F477185

General Info

Members Datasets Scaffolds Average Seq Length
718 293 718 318

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0002708|Ga0466967_0002708_3841_4920
Length 359
Sequence MERYAPEWPPTFGSNRQPQPNARQRSNEDEENFVSAIITDNVTRRFGDFTAVDRVSIRVEKGEVFGFLGPNGSGKTTLIKMLTGLLPLSEGSASVDDVDVTADPELVRERIGYMSQKFSLYDDLTVEENLTFYGRIYGLSPQRLRSRMDAIIETNGLAPYVRRSAAKLSGGWKQRLALGCAMLHEPRIMFLDEPTAGIDPVARRTLWDLLFQLSGQGITFFVTTHYMDEAERCSHVAYIYFGRIIADGTPDDLKEIPEINPPGTKRIEIDSSEVTRALMLAREFAGVRSATVFGQAIHALVDDRLSESALSEYLSREHIRVHEIRSLLPSLEDVFVELTYRRQAELEAENGVAKETVHA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.9
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10019228 3300003203 Bacteria 2789
2 rootL2_10024844 3300003322 Bacteria 7071
3 Ga0065715_10095553 3300005293 Bacteria 4060
4 Ga0070676_10002577 3300005328 Bacteria 9318
5 Ga0070676_10013025 3300005328 Bacteria 4557
6 Ga0070683_100000097 3300005329 Bacteria 57304
7 Ga0070683_100015960 3300005329 Bacteria 6607
8 Ga0070683_100022036 3300005329 Bacteria 5688
9 Ga0070683_100044469 3300005329 Bacteria 4095
10 Ga0070683_100207182 3300005329 Bacteria 1862
11 Ga0070683_100222443 3300005329 Bacteria 1794
12 Ga0070690_100002589 3300005330 Bacteria 9744
13 Ga0070690_100012605 3300005330 Bacteria 4976
14 Ga0070690_100097002 3300005330 Bacteria 1949
15 Ga0070670_100010640 3300005331 Bacteria 7859
16 Ga0070670_100013420 3300005331 Bacteria 7017
17 Ga0070670_100175734 3300005331 Bacteria 1858
18 Ga0068869_100001114 3300005334 Bacteria 15660
19 Ga0068869_100004783 3300005334 Bacteria 8453
20 Ga0070680_100010238 3300005336 Bacteria 7230
21 Ga0070682_100000082 3300005337 Bacteria 85071
22 Ga0070682_100064671 3300005337 Bacteria 2322
23 Ga0068868_100000479 3300005338 Bacteria 26512
24 Ga0068868_100003002 3300005338 Bacteria 11729
25 Ga0068868_100226090 3300005338 Bacteria 1568
26 Ga0070689_100000899 3300005340 Bacteria 18558
27 Ga0070689_100030208 3300005340 Bacteria 4111
28 Ga0070689_100290896 3300005340 Bacteria 1358
29 Ga0070687_100131256 3300005343 Bacteria 1447
30 Ga0070661_100005145 3300005344 Bacteria 9008
31 Ga0070661_100005454 3300005344 Bacteria 8771
32 Ga0070661_100045692 3300005344 Bacteria 3202
33 Ga0070661_100216062 3300005344 Unclassified 1469
34 Ga0070661_100356730 3300005344 Bacteria 1148
35 Ga0070668_100168194 3300005347 Bacteria 1783
36 Ga0070669_100004094 3300005353 Bacteria 10564
37 Ga0070669_100100748 3300005353 Bacteria 2178
38 Ga0070675_100000003 3300005354 Bacteria 422595
39 Ga0070675_100029761 3300005354 Bacteria 4406
40 Ga0070675_100051327 3300005354 Bacteria 3389
41 Ga0070671_100007588 3300005355 Bacteria 8673
42 Ga0070671_100017627 3300005355 Bacteria 5786
43 Ga0070671_100029409 3300005355 Bacteria 4530
44 Ga0070688_100046952 3300005365 Bacteria 2676
45 Ga0070688_100137183 3300005365 Bacteria 1657
46 Ga0070659_100004954 3300005366 Bacteria 9526
47 Ga0070659_100404524 3300005366 Bacteria 1153
48 Ga0070667_100000808 3300005367 Bacteria 29235
49 Ga0070667_100045107 3300005367 Bacteria 3706
50 Ga0070667_100050889 3300005367 Bacteria 3491
51 Ga0070709_10080316 3300005434 Bacteria 2126
52 Ga0070709_10096014 3300005434 Bacteria 1965
53 Ga0070714_100123214 3300005435 Bacteria 2308
54 Ga0070714_100207413 3300005435 Unclassified 1795
55 Ga0070701_10026517 3300005438 Bacteria 2827
56 Ga0070711_100018101 3300005439 Bacteria 4495
57 Ga0070711_100123852 3300005439 Bacteria 1916
58 Ga0070705_100002661 3300005440 Bacteria 8942
59 Ga0070705_100043942 3300005440 Bacteria 2564
60 Ga0070705_100173749 3300005440 Unclassified 1453
61 Ga0070700_100000001 3300005441 Bacteria 346167
62 Ga0070694_100016968 3300005444 Bacteria 4594
63 Ga0070694_100311393 3300005444 Bacteria 1209
64 Ga0070708_100006686 3300005445 Bacteria 9181
65 Ga0070708_100017608 3300005445 Bacteria 5965
66 Ga0070708_100040668 3300005445 Unclassified 4072
67 Ga0070708_100443327 3300005445 Bacteria 1225
68 Ga0070663_100002121 3300005455 Bacteria 11111
69 Ga0070663_100003832 3300005455 Bacteria 8755
70 Ga0070663_100075253 3300005455 Bacteria 2467
71 Ga0070678_100005711 3300005456 Bacteria 7228
72 Ga0070678_100255363 3300005456 Bacteria 1471
73 Ga0070662_100000757 3300005457 Bacteria 19820
74 Ga0070662_100002775 3300005457 Bacteria 10842
75 Ga0070681_10418887 3300005458 Bacteria 1251
76 Ga0068867_100004156 3300005459 Bacteria 10180
77 Ga0070685_10003684 3300005466 Bacteria 7766
78 Ga0070685_10064461 3300005466 Bacteria 2154
79 Ga0070706_100006053 3300005467 Bacteria 11435
80 Ga0070706_100012328 3300005467 Bacteria 7922
