635 | 3300035725 | Bacteria | 580 |
| 587 | Ga0373937_0007859 | 3300036401 | Bacteria | 9246 |
| 588 | Ga0373937_0100915 | 3300036401 | Bacteria | 2678 |
| 589 | Ga0373937_0226283 | 3300036401 | Bacteria | 1761 |
| 590 | Ga0373937_0427729 | 3300036401 | Unclassified | 1257 |
| 591 | Ga0373937_1275379 | 3300036401 | Unclassified | 683 |
| 592 | Ga0373925_0000805 | 3300037068 | Bacteria | 28892 |
| 593 | Ga0373925_0055110 | 3300037068 | Bacteria | 2975 |
| 594 | Ga0373925_0068515 | 3300037068 | Bacteria | 2679 |
| 595 | Ga0373925_0070049 | 3300037068 | Bacteria | 2650 |
| 596 | Ga0373925_0099470 | 3300037068 | Bacteria | 2234 |
| 597 | Ga0373925_0172656 | 3300037068 | Bacteria | 1707 |
| 598 | Ga0373925_0282067 | 3300037068 | Bacteria | 1338 |
| 599 | Ga0395900_0336524 | 3300037418 | Bacteria | 1486 |
| 600 | Ga0395905_0659466 | 3300037471 | Unclassified | 948 |
| 601 | Ga0395905_0725780 | 3300037471 | Unclassified | 896 |
| 602 | Ga0436364_0114467 | 3300037853 | Bacteria | 1057 |
| 603 | Ga0436364_0250279 | 3300037853 | Bacteria | 6471 |
| 604 | Ga0436365_0303955 | 3300039437 | Bacteria | 1372 |
| 605 | Ga0436365_0851550 | 3300039437 | Bacteria | 1736 |
| 606 | Ga0436365_1891567 | 3300039437 | Bacteria | 1044 |
| 607 | Ga0436360_0254837 | 3300039438 | Bacteria | 7127 |
| 608 | Ga0436363_0266634 | 3300039450 | Unclassified | 1099 |
| 609 | Ga0436363_1006948 | 3300039450 | Bacteria | 2382 |
| 610 | Ga0436362_0210836 | 3300039453 | Bacteria | 1413 |
| 611 | Ga0436362_0871999 | 3300039453 | Bacteria | 3070 |
| 612 | Ga0439448_0064983 | 3300042005 | Unclassified | 1209 |
| 613 | Ga0451577_1142871 | 3300042876 | Bacteria | 696 |
| 614 | Ga0466965_0302852 | 3300044683 | Unclassified | 868 |
| 615 | Ga0466963_0277080 | 3300044694 | Unclassified | 1179 |
| 616 | Ga0466963_0606627 | 3300044694 | Unclassified | 773 |
| 617 | Ga0453684_0412689 | 3300044712 | Bacteria | 1510 |
| 618 | Ga0451576_0021663 | 3300045051 | Bacteria | 6983 |
| 619 | Ga0451576_0540860 | 3300045051 | Bacteria | 1224 |
| 620 | Ga0466958_0332441 | 3300045836 | Unclassified | 977 |
| 621 | Ga0466967_0812123 | 3300045976 | Unclassified | 929 |
| 622 | Ga0495651_0191308 | 3300046462 | Unclassified | 1440 |
| 623 | Ga0495651_0642030 | 3300046462 | Bacteria | 666 |
| 624 | Ga0495651_0771833 | 3300046462 | Unclassified | 595 |
| 625 | Ga0495580_0005431 | 3300046472 | Bacteria | 10532 |
| 626 | Ga0495580_0066450 | 3300046472 | Unclassified | 2524 |
| 627 | Ga0495580_0111752 | 3300046472 | Bacteria | 1897 |
| 628 | Ga0495580_0353183 | 3300046472 | Unclassified | 996 |
| 629 | Ga0495582_0022975 | 3300046473 | Bacteria | 3411 |
| 630 | Ga0495582_0256932 | 3300046473 | Bacteria | 1002 |
| 631 | Ga0495662_0091200 | 3300046476 | Bacteria | 1486 |
| 632 | Ga0495664_0138984 | 3300046477 | Bacteria | 1472 |
| 633 | Ga0495664_0165478 | 3300046477 | Bacteria | 1342 |
| 634 | Ga0495594_0200956 | 3300046499 | Bacteria | 1136 |
| 635 | Ga0495594_0227115 | 3300046499 | Bacteria | 1064 |
| 636 | Ga0495628_0539293 | 3300046516 | Unclassified | 839 |
| 637 | Ga0495630_0445287 | 3300046517 | Bacteria | 992 |
| 638 | Ga0495630_0579652 | 3300046517 | Unclassified | 860 |
| 639 | Ga0495666_0355740 | 3300046526 | Bacteria | 659 |
| 640 | Ga0495642_0308479 | 3300046528 | Bacteria | 694 |
| 641 | Ga0495652_0275021 | 3300046529 | Bacteria | 1236 |
| 642 | Ga0495652_0467981 | 3300046529 | Bacteria | 879 |
| 643 | Ga0495652_0995512 | 3300046529 | Unclassified | 549 |
| 644 | Ga0495665_0047438 | 3300046531 | Bacteria | 2278 |
| 645 | Ga0495640_0443953 | 3300046533 | Unclassified | 793 |
| 646 | Ga0495586_0183776 | 3300046535 | Unclassified | 1183 |
| 647 | Ga0495586_0355964 | 3300046535 | Unclassified | 841 |
| 648 | Ga0495587_0001072 | 3300046536 | Bacteria | 17978 |
| 649 | Ga0495587_0060907 | 3300046536 | Bacteria | 2212 |
| 650 | Ga0495587_0093310 | 3300046536 | Unclassified | 1738 |
| 651 | Ga0495645_0041606 | 3300046543 | Bacteria | 3351 |
| 652 | Ga0495645_0626639 | 3300046543 | Unclassified | 659 |
| 653 | Ga0495667_0167919 | 3300046559 | Unclassified | 1410 |