81 Ga0070707_100001974 3300005468 Bacteria 19626
82 Ga0070707_100003066 3300005468 Bacteria 15829
83 Ga0070707_100004807 3300005468 Bacteria 12652
84 Ga0070707_100024983 3300005468 Bacteria 5665
85 Ga0070698_100006903 3300005471 Bacteria 12304
86 Ga0070698_100022863 3300005471 Bacteria 6537
87 Ga0070698_100034608 3300005471 Bacteria 5228
88 Ga0070698_100157613 3300005471 Bacteria 2215
89 Ga0070698_100195545 3300005471 Bacteria 1959
90 Ga0070698_100278086 3300005471 Bacteria 1606
91 Ga0070699_100011123 3300005518 Bacteria 7777
92 Ga0070699_100015577 3300005518 Bacteria 6531
93 Ga0070699_100033738 3300005518 Bacteria 4423
94 Ga0070699_100047276 3300005518 Unclassified 3723
95 Ga0070699_100099871 3300005518 Bacteria 2543
96 Ga0070679_100069183 3300005530 Bacteria 3521
97 Ga0070679_100079144 3300005530 Bacteria 3276
98 Ga0070684_100000031 3300005535 Bacteria 106109
99 Ga0070684_100016682 3300005535 Bacteria 6010
100 Ga0070684_100097193 3300005535 Bacteria 2626
101 Ga0070697_100007629 3300005536 Bacteria 8421
102 Ga0070697_100009220 3300005536 Bacteria 7711
103 Ga0068853_100006331 3300005539 Bacteria 9396
104 Ga0068853_100025332 3300005539 Bacteria 4977
105 Ga0070672_100000324 3300005543 Bacteria 27234
106 Ga0070672_100004476 3300005543 Bacteria 9153
107 Ga0070695_100002293 3300005545 Bacteria 10965
108 Ga0070696_100004097 3300005546 Bacteria 9718
109 Ga0070696_100167489 3300005546 Bacteria 1622
110 Ga0070693_100000004 3300005547 Bacteria 94899
111 Ga0070693_100005354 3300005547 Bacteria 6152
112 Ga0070693_100007822 3300005547 Bacteria 5239
113 Ga0070665_100003370 3300005548 Bacteria 17092
114 Ga0070665_100009991 3300005548 Bacteria 9601
115 Ga0070665_100013260 3300005548 Bacteria 8300
116 Ga0070665_100019857 3300005548 Bacteria 6747
117 Ga0070704_100002014 3300005549 Bacteria 11260
118 Ga0068855_100009684 3300005563 Bacteria 11631
119 Ga0068855_100014801 3300005563 Bacteria 9392
120 Ga0068855_100017878 3300005563 Bacteria 8519
121 Ga0068855_100743515 3300005563 Bacteria 1046
122 Ga0070664_100077832 3300005564 Bacteria 2852
123 Ga0070664_100119594 3300005564 Bacteria 2305
124 Ga0068857_100000602 3300005577 Bacteria 26435
125 Ga0068857_100003885 3300005577 Bacteria 12577
126 Ga0068857_100004856 3300005577 Bacteria 11400
127 Ga0068857_100015384 3300005577 Bacteria 6681
128 Ga0068857_100178342 3300005577 Bacteria 1933
129 Ga0068854_100000587 3300005578 Bacteria 21705
130 Ga0068854_100007505 3300005578 Bacteria 6970
131 Ga0068854_100178829 3300005578 Bacteria 1656
132 Ga0068856_100009485 3300005614 Bacteria 9450
133 Ga0068856_100016636 3300005614 Bacteria 7121
134 Ga0068856_100039225 3300005614 Bacteria 4649
135 Ga0068856_100295138 3300005614 Bacteria 1638
136 Ga0070702_100003922 3300005615 Bacteria 6743
137 Ga0070702_100014769 3300005615 Bacteria 3970
138 Ga0068852_100000032 3300005616 Bacteria 102480
139 Ga0068852_100002033 3300005616 Bacteria 13786
140 Ga0068852_100104777 3300005616 Bacteria 2561
141 Ga0068852_100218104 3300005616 Unclassified 1813
142 Ga0068852_100313696 3300005616 Bacteria 1521
143 Ga0068859_100015723 3300005617 Bacteria 7605
144 Ga0068859_100024506 3300005617 Bacteria 6054
145 Ga0068859_100112219 3300005617 Bacteria 2789
146 Ga0068864_100000001 3300005618 Bacteria 686767
147 Ga0068864_100011164 3300005618 Bacteria 7424
148 Ga0068864_100033344 3300005618 Bacteria 4377
149 Ga0068864_100156212 3300005618 Bacteria 2070
150 Ga0068866_10009415 3300005718 Bacteria 4147
151 Ga0068851_10007717 3300005834 Bacteria 4948
152 Ga0068851_10009873 3300005834 Bacteria 4445
153 Ga0068870_10001103 3300005840 Bacteria 10735
154 Ga0068863_100003024 3300005841 Bacteria 16624
155 Ga0068863_100011180 3300005841 Bacteria 8699
156 Ga0068863_100058770 3300005841 Bacteria 3639
157 Ga0068863_100082252 3300005841 Unclassified 3051
158 Ga0068863_100123713 3300005841 Bacteria 2468
159 Ga0068863_100127894 3300005841 Bacteria 2424
160 Ga0068863_100283149 3300005841 Bacteria 1606
161 Ga0068858_100001897 3300005842 Bacteria 21342
162 Ga0068858_100005975 3300005842 Bacteria 11887
163 Ga0068858_100008393 3300005842 Bacteria 9936
164 Ga0068858_100013939 3300005842 Bacteria 7582
165 Ga0068858_100149088 3300005842 Bacteria 2198
166 Ga0068860_100000031 3300005843 Bacteria 255068
167 Ga0068860_100047573 3300005843 Bacteria 4088
168 Ga0068860_100073434 3300005843 Bacteria 3251
169 Ga0068860_100144359 3300005843 Bacteria 2289
170 Ga0068862_100003359 3300005844 Bacteria 13812
171 Ga0068862_100008925 3300005844 Bacteria 8300
172 Ga0081455_10007293 3300005937 Bacteria 11668