| 654 | Ga0495635_0330020 | 3300046663 | Bacteria | 1020 |
| 655 | Ga0495635_0366984 | 3300046663 | Unclassified | 959 |
| 656 | Ga0495635_0848131 | 3300046663 | Unclassified | 587 |
| 657 | Ga0495657_0458197 | 3300046675 | Unclassified | 746 |
| 658 | Ga0495599_0613013 | 3300046678 | Bacteria | 633 |
| 659 | Ga0495623_0049848 | 3300046679 | Unclassified | 2653 |
| 660 | Ga0495623_0189417 | 3300046679 | Bacteria | 1190 |
| 661 | Ga0495623_0252054 | 3300046679 | Bacteria | 992 |
| 662 | Ga0495658_0045585 | 3300046683 | Bacteria | 2461 |
| 663 | Ga0495658_0958793 | 3300046683 | Unclassified | 546 |
| 664 | Ga0495613_0226259 | 3300046689 | Bacteria | 1312 |
| 665 | Ga0495613_0484611 | 3300046689 | Unclassified | 834 |
| 666 | Ga0495624_0120379 | 3300046690 | Bacteria | 1612 |
| 667 | Ga0495624_0349819 | 3300046690 | Unclassified | 889 |
| 668 | Ga0495600_0135942 | 3300046809 | Unclassified | 1597 |
| 669 | Ga0495600_0515053 | 3300046809 | Bacteria | 734 |
| 670 | Ga0495581_0581685 | 3300047315 | Unclassified | 649 |
| 671 | Ga0495604_0037257 | 3300047317 | Bacteria | 3831 |
| 672 | Ga0495604_0232804 | 3300047317 | Bacteria | 1263 |
| 673 | Ga0495636_0077910 | 3300047318 | Bacteria | 1423 |
| 674 | Ga0495674_0002309 | 3300047319 | Bacteria | 18707 |
| 675 | Ga0495674_0124106 | 3300047319 | Bacteria | 2180 |
| 676 | Ga0495680_0558457 | 3300047322 | Bacteria | 770 |
| 677 | Ga0495675_0095092 | 3300047444 | Bacteria | 1868 |
| 678 | Ga0495675_0177986 | 3300047444 | Bacteria | 1303 |
| 679 | Ga0495675_0225385 | 3300047444 | Unclassified | 1133 |
| 680 | Ga0495675_0320261 | 3300047444 | Unclassified | 917 |
| 681 | Ga0495675_0616855 | 3300047444 | Bacteria | 614 |
| 682 | Ga0495684_0014766 | 3300047471 | Bacteria | 6013 |
| 683 | Ga0495684_0115406 | 3300047471 | Bacteria | 2024 |
| 684 | Ga0495684_0570769 | 3300047471 | Unclassified | 767 |
| 685 | Ga0495602_0135415 | 3300048088 | Bacteria | 1958 |
| 686 | Ga0495602_0189689 | 3300048088 | Unclassified | 1577 |
| 687 | Ga0495602_0717725 | 3300048088 | Unclassified | 677 |
| 688 | Ga0495602_0795115 | 3300048088 | Unclassified | 636 |
| 689 | Ga0496102_0898899 | 3300048905 | Unclassified | 807 |
| 690 | Ga0496112_0169492 | 3300048915 | Bacteria | 2149 |
| 691 | Ga0496115_0102945 | 3300048918 | Bacteria | 2342 |
| 692 | Ga0496115_0269619 | 3300048918 | Bacteria | 1399 |
| 693 | Ga0496126_0086318 | 3300048929 | Bacteria | 2766 |
| 694 | Ga0501032_0108395 | 3300049569 | Bacteria | 1839 |
| 695 | Ga0501034_0025207 | 3300049571 | Bacteria | 6053 |
| 696 | Ga0501034_0737477 | 3300049571 | Unclassified | 881 |
| 697 | Ga0501038_0222029 | 3300049574 | Unclassified | 1507 |
| 698 | Ga0501039_0773422 | 3300049575 | Unclassified | 749 |
| 699 | Ga0501043_0470366 | 3300049579 | Unclassified | 942 |
| 700 | Ga0501046_0376811 | 3300049580 | Unclassified | 1028 |
| 701 | Ga0501047_0047012 | 3300049581 | Unclassified | 4170 |
| 702 | Ga0501047_0063717 | 3300049581 | Bacteria | 3556 |
| 703 | Ga0501048_0457261 | 3300049582 | Unclassified | 914 |
| 704 | Ga0501070_0019634 | 3300049586 | Bacteria | 5666 |
| 705 | Ga0501073_0138869 | 3300049589 | Unclassified | 1684 |
| 706 | Ga0501035_0008190 | 3300049822 | Bacteria | 9741 |
| 707 | Ga0501044_0001789 | 3300049823 | Bacteria | 25105 |
| 708 | Ga0501044_0002189 | 3300049823 | Bacteria | 22424 |
| 709 | Ga0501044_0153711 | 3300049823 | Bacteria | 2282 |
| 710 | Ga0501044_0574372 | 3300049823 | Bacteria | 1022 |
| 711 | nmdc:mga05p37_886576_c1 | 3300050507 | Bacteria | 964 |
| 712 | nmdc:mga0n895_535578_c1 | 3300050512 | Bacteria | 1178 |
| 713 | nmdc:mga08x19_1007204_c1 | 3300050514 | Bacteria | 592 |
| 714 | nmdc:mga0a205_348771_c1 | 3300050515 | Bacteria | 1348 |
| 715 | Ga0495601_0383737 | 3300053077 | Bacteria | 912 |
| 716 | Ga0495612_0278423 | 3300053078 | Unclassified | 747 |
| 717 | Ga0495595_0343945 | 3300053084 | Bacteria | 752 |
| 718 | Ga0495619_0874804 | 3300053085 | Bacteria | 605 |
| 719 | Ga0587090_023332 | 3300059510 | Unclassified | 984 |
| 720 | Ga0587092_031146 | 3300059512 | Unclassified | 883 |