173 Ga0081455_10065623 3300005937 Unclassified 3035
174 Ga0081539_10018248 3300005985 Bacteria 4879
175 Ga0070717_10005591 3300006028 Bacteria 9176
176 Ga0070717_10527211 3300006028 Bacteria 1069
177 Ga0070716_100000450 3300006173 Bacteria 17008
178 Ga0070716_100003804 3300006173 Bacteria 7159
179 Ga0070716_100004439 3300006173 Bacteria 6709
180 Ga0070716_100030254 3300006173 Bacteria 2936
181 Ga0070716_100136952 3300006173 Bacteria 1556
182 Ga0070712_100054144 3300006175 Bacteria 2804
183 Ga0097621_100012626 3300006237 Bacteria 6269
184 Ga0097621_100109589 3300006237 Bacteria 2332
185 Ga0097621_100185260 3300006237 Bacteria 1800
186 Ga0097621_100279321 3300006237 Bacteria 1470
187 Ga0068871_100001244 3300006358 Bacteria 17011
188 Ga0068871_100011283 3300006358 Bacteria 6551
189 Ga0068871_100190361 3300006358 Bacteria 1767
190 Ga0075428_100031691 3300006844 Bacteria 5841
191 Ga0075428_100293309 3300006844 Bacteria 1749
192 Ga0075431_100018995 3300006847 Bacteria 7003
193 Ga0075431_100136569 3300006847 Bacteria 2528
194 Ga0075431_100402784 3300006847 Bacteria 1369
195 Ga0075431_100430035 3300006847 Bacteria 1318
196 Ga0075433_10035022 3300006852 Bacteria 4315
197 Ga0075433_10131004 3300006852 Bacteria 2228
198 Ga0075433_10280229 3300006852 Bacteria 1477
199 Ga0075434_100003588 3300006871 Bacteria 13866
200 Ga0075434_100030079 3300006871 Bacteria 5346
201 Ga0075434_100055325 3300006871 Bacteria 3943
202 Ga0075434_100239241 3300006871 Bacteria 1836
203 Ga0075429_100263342 3300006880 Bacteria 1510
204 Ga0068865_100002290 3300006881 Bacteria 11280
205 Ga0068865_100039266 3300006881 Bacteria 3210
206 Ga0075436_100000737 3300006914 Bacteria 21698
207 Ga0075436_100005655 3300006914 Bacteria 8581
208 Ga0075436_100026238 3300006914 Unclassified 4011
209 Ga0097620_100015722 3300006931 Bacteria 7605
210 Ga0097620_100024506 3300006931 Bacteria 6054
211 Ga0097620_100112217 3300006931 Bacteria 2789
212 Ga0075435_100058675 3300007076 Bacteria 3118
213 Ga0075435_100093913 3300007076 Unclassified 2479
214 Ga0075435_100336284 3300007076 Unclassified 1294
215 Ga0099794_10006331 3300007265 Bacteria 4785
216 Ga0099794_10023214 3300007265 Bacteria 2835
217 Ga0099794_10045411 3300007265 Bacteria 2102
218 Ga0099794_10148372 3300007265 Bacteria 1190
219 Ga0099795_10025446 3300007788 Bacteria 1985
220 Ga0105244_10013367 3300009036 Bacteria 4803
221 Ga0105240_10000135 3300009093 Bacteria 151432
222 Ga0105240_10000451 3300009093 Bacteria 75544
223 Ga0105240_10004680 3300009093 Bacteria 20685
224 Ga0105240_10010538 3300009093 Bacteria 12985
225 Ga0105240_10017307 3300009093 Bacteria 9718
226 Ga0105240_10048663 3300009093 Bacteria 5356
227 Ga0105240_10172716 3300009093 Bacteria 2558
228 Ga0105240_10372207 3300009093 Bacteria 1615
229 Ga0105240_10388657 3300009093 Bacteria 1574
230 Ga0105240_10439322 3300009093 Bacteria 1462
231 Ga0105240_10521159 3300009093 Bacteria 1319
232 Ga0105240_10543670 3300009093 Bacteria 1286
233 Ga0105245_10000786 3300009098 Bacteria 28771
234 Ga0105245_10002852 3300009098 Bacteria 15538
235 Ga0105245_10016836 3300009098 Bacteria 6382
236 Ga0105245_10040917 3300009098 Bacteria 4131
237 Ga0105245_10238688 3300009098 Bacteria 1761
238 Ga0114129_10157396 3300009147 Bacteria 3106
239 Ga0114129_10239068 3300009147 Bacteria 2442
240 Ga0105241_10010010 3300009174 Bacteria 6962
241 Ga0105241_10021359 3300009174 Bacteria 4785
242 Ga0105241_10050809 3300009174 Bacteria 3160
243 Ga0105241_10171475 3300009174 Bacteria 1792
244 Ga0105242_10002605 3300009176 Bacteria 14141
245 Ga0105242_10011272 3300009176 Bacteria 6869
246 Ga0105242_10024358 3300009176 Bacteria 4780
247 Ga0105248_10009291 3300009177 Bacteria 10826
248 Ga0105248_10026710 3300009177 Bacteria 6420
249 Ga0105248_10076405 3300009177 Bacteria 3764
250 Ga0105248_10186842 3300009177 Bacteria 2335
251 Ga0105237_10017522 3300009545 Bacteria 7423
252 Ga0105237_10021398 3300009545 Bacteria 6649
253 Ga0105237_10297153 3300009545 Bacteria 1618
254 Ga0105238_10001963 3300009551 Bacteria 20716
255 Ga0105238_10666499 3300009551 Bacteria 1051
256 Ga0105249_10039077 3300009553 Bacteria 4307
257 Ga0105249_10089888 3300009553 Bacteria 2870
258 Ga0105249_10119018 3300009553 Unclassified 2508
259 Ga0105249_10525790 3300009553 Bacteria 1231
260 Ga0099796_10000665 3300010159 Bacteria 6015
261 Ga0105239_10035672 3300010375 Bacteria 5460
262 Ga0105239_10057403 3300010375 Unclassified 4269
263 Ga0105239_10111537 3300010375 Unclassified 3032
264 Ga0105239_10366714 3300010375 Bacteria 1627
265 Ga0105246_10001466 3300011119 Bacteria 14010
266 Ga0105246_10085885 3300011119 Bacteria 2254
267 Ga0157373_10003983 3300013100 Bacteria 11139
268 Ga0157373_10004107 3300013100 Bacteria 10974
269 Ga0157371_10043860 3300013102 Bacteria 3185
270 Ga0157370_10000023 3300013104 Bacteria 161359
271 Ga0157370_10015084 3300013104 Bacteria 7874
272 Ga0157369_10000010 3300013105 Bacteria 273443
273 Ga0157369_10035913 3300013105 Bacteria 5432
274 Ga0157369_10042861 3300013105 Unclassified 4936
275 Ga0157369_10062729 3300013105 Bacteria 4004
276 Ga0157369_10213051 3300013105 Bacteria 2024
277 Ga0157369_10446150 3300013105 Bacteria 1340
278 Ga0157374_10001688 3300013296 Bacteria 18485
279 Ga0157374_10046796 3300013296 Bacteria 4008
280 Ga0157374_10047646 3300013296 Bacteria 3974
281 Ga0157374_10239095 3300013296 Unclassified 1786
282 Ga0157374_10316594 3300013296 Bacteria 1546
283 Ga0157378_10000044 3300013297 Bacteria 106822
284 Ga0157378_10002388 3300013297 Bacteria 16681
285 Ga0157378_10006829 3300013297 Bacteria 9955
286 Ga0157378_10016679 3300013297 Bacteria 6436
287 Ga0157378_10095021 3300013297 Unclassified 2714
288 Ga0157378_10193705 3300013297 Bacteria 1919
289 Ga0157378_10304705 3300013297 Bacteria 1543
290 Ga0163162_10001495 3300013306 Bacteria 21784
291 Ga0163162_10007750 3300013306 Bacteria 10461
292 Ga0163162_10010928 3300013306 Bacteria 8838
293 Ga0163162_10017286 3300013306 Bacteria 7057
294 Ga0163162_10176040 3300013306 Bacteria 2265
295 Ga0163162_10440447 3300013306 Unclassified 1435
296 Ga0163162_10555036 3300013306 Bacteria 1277
297 Ga0157372_10000055 3300013307 Bacteria 126308
298 Ga0157372_10007697 3300013307 Bacteria 11460
299 Ga0157372_10008911 3300013307 Bacteria 10660
300 Ga0157372_10068306 3300013307 Bacteria 3995
301 Ga0157372_10104887 3300013307 Bacteria 3232
302 Ga0157372_10211618 3300013307 Bacteria 2247
303 Ga0157372_10223635 3300013307 Bacteria 2182
304 Ga0157372_10250472 3300013307 Unclassified 2056
305 Ga0157372_10372883 3300013307 Bacteria 1663
306 Ga0157375_10000005 3300013308 Bacteria 429412
307 Ga0157375_10000092 3300013308 Bacteria 90157
308 Ga0157375_10122045 3300013308 Bacteria 2716
309 Ga0157375_10247725 3300013308 Bacteria 1942
310 Ga0157375_10517914 3300013308 Bacteria 1356
311 Ga0163163_10001291 3300014325 Bacteria 21165
312 Ga0163163_10004292 3300014325 Bacteria 12142
313 Ga0163163_10004406 3300014325 Bacteria 11999
314 Ga0163163_10011078 3300014325 Bacteria 8159
315 Ga0163163_10055189 3300014325 Unclassified 3927
316 Ga0163163_10086516 3300014325 Unclassified 3144
317 Ga0157380_10362470 3300014326 Unclassified 1360
318 Ga0157377_10000105 3300014745 Bacteria 57869
319 Ga0157377_10000304 3300014745 Bacteria 22848
320 Ga0157379_10001222 3300014968 Bacteria 20890
321 Ga0157379_10008140 3300014968 Bacteria 9106
322 Ga0157376_10000008 3300014969 Bacteria 351192
323 Ga0157376_10002199 3300014969 Bacteria 13151
324 Ga0157376_10018878 3300014969 Bacteria 5301
325 Ga0157376_10022142 3300014969 Bacteria 4948
326 Ga0157376_10068900 3300014969 Unclassified 2997
327 Ga0157376_10079463 3300014969 Bacteria 2812
328 Ga0157376_10118333 3300014969 Bacteria 2344
329 Ga0157376_10170736 3300014969 Bacteria 1980
330 Ga0157376_10570691 3300014969 Bacteria 1122
331 Ga0213873_10000001 3300021358 Bacteria 1657979
332 Ga0213876_10000002 3300021384 Bacteria 1168769
333 Ga0213876_10042452 3300021384 Bacteria 2403
334 Ga0228598_1024820 3300024227 Bacteria 1179
335 Ga0207697_10028981 3300025315 Bacteria 2265
336 Ga0207656_10009454 3300025321 Bacteria 3622
337 Ga0207656_10045886 3300025321 Unclassified 1872
338 Ga0207655_1040181 3300025728 Bacteria 2022
339 Ga0207653_10056710 3300025885 Bacteria 1314
340 Ga0207682_10007200 3300025893 Bacteria 4450
341 Ga0207710_10001423 3300025900 Bacteria 11961
342 Ga0207688_10011349 3300025901 Bacteria 4852
343 Ga0207688_10093320 3300025901 Unclassified 1731
344 Ga0207680_10002500 3300025903 Bacteria 8573
345 Ga0207680_10004549 3300025903 Bacteria 6585
346 Ga0207680_10042030 3300025903 Bacteria 2671
347 Ga0207647_10007389 3300025904 Bacteria 7943
348 Ga0207647_10015179 3300025904 Bacteria 5290
349 Ga0207685_10022938 3300025905 Bacteria 2117
350 Ga0207699_10069725 3300025906 Bacteria 2145
351 Ga0207645_10003138 3300025907 Bacteria 12670
352 Ga0207645_10003581 3300025907 Bacteria 11749
353 Ga0207645_10040661 3300025907 Bacteria 2977
354 Ga0207643_10000247 3300025908 Bacteria 37737
355 Ga0207684_10015257 3300025910 Bacteria 6618
356 Ga0207684_10015510 3300025910 Bacteria 6554
357 Ga0207684_10040516 3300025910 Bacteria 3948