| 721 | Ga0587076_044897 | 3300059645 | Unclassified | 840 |
| 722 | Ga0070692_10063638 | |||
| 723 | Ga0070658_10013005 | |||
| 724 | Ga0070658_10095970 | |||
| 725 | Ga0070658_10339728 | |||
| 726 | Ga0070658_10561170 | |||
| 727 | Ga0070658_11044247 | |||
| 728 | Ga0070676_11074629 | |||
| 729 | Ga0070683_100000012 | |||
| 730 | Ga0070683_100012585 | |||
| 731 | Ga0070683_100015704 | |||
| 732 | Ga0070683_100044124 | |||
| 733 | Ga0070683_100067141 | |||
| 734 | Ga0070683_100068898 | |||
| 735 | Ga0070683_100160486 | |||
| 736 | Ga0070683_101010036 | |||
| 737 | Ga0070670_101066321 | |||
| 738 | Ga0070666_10006790 | |||
| 739 | Ga0070680_100173583 | |||
| 740 | Ga0070682_100378417 | |||
| 741 | Ga0068868_100087314 | |||
| 742 | Ga0068868_100115933 | |||
| 743 | Ga0068868_101289433 | |||
| 744 | Ga0070660_100004853 | |||
| 745 | Ga0070660_100046637 | |||
| 746 | Ga0070660_100215593 | |||
| 747 | Ga0070661_100705897 | |||
| 748 | Ga0070668_100552784 | |||
| 749 | Ga0070669_101042334 | |||
| 750 | Ga0070675_100209190 | |||
| 751 | Ga0070675_100606188 | |||
| 752 | Ga0070671_100062671 | |||
| 753 | Ga0070671_100399257 | |||
| 754 | Ga0070673_100154899 | |||
| 755 | Ga0070659_100045635 | |||
| 756 | Ga0070667_100018357 | |||
| 757 | Ga0070709_10010363 | |||
| 758 | Ga0070714_100125612 | |||
| 759 | Ga0070714_100554765 | |||
| 760 | Ga0070713_100008242 | |||
| 761 | Ga0070713_100078359 | |||
| 762 | Ga0070713_100138685 | |||
| 763 | Ga0070713_100292608 | |||
| 764 | Ga0070713_100361954 | |||
| 765 | Ga0070713_100897711 | |||
| 766 | Ga0070710_10210541 | |||
| 767 | Ga0070710_11543189 | |||
| 768 | Ga0070711_100075155 | |||
| 769 | Ga0070711_100193618 | |||
| 770 | Ga0070711_100340741 | |||
| 771 | Ga0070708_100661266 | |||
| 772 | Ga0070678_100057344 | |||
| 773 | Ga0070662_100009879 | |||
| 774 | Ga0070681_10001902 | |||
| 775 | Ga0070681_10033570 | |||
| 776 | Ga0070681_10085379 | |||
| 777 | Ga0070681_10446168 | |||
| 778 | Ga0070681_10883266 | |||
| 779 | Ga0070681_11241175 | |||
| 780 | Ga0068867_100024317 | |||
| 781 | Ga0068867_100076246 | |||
| 782 | Ga0068867_100251980 | |||
| 783 | Ga0068867_100399598 | |||
| 784 | Ga0068867_101297323 | |||
| 785 | Ga0070685_10230856 | |||
| 786 | Ga0070685_10362337 | |||
| 787 | Ga0070679_100289914 | |||
| 788 | Ga0070679_100350680 | |||
| 789 | Ga0070684_100000013 | |||
| 790 | Ga0070684_100011633 | |||
| 791 | Ga0070684_100033990 | |||
| 792 | Ga0070684_100043429 | |||
| 793 | Ga0070684_100069552 | |||
| 794 | Ga0070684_100168846 | |||
| 795 | Ga0070697_100164058 | |||
| 796 | Ga0070697_100265244 | |||
| 797 | Ga0070697_100580970 | |||
| 798 | Ga0068853_100017965 | |||
| 799 | Ga0068853_100088088 | |||
| 800 | Ga0070672_100284751 | |||
| 801 | Ga0070672_100412369 | |||
| 802 | Ga0070695_100313307 | |||
| 803 | Ga0070696_100000050 | |||
| 804 | Ga0070693_100005014 | |||
| 805 | Ga0070693_100614901 | |||
| 806 | Ga0070665_100151511 | |||
| 807 | Ga0070665_100409164 | |||
| 808 | Ga0070665_100611536 | |||
| 809 | Ga0068855_100003939 | |||
| 810 | Ga0068855_100004073 | |||
| 811 | Ga0068855_100010695 | |||
| 812 | Ga0068855_100021220 | |||
| 813 | Ga0068855_100056422 | |||
| 814 | Ga0068855_100088064 | |||
| 815 | Ga0068855_100143830 | |||
| 816 | Ga0068855_100151103 | |||
| 817 | Ga0068855_100177795 | |||
| 818 | Ga0068855_100402687 | |||
| 819 | Ga0068855_100973897 | |||
| 820 | Ga0070664_100008200 | |||
| 821 | Ga0070664_100910018 | |||
| 822 | Ga0068857_100003867 | |||
| 823 | Ga0068857_100018807 | |||
| 824 | Ga0068857_100089179 | |||
| 825 | Ga0068857_100355101 | |||
| 826 | Ga0068856_100020144 | |||
| 827 | Ga0068856_100037499 | |||
| 828 | Ga0068856_100212556 | |||
| 829 | Ga0068856_100247702 | |||
| 830 | Ga0068856_100291547 | |||
| 831 | Ga0068856_100317163 | |||
| 832 | Ga0068856_100861895 | |||
| 833 | Ga0068852_100035376 | |||
| 834 | Ga0068852_100161349 | |||
| 835 | Ga0068852_100339823 | |||
| 836 | Ga0068852_100818692 | |||
| 837 | Ga0068859_100016202 | |||
| 838 | Ga0068859_100201699 | |||