358 Ga0207654_10013984 3300025911 Bacteria 4138
359 Ga0207654_10030271 3300025911 Unclassified 2970
360 Ga0207654_10118775 3300025911 Bacteria 1657
361 Ga0207707_10035921 3300025912 Bacteria 4333
362 Ga0207707_10258700 3300025912 Bacteria 1511
363 Ga0207707_10350079 3300025912 Bacteria 1273
364 Ga0207695_10000050 3300025913 Bacteria 405727
365 Ga0207695_10000075 3300025913 Bacteria 308496
366 Ga0207695_10002642 3300025913 Bacteria 26207
367 Ga0207695_10006933 3300025913 Bacteria 14557
368 Ga0207695_10028415 3300025913 Bacteria 6202
369 Ga0207695_10049587 3300025913 Bacteria 4424
370 Ga0207695_10072236 3300025913 Bacteria 3522
371 Ga0207695_10373390 3300025913 Unclassified 1312
372 Ga0207671_10001031 3300025914 Bacteria 33913
373 Ga0207671_10010247 3300025914 Bacteria 7755
374 Ga0207671_10060918 3300025914 Unclassified 2800
375 Ga0207671_10061951 3300025914 Bacteria 2777
376 Ga0207671_10142339 3300025914 Bacteria 1848
377 Ga0207693_10044049 3300025915 Bacteria 3507
378 Ga0207693_10046145 3300025915 Bacteria 3423
379 Ga0207693_10052328 3300025915 Bacteria 3203
380 Ga0207693_10060064 3300025915 Bacteria 2978
381 Ga0207663_10010895 3300025916 Bacteria 4857
382 Ga0207663_10014302 3300025916 Bacteria 4339
383 Ga0207663_10039572 3300025916 Bacteria 2858
384 Ga0207663_10062463 3300025916 Bacteria 2368
385 Ga0207657_10001280 3300025919 Bacteria 26783
386 Ga0207657_10008909 3300025919 Bacteria 10144
387 Ga0207649_10000566 3300025920 Bacteria 25447
388 Ga0207652_10029113 3300025921 Bacteria 4615
389 Ga0207652_10105765 3300025921 Bacteria 2490
390 Ga0207652_10165814 3300025921 Bacteria 1981
391 Ga0207646_10002647 3300025922 Bacteria 21021
392 Ga0207646_10002966 3300025922 Bacteria 19640
393 Ga0207646_10010731 3300025922 Bacteria 8911
394 Ga0207646_10014722 3300025922 Bacteria 7410
395 Ga0207646_10072525 3300025922 Bacteria 3076
396 Ga0207646_10161234 3300025922 Unclassified 2024
397 Ga0207681_10045028 3300025923 Bacteria 2960
398 Ga0207694_10000024 3300025924 Bacteria 259443
399 Ga0207650_10000051 3300025925 Bacteria 168652
400 Ga0207650_10031548 3300025925 Bacteria 3828
401 Ga0207659_10000001 3300025926 Bacteria 660958
402 Ga0207659_10008490 3300025926 Bacteria 6381
403 Ga0207687_10000623 3300025927 Bacteria 23906
404 Ga0207687_10001469 3300025927 Bacteria 16181
405 Ga0207687_10001653 3300025927 Bacteria 15376
406 Ga0207687_10002345 3300025927 Bacteria 12888
407 Ga0207687_10018255 3300025927 Bacteria 4628
408 Ga0207700_10009425 3300025928 Bacteria 6097
409 Ga0207700_10025361 3300025928 Bacteria 4115
410 Ga0207664_10146730 3300025929 Bacteria 2001
411 Ga0207664_10276449 3300025929 Bacteria 1473
412 Ga0207664_10292927 3300025929 Bacteria 1430
413 Ga0207644_10001997 3300025931 Bacteria 13209
414 Ga0207644_10002704 3300025931 Bacteria 11422
415 Ga0207644_10388516 3300025931 Unclassified 1139
416 Ga0207690_10028250 3300025932 Bacteria 3554
417 Ga0207706_10000339 3300025933 Bacteria 50795
418 Ga0207706_10004876 3300025933 Bacteria 12553
419 Ga0207706_10009068 3300025933 Bacteria 9151
420 Ga0207686_10013161 3300025934 Bacteria 4571
421 Ga0207686_10031876 3300025934 Bacteria 3133
422 Ga0207670_10000778 3300025936 Bacteria 16755
423 Ga0207670_10287211 3300025936 Bacteria 1284
424 Ga0207669_10063345 3300025937 Bacteria 2282
425 Ga0207704_10029097 3300025938 Bacteria 3075
426 Ga0207704_10037110 3300025938 Unclassified 2812
427 Ga0207704_10148443 3300025938 Bacteria 1651
428 Ga0207665_10010339 3300025939 Bacteria 6127
429 Ga0207665_10014588 3300025939 Bacteria 5173
430 Ga0207665_10048966 3300025939 Unclassified 2838
431 Ga0207665_10218907 3300025939 Bacteria 1394
432 Ga0207691_10001710 3300025940 Bacteria 21634
433 Ga0207691_10001789 3300025940 Bacteria 21139
434 Ga0207691_10037155 3300025940 Unclassified 4511
435 Ga0207711_10013284 3300025941 Bacteria 6842
436 Ga0207711_10016683 3300025941 Bacteria 6098
437 Ga0207711_10041585 3300025941 Bacteria 3915
438 Ga0207689_10000184 3300025942 Bacteria 54232
439 Ga0207689_10051744 3300025942 Unclassified 3385
440 Ga0207661_10000069 3300025944 Bacteria 70656
441 Ga0207661_10051554 3300025944 Bacteria 3284
442 Ga0207661_10481396 3300025944 Bacteria 1133
443 Ga0207679_10000101 3300025945 Bacteria 71096
444 Ga0207679_10009655 3300025945 Bacteria 6186
445 Ga0207667_10001729 3300025949 Bacteria 27497
446 Ga0207667_10005590 3300025949 Bacteria 15338
447 Ga0207667_10035351 3300025949 Bacteria 5359
448 Ga0207667_10051783 3300025949 Bacteria 4327
449 Ga0207667_10058356 3300025949 Bacteria 4048
450 Ga0207667_10203137 3300025949 Unclassified 2033
451 Ga0207667_10233401 3300025949 Bacteria 1883
452 Ga0207651_10067331 3300025960 Unclassified 2520
453 Ga0207712_10017344 3300025961 Bacteria 4675
454 Ga0207712_10131552 3300025961 Bacteria 1907
455 Ga0207668_10030920 3300025972 Bacteria 3522
456 Ga0207640_10102348 3300025981 Bacteria 2011
457 Ga0207640_10305128 3300025981 Bacteria 1261
458 Ga0207658_10001141 3300025986 Bacteria 21288
459 Ga0207658_10003193 3300025986 Bacteria 11675
460 Ga0207658_10019055 3300025986 Bacteria 4746
461 Ga0207677_10000003 3300026023 Bacteria 450061
462 Ga0207677_10000034 3300026023 Bacteria 117922
463 Ga0207703_10000019 3300026035 Bacteria 254885
464 Ga0207703_10000839 3300026035 Bacteria 30236
465 Ga0207703_10041152 3300026035 Bacteria 3700
466 Ga0207703_10290434 3300026035 Bacteria 1488
467 Ga0207639_10000005 3300026041 Bacteria 579948
468 Ga0207639_10025342 3300026041 Bacteria 4300
469 Ga0207639_10114812 3300026041 Bacteria 2201
470 Ga0207639_10264938 3300026041 Bacteria 1505
471 Ga0207639_10268059 3300026041 Bacteria 1497
472 Ga0207678_10000921 3300026067 Bacteria 26925
473 Ga0207678_10002190 3300026067 Bacteria 17649
474 Ga0207678_10002652 3300026067 Bacteria 16263
475 Ga0207708_10000024 3300026075 Bacteria 172863
476 Ga0207702_10004078 3300026078 Bacteria 13112
477 Ga0207702_10008197 3300026078 Bacteria 8831
478 Ga0207702_10141454 3300026078 Bacteria 2178
479 Ga0207702_10208082 3300026078 Unclassified 1817
480 Ga0207641_10000006 3300026088 Bacteria 442569
481 Ga0207641_10002780 3300026088 Bacteria 15941
482 Ga0207641_10006018 3300026088 Bacteria 10281
483 Ga0207641_10047752 3300026088 Bacteria 3611
484 Ga0207641_10099035 3300026088 Bacteria 2564
485 Ga0207641_10102806 3300026088 Bacteria 2520
486 Ga0207641_10392045 3300026088 Unclassified 1332
487 Ga0207648_10000664 3300026089 Bacteria 38538
488 Ga0207648_10003349 3300026089 Bacteria 16845
489 Ga0207648_10009473 3300026089 Bacteria 9324
490 Ga0207676_10000002 3300026095 Bacteria 1198607
491 Ga0207676_10002185 3300026095 Bacteria 14106
492 Ga0207676_10094434 3300026095 Bacteria 2464
493 Ga0207676_10133693 3300026095 Bacteria 2113
494 Ga0207674_10002167 3300026116 Bacteria 24843
495 Ga0207674_10009736 3300026116 Bacteria 10951
496 Ga0207674_10012889 3300026116 Bacteria 9329
497 Ga0207674_10017826 3300026116 Bacteria 7739
498 Ga0207674_10230528 3300026116 Bacteria 1799
499 Ga0207675_100106512 3300026118 Bacteria 2643
500 Ga0207683_10000460 3300026121 Bacteria 37808
501 Ga0207683_10001670 3300026121 Bacteria 19882
502 Ga0207683_10099462 3300026121 Bacteria 2596
503 Ga0207698_10000008 3300026142 Bacteria 281991
504 Ga0207698_10101694 3300026142 Bacteria 2384
505 Ga0207698_10300883 3300026142 Bacteria 1493
506 Ga0207698_10309124 3300026142 Unclassified 1475
507 Ga0209588_1011308 3300027671 Bacteria 2695
508 Ga0207428_10138319 3300027907 Bacteria 1861
509 Ga0265354_1000021 3300028016 Bacteria 24904
510 Ga0265354_1001873 3300028016 Bacteria 2813
511 Ga0268266_10000153 3300028379 Bacteria 131887
512 Ga0268266_10002191 3300028379 Bacteria 21364
513 Ga0268266_10013979 3300028379 Bacteria 6911
514 Ga0268266_10055676 3300028379 Bacteria 3400
515 Ga0268266_10104266 3300028379 Bacteria 2504
516 Ga0268265_10011994 3300028380 Bacteria 5865
517 Ga0268265_10299912 3300028380 Bacteria 1446
518 Ga0268264_10000669 3300028381 Bacteria 40172
519 Ga0268264_10001226 3300028381 Bacteria 24663
520 Ga0268264_10045316 3300028381 Bacteria 3651
521 Ga0268264_10167702 3300028381 Bacteria 1983
522 Ga0268264_10248502 3300028381 Unclassified 1651
523 Ga0265338_10052974 3300028800 Bacteria 3635
524 Ga0265338_10180950 3300028800 Bacteria 1607
525 Ga0265770_1001287 3300030878 Bacteria 3462
526 Ga0265770_1003233 3300030878 Bacteria 2216
527 Ga0265765_1003655 3300030879 Bacteria 1550
528 Ga0265339_10005498 3300031249 Bacteria 8440
529 Ga0265331_10128639 3300031250 Bacteria 1156
530 Ga0265316_10041336 3300031344 Bacteria 3690
531 Ga0265313_10008888 3300031595 Bacteria 6607
532 Ga0265314_10007163 3300031711 Bacteria 9707
533 Ga0265342_10030322 3300031712 Bacteria 3352
534 Ga0307416_100123614 3300032002 Bacteria 2313
535 Ga0316212_1001185 3300033547 Bacteria 3487
536 Ga0373926_0000636 3300035083 Bacteria 9569
537 Ga0373934_0000710 3300035086 Bacteria 11888
538 Ga0373953_0082393 3300035117 Unclassified 1339
539 Ga0373954_0007118 3300035118 Bacteria 4883
540 Ga0373956_0009696 3300035119 Bacteria 3921
541 Ga0373956_0018682 3300035119 Bacteria 2937
542 Ga0373946_0001883 3300035171 Bacteria 7325
543 Ga0373955_0005463 3300035172 Bacteria 5713