| 839 | Ga0068859_100296810 | |||
| 840 | Ga0068859_100401498 | |||
| 841 | Ga0068859_100429608 | |||
| 842 | Ga0068864_100010390 | |||
| 843 | Ga0068864_100086771 | |||
| 844 | Ga0068864_100341500 | |||
| 845 | Ga0068866_10649702 | |||
| 846 | Ga0068861_100215675 | |||
| 847 | Ga0068863_100028052 | |||
| 848 | Ga0068858_100015361 | |||
| 849 | Ga0068858_100020764 | |||
| 850 | Ga0068858_100051849 | |||
| 851 | Ga0068858_100242210 | |||
| 852 | Ga0068858_100515642 | |||
| 853 | Ga0068858_100664202 | |||
| 854 | Ga0068858_100854395 | |||
| 855 | Ga0068858_101029505 | |||
| 856 | Ga0068858_101378756 | |||
| 857 | Ga0068860_100005436 | |||
| 858 | Ga0068860_100489466 | |||
| 859 | Ga0068860_100546055 | |||
| 860 | Ga0070717_10107359 | |||
| 861 | Ga0070717_10222557 | |||
| 862 | Ga0070717_10427371 | |||
| 863 | Ga0070717_10819033 | |||
| 864 | Ga0070715_10633314 | |||
| 865 | Ga0070716_100129714 | |||
| 866 | Ga0070716_101455247 | |||
| 867 | Ga0070712_101218283 | |||
| 868 | Ga0097621_100008838 | |||
| 869 | Ga0097621_100017903 | |||
| 870 | Ga0097621_100018740 | |||
| 871 | Ga0097621_100050518 | |||
| 872 | Ga0097621_100097086 | |||
| 873 | Ga0068871_100003974 | |||
| 874 | Ga0068871_100013203 | |||
| 875 | Ga0068871_100027475 | |||
| 876 | Ga0068871_100194431 | |||
| 877 | Ga0068871_100316102 | |||
| 878 | Ga0068871_100323177 | |||
| 879 | Ga0068871_100903382 | |||
| 880 | Ga0068871_101109734 | |||
| 881 | Ga0068871_101156349 | |||
| 882 | Ga0075430_100547266 | |||
| 883 | Ga0075431_100927921 | |||
| 884 | Ga0075433_10222829 | |||
| 885 | Ga0075434_100395153 | |||
| 886 | Ga0068865_100032759 | |||
| 887 | Ga0075436_100008326 | |||
| 888 | Ga0075436_100180253 | |||
| 889 | Ga0075436_100766734 | |||
| 890 | Ga0097620_100016202 | |||
| 891 | Ga0097620_100201717 | |||
| 892 | Ga0097620_100296803 | |||
| 893 | Ga0097620_100401484 | |||
| 894 | Ga0097620_100429629 | |||
| 895 | Ga0105240_10001553 | |||
| 896 | Ga0105240_10003003 | |||
| 897 | Ga0105240_10004561 | |||
| 898 | Ga0105240_10106554 | |||
| 899 | Ga0105240_10164160 | |||
| 900 | Ga0105240_10219956 | |||
| 901 | Ga0105240_10236496 | |||
| 902 | Ga0105240_10304419 | |||
| 903 | Ga0105240_10545090 | |||
| 904 | Ga0105240_10718466 | |||
| 905 | Ga0111539_11586767 | |||
| 906 | Ga0105245_10005491 | |||
| 907 | Ga0105245_10005572 | |||
| 908 | Ga0105245_10007447 | |||
| 909 | Ga0105245_10009917 | |||
| 910 | Ga0105245_10173896 | |||
| 911 | Ga0105245_10408905 | |||
| 912 | Ga0105245_10417860 | |||
| 913 | Ga0105245_10494377 | |||
| 914 | Ga0105245_10607520 | |||
| 915 | Ga0105245_11198740 | |||
| 916 | Ga0105245_11803997 | |||
| 917 | Ga0105247_10064005 | |||
| 918 | Ga0105247_10435543 | |||
| 919 | Ga0114129_10155295 | |||
| 920 | Ga0114129_12169972 | |||
| 921 | Ga0105243_10035599 | |||
| 922 | Ga0105243_10422713 | |||
| 923 | Ga0105243_10616827 | |||
| 924 | Ga0105241_10001612 | |||
| 925 | Ga0105241_10006980 | |||
| 926 | Ga0105241_10024647 | |||
| 927 | Ga0105241_10091330 | |||
| 928 | Ga0105241_10258487 | |||
| 929 | Ga0105241_10772895 | |||
| 930 | Ga0105242_10008962 | |||
| 931 | Ga0105242_10033108 | |||
| 932 | Ga0105242_10131113 | |||
| 933 | Ga0105242_10150758 | |||
| 934 | Ga0105242_11065509 | |||
| 935 | Ga0105242_11640765 | |||
| 936 | Ga0105248_10008015 | |||
| 937 | Ga0105248_10009926 | |||
| 938 | Ga0105248_10014462 | |||
| 939 | Ga0105248_10082213 | |||
| 940 | Ga0105248_10124599 | |||
| 941 | Ga0105248_10156917 | |||
| 942 | Ga0105248_10170725 | |||
| 943 | Ga0105248_10332466 | |||
| 944 | Ga0105248_10555737 | |||
| 945 | Ga0105248_10637869 | |||
| 946 | Ga0105248_11222643 | |||
| 947 | Ga0105248_12358296 | |||
| 948 | Ga0105237_10003328 | |||
| 949 | Ga0105237_10009562 | |||
| 950 | Ga0105237_10011412 | |||
| 951 | Ga0105237_10187991 | |||
| 952 | Ga0105237_10210700 | |||
| 953 | Ga0105237_10879665 | |||
| 954 | Ga0105237_10897678 | |||
| 955 | Ga0105238_10002748 | |||
| 956 | Ga0105238_10002897 | |||
| 957 | Ga0105238_10002962 | |||
| 958 | Ga0105238_10022218 | |||
| 959 | Ga0105238_10022657 | |||
| 960 | Ga0105238_10039484 | |||
| 961 | Ga0105238_10043198 | |||
| 962 | Ga0105238_10202443 | |||
| 963 | Ga0105238_10322120 | |||
| 964 | Ga0105238_10467764 | |||
| 965 | Ga0105238_10668942 | |||
| 966 | Ga0105238_10817560 | |||
| 967 | Ga0105238_11221095 | |||
| 968 | Ga0105249_10008277 | |||
| 969 | Ga0105249_10394464 | |||
| 970 | Ga0105249_10539059 | |||
| 971 | Ga0105239_10004459 | |||
| 972 | Ga0105239_10006516 | |||
| 973 | Ga0105239_10006798 | |||
| 974 | Ga0105239_10010535 | |||
| 975 | Ga0105239_10083921 | |||
| 976 | Ga0105239_10089374 | |||
| 977 | Ga0105239_10177949 | |||
| 978 | Ga0105239_10182154 | |||
| 979 | Ga0105239_10393767 | |||
| 980 | Ga0105239_10464802 | |||
| 981 | Ga0105246_10002236 | |||
| 982 | Ga0105246_10046176 | |||
| 983 | Ga0105246_10047658 | |||
| 984 | Ga0105246_10123487 | |||
| 985 | Ga0157370_10003269 | |||
| 986 | Ga0157370_10005361 | |||
| 987 | Ga0157370_10005815 | |||
| 988 | Ga0157370_10011955 | |||
| 989 | Ga0157370_10052168 | |||
| 990 | Ga0157370_11119180 | |||
| 991 | Ga0157369_10001386 | |||
| 992 | Ga0157369_10038688 | |||
| 993 | Ga0157369_10055382 | |||
| 994 | Ga0157369_10123947 | |||
| 995 | Ga0157369_10152926 | |||
| 996 | Ga0157369_10258931 | |||
| 997 | Ga0157369_10711197 | |||
| 998 | Ga0157369_11386613 | |||
| 999 | Ga0157374_10002706 | |||
| 1000 | Ga0157374_10032316 | |||
| 1001 | Ga0157374_10228341 | |||
| 1002 | Ga0157374_10288512 | |||
| 1003 | Ga0157374_10489155 | |||
| 1004 | Ga0157374_10680636 | |||
| 1005 | Ga0157378_10003111 | |||
| 1006 | Ga0157378_10046322 | |||
| 1007 | Ga0157378_10076701 | |||
| 1008 | Ga0157378_10393935 | |||
| 1009 | Ga0157378_10487230 | |||
| 1010 | Ga0157378_11071778 | |||
| 1011 | Ga0163162_10030661 | |||
| 1012 | Ga0163162_10067948 | |||
| 1013 | Ga0163162_10123450 | |||
| 1014 | Ga0163162_10147225 | |||
| 1015 | Ga0163162_10284161 | |||
| 1016 | Ga0163162_10668454 | |||
| 1017 | Ga0163162_11925696 | |||
| 1018 | Ga0157372_10000940 | |||
| 1019 | Ga0157372_10004118 | |||
| 1020 | Ga0157372_10074591 | |||
| 1021 | Ga0157372_10076927 | |||
| 1022 | Ga0157372_10251607 | |||
| 1023 | Ga0157372_10337808 | |||
| 1024 | Ga0157375_10008481 | |||
| 1025 | Ga0157375_10036509 | |||
| 1026 | Ga0157375_11084215 | |||
| 1027 | Ga0157375_11319587 | |||
| 1028 | Ga0157375_11444423 | |||
| 1029 | Ga0157375_11451561 | |||
| 1030 | Ga0157375_12580063 | |||
| 1031 | Ga0163163_10008943 | |||
| 1032 | Ga0163163_10023757 | |||
| 1033 | Ga0163163_10045702 | |||
| 1034 | Ga0163163_10223101 | |||
| 1035 | Ga0163163_10506156 | |||
| 1036 | Ga0163163_10729299 | |||
| 1037 | Ga0163163_11182197 | |||
| 1038 | Ga0163163_11544532 | |||
| 1039 | Ga0157380_11980900 | |||
| 1040 | Ga0157379_10133217 | |||
| 1041 | Ga0157379_10169469 | |||
| 1042 | Ga0157376_10008361 | |||
| 1043 | Ga0157376_10024410 | |||
| 1044 | Ga0157376_10039132 | |||
| 1045 | Ga0157376_10572272 | |||
| 1046 | Ga0157376_11081516 | |||
| 1047 | Ga0157376_12058066 | |||
| 1048 | Ga0157376_12182027 | |||
| 1049 | Ga0197907_10306262 | |||
| 1050 | Ga0206356_10299373 | |||
| 1051 | Ga0206356_10741037 | |||
| 1052 | Ga0206355_1273913 | |||
| 1053 | Ga0206355_1496514 | |||
| 1054 | Ga0206355_1611549 | |||
| 1055 | Ga0206352_10211364 | |||
| 1056 | Ga0213874_10191108 | |||
| 1057 | Ga0213876_10252057 | |||
| 1058 | Ga0213875_10003217 | |||
| 1059 | Ga0224712_10078853 | |||
| 1060 | Ga0207656_10230483 | |||
| 1061 | Ga0207692_10607158 | |||
| 1062 | Ga0207642_10076852 | |||
| 1063 | Ga0207680_10023532 | |||
| 1064 | Ga0207699_10081662 | |||
| 1065 | Ga0207643_10459317 | |||
| 1066 | Ga0207705_10126838 | |||
| 1067 | Ga0207705_11232893 | |||
| 1068 | Ga0207654_10003898 | |||
| 1069 | Ga0207654_10005400 | |||
| 1070 | Ga0207654_10014963 | |||
| 1071 | Ga0207654_10056621 | |||
| 1072 | Ga0207654_10234301 | |||
| 1073 | Ga0207707_10001064 | |||
| 1074 | Ga0207707_10069823 | |||
| 1075 | Ga0207707_10106835 | |||
| 1076 | Ga0207707_10143225 | |||
| 1077 | Ga0207707_10233997 | |||
| 1078 | Ga0207707_10361312 | |||
| 1079 | Ga0207707_10669140 | |||
| 1080 | Ga0207695_10000736 | |||