544 Ga0373955_0054539 3300035172 Bacteria 2186
545 Ga0373955_0076666 3300035172 Bacteria 1881
546 Ga0373961_0026879 3300035241 Bacteria 1576
547 Ga0373924_0011060 3300035410 Bacteria 3344
548 Ga0373931_0008198 3300035691 Bacteria 4949
549 Ga0373931_0045338 3300035691 Bacteria 2322
550 Ga0373935_0159403 3300035692 Bacteria 1537
551 Ga0373927_0000782 3300035695 Bacteria 24268
552 Ga0373933_0009110 3300035724 Bacteria 5418
553 Ga0373933_0039687 3300035724 Bacteria 2771
554 Ga0373947_0017268 3300035725 Bacteria 4150
555 Ga0373947_0073749 3300035725 Bacteria 2098
556 Ga0373937_0000349 3300036401 Bacteria 43599
557 Ga0373937_0096703 3300036401 Bacteria 2739
558 Ga0373937_0097787 3300036401 Bacteria 2723
559 Ga0373925_0000717 3300037068 Bacteria 30876
560 Ga0373925_0021689 3300037068 Bacteria 4681
561 Ga0373925_0243120 3300037068 Bacteria 1442
562 Ga0395905_0007860 3300037471 Bacteria 10563
563 Ga0395905_0094350 3300037471 Bacteria 2807
564 Ga0436365_0235218 3300039437 Bacteria 5170
565 Ga0436365_0693404 3300039437 Bacteria 102624
566 Ga0436365_1172964 3300039437 Bacteria 3139
567 Ga0436363_0124748 3300039450 Bacteria 1401
568 Ga0436363_1479800 3300039450 Bacteria 7165
569 Ga0436362_0984254 3300039453 Bacteria 405590
570 Ga0451577_0033406 3300042876 Bacteria 4638
571 Ga0451577_0202079 3300042876 Bacteria 1794
572 Ga0453683_0028024 3300044673 Bacteria 3568
573 Ga0466963_0031125 3300044694 Bacteria 3447
574 Ga0451576_0234056 3300045051 Bacteria 1918
575 Ga0466967_0002708 3300045976 Bacteria 11201
576 Ga0466967_0143575 3300045976 Bacteria 2225
577 Ga0466967_0420615 3300045976 Archaea 1302
578 Ga0495603_0001224 3300046455 Bacteria 14983
579 Ga0495603_0015962 3300046455 Bacteria 4539
580 Ga0495629_0013388 3300046459 Bacteria 5918
581 Ga0495629_0030616 3300046459 Bacteria 3815
582 Ga0495629_0036209 3300046459 Bacteria 3485
583 Ga0495629_0140932 3300046459 Bacteria 1677
584 Ga0495629_0184823 3300046459 Bacteria 1444
585 Ga0495641_0013483 3300046461 Bacteria 4486
586 Ga0495641_0018646 3300046461 Bacteria 3576
587 Ga0495651_0023136 3300046462 Bacteria 4833
588 Ga0495651_0323015 3300046462 Bacteria 1028
589 Ga0495653_0156588 3300046463 Bacteria 1586
590 Ga0495580_0001359 3300046472 Bacteria 21509
591 Ga0495580_0021567 3300046472 Bacteria 4750
592 Ga0495580_0039037 3300046472 Bacteria 3397
593 Ga0495580_0142280 3300046472 Bacteria 1663
594 Ga0495582_0000382 3300046473 Bacteria 24110
595 Ga0495582_0042520 3300046473 Bacteria 2503
596 Ga0495582_0061327 3300046473 Bacteria 2076
597 Ga0495639_0001243 3300046475 Bacteria 11478
598 Ga0495639_0097343 3300046475 Bacteria 1386
599 Ga0495662_0031837 3300046476 Bacteria 2548
600 Ga0495664_0006870 3300046477 Bacteria 6297
601 Ga0495664_0095376 3300046477 Bacteria 1791
602 Ga0495585_0056531 3300046492 Bacteria 2167
603 Ga0495594_0001319 3300046499 Bacteria 12905
604 Ga0495594_0001600 3300046499 Bacteria 11779
605 Ga0495594_0003442 3300046499 Bacteria 8169
606 Ga0495583_0040172 3300046506 Bacteria 2200
607 Ga0495606_0031487 3300046507 Bacteria 3687
608 Ga0495606_0144380 3300046507 Bacteria 1403
609 Ga0495616_0037220 3300046513 Bacteria 2505
610 Ga0495630_0012090 3300046517 Bacteria 6259
611 Ga0495666_0021800 3300046526 Bacteria 3171
612 Ga0495665_0004658 3300046531 Bacteria 7396
613 Ga0495665_0029902 3300046531 Bacteria 2917
614 Ga0495640_0005257 3300046533 Bacteria 10292
615 Ga0495640_0017251 3300046533 Bacteria 5384
616 Ga0495586_0003873 3300046535 Bacteria 8019
617 Ga0495587_0041029 3300046536 Bacteria 2763
618 Ga0495587_0118461 3300046536 Bacteria 1517
619 Ga0495609_0033809 3300046538 Bacteria 2320
620 Ga0495645_0016995 3300046543 Bacteria 5208
621 Ga0495645_0040549 3300046543 Bacteria 3396
622 Ga0495645_0128538 3300046543 Bacteria 1778
623 Ga0495645_0150100 3300046543 Bacteria 1620
624 Ga0495622_0012938 3300046557 Bacteria 3870
625 Ga0495667_0026544 3300046559 Bacteria 3904
626 Ga0495667_0038489 3300046559 Bacteria 3184
627 Ga0495634_0032295 3300046642 Bacteria 3601
628 Ga0495625_0039657 3300046660 Bacteria 3438
629 Ga0495635_0117040 3300046663 Bacteria 1819
630 Ga0495635_0210844 3300046663 Bacteria 1315
631 Ga0495635_0249144 3300046663 Bacteria 1198
632 Ga0495588_0081695 3300046674 Bacteria 1687
633 Ga0495657_0108859 3300046675 Bacteria 1758
634 Ga0495623_0052314 3300046679 Bacteria 2581
635 Ga0495647_0003725 3300046681 Bacteria 4897
636 Ga0495669_0001925 3300046684 Bacteria 8523
637 Ga0495669_0002169 3300046684 Bacteria 8054
638 Ga0495669_0012854 3300046684 Unclassified 3564
639 Ga0495613_0004084 3300046689 Bacteria 10908