| 1081 | Ga0207695_10006825 | |||
| 1082 | Ga0207695_10009719 | |||
| 1083 | Ga0207695_10024452 | |||
| 1084 | Ga0207695_10036777 | |||
| 1085 | Ga0207695_10092564 | |||
| 1086 | Ga0207695_10192162 | |||
| 1087 | Ga0207695_10237607 | |||
| 1088 | Ga0207695_10263549 | |||
| 1089 | Ga0207695_10386203 | |||
| 1090 | Ga0207695_10400962 | |||
| 1091 | Ga0207671_10028988 | |||
| 1092 | Ga0207671_10032809 | |||
| 1093 | Ga0207671_10066169 | |||
| 1094 | Ga0207671_10188773 | |||
| 1095 | Ga0207671_10283352 | |||
| 1096 | Ga0207693_10822660 | |||
| 1097 | Ga0207663_10124017 | |||
| 1098 | Ga0207663_10268789 | |||
| 1099 | Ga0207663_10510416 | |||
| 1100 | Ga0207660_10001472 | |||
| 1101 | Ga0207660_10010369 | |||
| 1102 | Ga0207660_10037948 | |||
| 1103 | Ga0207660_10358655 | |||
| 1104 | Ga0207657_10002373 | |||
| 1105 | Ga0207657_10058904 | |||
| 1106 | Ga0207657_10106806 | |||
| 1107 | Ga0207657_10340660 | |||
| 1108 | Ga0207657_10476877 | |||
| 1109 | Ga0207649_10248645 | |||
| 1110 | Ga0207649_10744332 | |||
| 1111 | Ga0207652_10004167 | |||
| 1112 | Ga0207652_10194845 | |||
| 1113 | Ga0207652_10332783 | |||
| 1114 | Ga0207694_10000596 | |||
| 1115 | Ga0207694_10009372 | |||
| 1116 | Ga0207694_10019850 | |||
| 1117 | Ga0207694_10041862 | |||
| 1118 | Ga0207694_10256961 | |||
| 1119 | Ga0207694_10262071 | |||
| 1120 | Ga0207694_10329727 | |||
| 1121 | Ga0207659_10484304 | |||
| 1122 | Ga0207687_10003886 | |||
| 1123 | Ga0207687_10007395 | |||
| 1124 | Ga0207687_10008651 | |||
| 1125 | Ga0207687_10011455 | |||
| 1126 | Ga0207687_10319671 | |||
| 1127 | Ga0207687_10342340 | |||
| 1128 | Ga0207687_10370136 | |||
| 1129 | Ga0207687_10423832 | |||
| 1130 | Ga0207700_10083365 | |||
| 1131 | Ga0207700_10209603 | |||
| 1132 | Ga0207664_10019746 | |||
| 1133 | Ga0207664_10856278 | |||
| 1134 | Ga0207644_10113967 | |||
| 1135 | Ga0207644_10242278 | |||
| 1136 | Ga0207644_10413376 | |||
| 1137 | Ga0207690_10343530 | |||
| 1138 | Ga0207706_10061616 | |||
| 1139 | Ga0207686_10039780 | |||
| 1140 | Ga0207686_10069356 | |||
| 1141 | Ga0207686_10158359 | |||
| 1142 | Ga0207686_10956932 | |||
| 1143 | Ga0207709_10009378 | |||
| 1144 | Ga0207709_10030995 | |||
| 1145 | Ga0207669_11203932 | |||
| 1146 | Ga0207704_10047044 | |||
| 1147 | Ga0207704_10872033 | |||
| 1148 | Ga0207691_10280822 | |||
| 1149 | Ga0207691_10339044 | |||
| 1150 | Ga0207711_10002369 | |||
| 1151 | Ga0207711_10005641 | |||
| 1152 | Ga0207711_10024130 | |||
| 1153 | Ga0207711_10207666 | |||
| 1154 | Ga0207711_10213401 | |||
| 1155 | Ga0207711_10378150 | |||
| 1156 | Ga0207711_10442611 | |||
| 1157 | Ga0207711_10453750 | |||
| 1158 | Ga0207711_10860792 | |||
| 1159 | Ga0207711_11431294 | |||
| 1160 | Ga0207689_10020007 | |||
| 1161 | Ga0207689_10267167 | |||
| 1162 | Ga0207689_10325405 | |||
| 1163 | Ga0207689_11005614 | |||
| 1164 | Ga0207661_10000034 | |||
| 1165 | Ga0207661_10005010 | |||
| 1166 | Ga0207661_10022058 | |||
| 1167 | Ga0207661_10129392 | |||
| 1168 | Ga0207661_10219924 | |||
| 1169 | Ga0207661_10695457 | |||
| 1170 | Ga0207661_10917688 | |||
| 1171 | Ga0207679_10340032 | |||
| 1172 | Ga0207679_10957802 | |||
| 1173 | Ga0207679_10997973 | |||
| 1174 | Ga0207667_10000286 | |||
| 1175 | Ga0207667_10002312 | |||
| 1176 | Ga0207667_10006895 | |||
| 1177 | Ga0207667_10013803 | |||
| 1178 | Ga0207667_10015881 | |||
| 1179 | Ga0207667_10050549 | |||
| 1180 | Ga0207667_10117880 | |||
| 1181 | Ga0207667_10134311 | |||
| 1182 | Ga0207667_10171762 | |||
| 1183 | Ga0207667_10212101 | |||
| 1184 | Ga0207651_10043824 | |||
| 1185 | Ga0207651_11058634 | |||
| 1186 | Ga0207712_10091979 | |||
| 1187 | Ga0207712_10282552 | |||
| 1188 | Ga0207712_10941366 | |||
| 1189 | Ga0207640_10011159 | |||
| 1190 | Ga0207658_10383032 | |||
| 1191 | Ga0207677_10047405 | |||
| 1192 | Ga0207677_10059654 | |||
| 1193 | Ga0207677_10487105 | |||
| 1194 | Ga0207703_10005985 | |||
| 1195 | Ga0207703_10114605 | |||
| 1196 | Ga0207703_10225387 | |||
| 1197 | Ga0207703_10342353 | |||
| 1198 | Ga0207703_10602125 | |||
| 1199 | Ga0207703_10737801 | |||
| 1200 | Ga0207703_11307607 | |||
| 1201 | Ga0207639_10011143 | |||
| 1202 | Ga0207639_10069567 | |||
| 1203 | Ga0207639_10069804 | |||
| 1204 | Ga0207639_10223018 | |||
| 1205 | Ga0207702_10066028 | |||
| 1206 | Ga0207702_10159328 | |||
| 1207 | Ga0207702_10436860 | |||
| 1208 | Ga0207702_10461738 | |||
| 1209 | Ga0207702_10526009 | |||
| 1210 | Ga0207702_10804003 | |||
| 1211 | Ga0207702_10959475 | |||
| 1212 | Ga0207702_11052111 | |||
| 1213 | Ga0207641_10107739 | |||
| 1214 | Ga0207641_10115286 | |||
| 1215 | Ga0207641_10276618 | |||
| 1216 | Ga0207648_10081127 | |||
| 1217 | Ga0207648_10084152 | |||
| 1218 | Ga0207648_10095543 | |||
| 1219 | Ga0207676_10045779 | |||
| 1220 | Ga0207676_10524561 | |||
| 1221 | Ga0207676_10660176 | |||
| 1222 | Ga0207676_10843511 | |||
| 1223 | Ga0207676_11906650 | |||
| 1224 | Ga0207674_10000598 | |||
| 1225 | Ga0207674_10002054 | |||
| 1226 | Ga0207674_10007040 | |||
| 1227 | Ga0207674_10016379 | |||
| 1228 | Ga0207674_10029344 | |||
| 1229 | Ga0207674_10149267 | |||
| 1230 | Ga0207683_10072584 | |||
| 1231 | Ga0207698_10011678 | |||
| 1232 | Ga0207698_10020874 | |||
| 1233 | Ga0207698_10388397 | |||
| 1234 | Ga0207698_10621521 | |||
| 1235 | Ga0268266_11033028 | |||
| 1236 | Ga0268265_11552167 | |||
| 1237 | Ga0268264_10022204 | |||
| 1238 | Ga0268264_10847643 | |||
| 1239 | Ga0268264_10955840 | |||
| 1240 | Ga0265338_10447312 | |||
| 1241 | Ga0265332_10266379 | |||
| 1242 | Ga0265325_10007620 | |||
| 1243 | Ga0265340_10191775 | |||
| 1244 | Ga0265340_10257000 | |||
| 1245 | Ga0265339_10097048 | |||
| 1246 | Ga0265339_10114933 | |||
| 1247 | Ga0265331_10060690 | |||
| 1248 | Ga0265331_10125460 | |||
| 1249 | Ga0265331_10139093 | |||
| 1250 | Ga0265331_10302811 | |||
| 1251 | Ga0265316_10003417 | |||
| 1252 | Ga0265316_10003861 | |||
| 1253 | Ga0265316_10051590 | |||
| 1254 | Ga0265316_10056432 | |||
| 1255 | Ga0265316_10086751 | |||
| 1256 | Ga0265316_10088282 | |||
| 1257 | Ga0265316_10118687 | |||
| 1258 | Ga0265316_10239243 | |||
| 1259 | Ga0265316_10252549 | |||
| 1260 | Ga0265316_10298882 | |||
| 1261 | Ga0265313_10041165 | |||
| 1262 | Ga0265313_10159814 | |||
| 1263 | Ga0265313_10167425 | |||
| 1264 | Ga0265313_10327543 | |||
| 1265 | Ga0265314_10002505 | |||
| 1266 | Ga0265314_10006404 | |||
| 1267 | Ga0265314_10032317 | |||
| 1268 | Ga0373926_0030072 | |||
| 1269 | Ga0373926_0240760 | |||
| 1270 | Ga0373934_0000702 | |||
| 1271 | Ga0373944_0360586 | |||
| 1272 | Ga0373945_0070509 | |||
| 1273 | Ga0373953_0007112 | |||
| 1274 | Ga0373953_0009909 | |||
| 1275 | Ga0373953_0365451 | |||
| 1276 | Ga0373954_0003460 | |||
| 1277 | Ga0373954_0070698 | |||
| 1278 | Ga0373954_0107145 | |||
| 1279 | Ga0373956_0014046 | |||
| 1280 | Ga0373956_0071812 | |||
| 1281 | Ga0373957_0204554 | |||
| 1282 | Ga0373960_0295682 | |||
| 1283 | Ga0373943_0027185 | |||
| 1284 | Ga0373943_0067611 | |||
| 1285 | Ga0373946_0037373 | |||
| 1286 | Ga0373946_0268748 | |||
| 1287 | Ga0373946_0568274 | |||
| 1288 | Ga0373955_0025520 | |||
| 1289 | Ga0373955_0044205 | |||
| 1290 | Ga0373955_0188268 | |||
| 1291 | Ga0373955_0188343 | |||
| 1292 | Ga0373924_0008858 | |||
| 1293 | Ga0373935_0104847 | |||
| 1294 | Ga0373935_0126018 | |||
| 1295 | Ga0373935_0310383 | |||
| 1296 | Ga0373935_0786176 | |||
| 1297 | Ga0373927_0000406 | |||
| 1298 | Ga0373927_0054900 | |||
| 1299 | Ga0373927_0172438 | |||
| 1300 | Ga0373927_0265530 | |||
| 1301 | Ga0373933_0245451 | |||
| 1302 | Ga0373933_0387255 | |||
| 1303 | Ga0373933_0637630 | |||
| 1304 | Ga0373947_0000515 | |||
| 1305 | Ga0373947_0107903 | |||
| 1306 | Ga0373947_0384445 | |||
| 1307 | Ga0373947_0970635 | |||
| 1308 | Ga0373937_0007859 | |||
| 1309 | Ga0373937_0100915 | |||
| 1310 | Ga0373937_0226283 | |||
| 1311 | Ga0373937_0427729 | |||
| 1312 | Ga0373937_1275379 | |||
| 1313 | Ga0373925_0000805 | |||
| 1314 | Ga0373925_0055110 | |||
| 1315 | Ga0373925_0068515 | |||
| 1316 | Ga0373925_0070049 | |||
| 1317 | Ga0373925_0099470 | |||
| 1318 | Ga0373925_0172656 | |||
| 1319 | Ga0373925_0282067 | |||
| 1320 | Ga0395900_0336524 | |||
| 1321 | Ga0395905_0659466 | |||
| 1322 | Ga0395905_0725780 | |||
| 1323 | Ga0436364_0114467 | |||
| 1324 | Ga0436364_0250279 | |||
| 1325 | Ga0436365_0303955 | |||
| 1326 | Ga0436365_0851550 | |||
| 1327 | Ga0436365_1891567 | |||
| 1328 | Ga0436360_0254837 | |||
| 1329 | Ga0436363_0266634 | |||
| 1330 | Ga0436363_1006948 | |||
| 1331 | Ga0436362_0210836 | |||
| 1332 | Ga0436362_0871999 | |||
| 1333 | Ga0439448_0064983 | |||
| 1334 | Ga0451577_1142871 | |||
| 1335 | Ga0466965_0302852 | |||
| 1336 | Ga0466963_0277080 | |||
| 1337 | Ga0466963_0606627 | |||
| 1338 | Ga0453684_0412689 | |||
| 1339 | Ga0451576_0021663 | |||
| 1340 | Ga0451576_0540860 | |||
| 1341 | Ga0466958_0332441 | |||
| 1342 | Ga0466967_0812123 | |||
| 1343 | Ga0495651_0191308 | |||
| 1344 | Ga0495651_0642030 | |||
| 1345 | Ga0495651_0771833 | |||
| 1346 | Ga0495580_0005431 | |||
| 1347 | Ga0495580_0066450 | |||
| 1348 | Ga0495580_0111752 | |||
| 1349 | Ga0495580_0353183 | |||
| 1350 | Ga0495582_0022975 | |||
| 1351 | Ga0495582_0256932 | |||
| 1352 | Ga0495662_0091200 | |||
| 1353 | Ga0495664_0138984 | |||
| 1354 | Ga0495664_0165478 | |||
| 1355 | Ga0495594_0200956 | |||
| 1356 | Ga0495594_0227115 | |||
| 1357 | Ga0495628_0539293 | |||
| 1358 | Ga0495630_0445287 | |||
| 1359 | Ga0495630_0579652 | |||
| 1360 | Ga0495666_0355740 | |||
| 1361 | Ga0495642_0308479 | |||
| 1362 | Ga0495652_0275021 | |||
| 1363 | Ga0495652_0467981 | |||
| 1364 | Ga0495652_0995512 | |||
| 1365 | Ga0495665_0047438 | |||
| 1366 | Ga0495640_0443953 | |||
| 1367 | Ga0495586_0183776 | |||
| 1368 | Ga0495586_0355964 | |||
| 1369 | Ga0495587_0001072 | |||
| 1370 | Ga0495587_0060907 | |||
| 1371 | Ga0495587_0093310 | |||
| 1372 | Ga0495645_0041606 | |||
| 1373 | Ga0495645_0626639 | |||
| 1374 | Ga0495667_0167919 | |||
| 1375 | Ga0495635_0330020 | |||
| 1376 | Ga0495635_0366984 | |||
| 1377 | Ga0495635_0848131 | |||
| 1378 | Ga0495657_0458197 | |||
| 1379 | Ga0495599_0613013 | |||
| 1380 | Ga0495623_0049848 | |||
| 1381 | Ga0495623_0189417 | |||
| 1382 | Ga0495623_0252054 | |||
| 1383 | Ga0495658_0045585 | |||
| 1384 | Ga0495658_0958793 | |||
| 1385 | Ga0495613_0226259 | |||
| 1386 | Ga0495613_0484611 | |||
| 1387 | Ga0495624_0120379 | |||
| 1388 | Ga0495624_0349819 | |||
| 1389 | Ga0495600_0135942 | |||
| 1390 | Ga0495600_0515053 | |||
| 1391 | Ga0495581_0581685 | |||
| 1392 | Ga0495604_0037257 | |||
| 1393 | Ga0495604_0232804 | |||
| 1394 | Ga0495636_0077910 | |||
| 1395 | Ga0495674_0002309 | |||
| 1396 | Ga0495674_0124106 | |||
| 1397 | Ga0495680_0558457 | |||
| 1398 | Ga0495675_0095092 | |||
| 1399 | Ga0495675_0177986 | |||
| 1400 | Ga0495675_0225385 | |||
| 1401 | Ga0495675_0320261 | |||
| 1402 | Ga0495675_0616855 | |||
| 1403 | Ga0495684_0014766 | |||
| 1404 | Ga0495684_0115406 | |||
| 1405 | Ga0495684_0570769 | |||
| 1406 | Ga0495602_0135415 | |||
| 1407 | Ga0495602_0189689 | |||
| 1408 | Ga0495602_0717725 | |||
| 1409 | Ga0495602_0795115 | |||
| 1410 | Ga0496102_0898899 | |||
| 1411 | Ga0496112_0169492 | |||
| 1412 | Ga0496115_0102945 | |||
| 1413 | Ga0496115_0269619 | |||
| 1414 | Ga0496126_0086318 | |||
| 1415 | Ga0501032_0108395 | |||
| 1416 | Ga0501034_0025207 | |||
| 1417 | Ga0501034_0737477 | |||
| 1418 | Ga0501038_0222029 | |||
| 1419 | Ga0501039_0773422 | |||
| 1420 | Ga0501043_0470366 | |||
| 1421 | Ga0501046_0376811 | |||
| 1422 | Ga0501047_0047012 | |||
| 1423 | Ga0501047_0063717 | |||
| 1424 | Ga0501048_0457261 | |||
| 1425 | Ga0501070_0019634 | |||
| 1426 | Ga0501073_0138869 | |||
| 1427 | Ga0501035_0008190 | |||
| 1428 | Ga0501044_0001789 | |||
| 1429 | Ga0501044_0002189 | |||
| 1430 | Ga0501044_0153711 | |||
| 1431 | Ga0501044_0574372 | |||
| 1432 | nmdc:mga05p37_886576_c1 | |||
| 1433 | nmdc:mga0n895_535578_c1 | |||
| 1434 | nmdc:mga08x19_1007204_c1 | |||
| 1435 | nmdc:mga0a205_348771_c1 | |||
| 1436 | Ga0495601_0383737 | |||
| 1437 | Ga0495612_0278423 | |||
| 1438 | Ga0495595_0343945 | |||
| 1439 | Ga0495619_0874804 | |||
| 1440 | Ga0587090_023332 | |||
| 1441 | Ga0587092_031146 | |||
| 1442 | Ga0587076_044897 |