640 Ga0495613_0027378 3300046689 Bacteria 4242
641 Ga0495613_0062387 3300046689 Bacteria 2728
642 Ga0495624_0051285 3300046690 Bacteria 2612
643 Ga0495670_0041221 3300046691 Bacteria 2303
644 Ga0495671_0102202 3300046692 Bacteria 1401
645 Ga0495600_0006833 3300046809 Bacteria 6956
646 Ga0495600_0019628 3300046809 Bacteria 4319
647 Ga0495581_0013471 3300047315 Bacteria 4742
648 Ga0495581_0038031 3300047315 Bacteria 2784
649 Ga0495604_0001770 3300047317 Bacteria 17631
650 Ga0495604_0029105 3300047317 Bacteria 4395
651 Ga0495674_0009174 3300047319 Bacteria 9399
652 Ga0495674_0035705 3300047319 Bacteria 4482
653 Ga0495674_0036725 3300047319 Bacteria 4407
654 Ga0495676_0001777 3300047321 Bacteria 18840
655 Ga0495676_0007774 3300047321 Bacteria 9836
656 Ga0495675_0021825 3300047444 Bacteria 4079
657 Ga0495684_0011951 3300047471 Bacteria 6696
658 Ga0495684_0060732 3300047471 Bacteria 2876
659 Ga0495593_0040756 3300047673 Bacteria 2499
660 Ga0495602_0013387 3300048088 Bacteria 8386
661 Ga0495614_0007434 3300048089 Bacteria 4877
662 Ga0495614_0021477 3300048089 Bacteria 2788
663 Ga0496101_0081230 3300048904 Bacteria 2397
664 Ga0496102_0003513 3300048905 Bacteria 13281
665 Ga0496102_0004269 3300048905 Bacteria 12085
666 Ga0496103_0015318 3300048906 Bacteria 4561
667 Ga0496104_0210221 3300048907 Bacteria 1857
668 Ga0496104_0217841 3300048907 Bacteria 1821
669 Ga0496105_0048746 3300048908 Bacteria 3496
670 Ga0496105_0059250 3300048908 Bacteria 3160
671 Ga0496106_0070980 3300048909 Bacteria 2661
672 Ga0496107_0010356 3300048910 Bacteria 6478
673 Ga0496108_0000095 3300048911 Bacteria 92520
674 Ga0496108_0113319 3300048911 Bacteria 2321
675 Ga0496109_0000126 3300048912 Bacteria 77920
676 Ga0496109_0000410 3300048912 Bacteria 38147
677 Ga0496110_0002871 3300048913 Bacteria 13020
678 Ga0496111_0007966 3300048914 Bacteria 6985
679 Ga0496112_0000615 3300048915 Bacteria 24595
680 Ga0496112_0005230 3300048915 Bacteria 11169
681 Ga0496112_0017844 3300048915 Bacteria 6679
682 Ga0496112_0309642 3300048915 Bacteria 1524
683 Ga0496113_0003748 3300048916 Bacteria 9167
684 Ga0496113_0357896 3300048916 Unclassified 1171
685 Ga0496114_0022761 3300048917 Bacteria 5107
686 Ga0496114_0030844 3300048917 Bacteria 4410
687 Ga0496114_0238661 3300048917 Bacteria 1598
688 Ga0496115_0006563 3300048918 Bacteria 8528
689 Ga0496115_0009132 3300048918 Bacteria 7359
690 Ga0496115_0045376 3300048918 Unclassified 3508
691 Ga0501073_0012134 3300049589 Bacteria 6291
692 Ga0501080_0001025 3300049742 Bacteria 22971
693 Ga0501081_0147021 3300049743 Bacteria 1692
694 nmdc:mga05p37_22163_c1 3300050507 Bacteria 7700
695 nmdc:mga06r32_217866_c1 3300050510 Bacteria 1897
696 nmdc:mga06r32_299693_c1 3300050510 Bacteria 1594
697 nmdc:mga06r32_367438_c1 3300050510 Bacteria 1422
698 nmdc:mga06r32_9974_c1 3300050510 Bacteria 8568
699 nmdc:mga08y16_35772_c1 3300050511 Bacteria 5216
700 nmdc:mga0n895_100917_c1 3300050512 Bacteria 2368
701 nmdc:mga0n895_51073_c1 3300050512 Bacteria 4055
702 nmdc:mga0n895_907_c1 3300050512 Bacteria 14186
703 nmdc:mga0rr50_10588_c1 3300050513 Bacteria 5861
704 nmdc:mga0rr50_275741_c1 3300050513 Bacteria 1402
705 nmdc:mga0rr50_49268_c1 3300050513 Bacteria 3118
706 nmdc:mga0rr50_64144_c1 3300050513 Unclassified 2777
707 nmdc:mga08x19_146_c1 3300050514 Bacteria 60222
708 nmdc:mga08x19_2567_c1 3300050514 Bacteria 11042
709 nmdc:mga08x19_57650_c1 3300050514 Bacteria 2510
710 nmdc:mga08x19_6583_c1 3300050514 Bacteria 6885
711 nmdc:mga08x19_689_c1 3300050514 Bacteria 21661
712 nmdc:mga0a205_141703_c1 3300050515 Bacteria 2304
713 nmdc:mga0a205_37552_c1 3300050515 Bacteria 4658
714 nmdc:mga0a205_46298_c1 3300050515 Bacteria 4194
715 Ga0495619_0015727 3300053085 Bacteria 4791
716 Ga0501084_0018572 3300054114 Bacteria 5788
717 Ga0501084_0089633 3300054114 Bacteria 2582
718 Ga0501082_0131148 3300060353 Bacteria 2175

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0108859 Ga0495657_0108859_12_884 282
2 3300054114 Ga0501084_0089633 Ga0501084_0089633_1378_2340 283
3 3300025939 Ga0207665_10048966 Ga0207665_100489663 285
4 3300006852 Ga0075433_10035022 Ga0075433_100350223 288
5 3300006871 Ga0075434_100003588 Ga0075434_1000035885 288
6 3300007076 Ga0075435_100093913 Ga0075435_1000939132 288
7 3300050512 nmdc:mga0n895_907_c1 nmdc:mga0n895_907_c1_7727_8680 288
8 3300050513 nmdc:mga0rr50_64144_c1 nmdc:mga0rr50_64144_c1_1387_2340 288
9 3300050515 nmdc:mga0a205_37552_c1 nmdc:mga0a205_37552_c1_1570_2523 288
10 3300025915 Ga0207693_10046145 Ga0207693_100461452 289
11 3300005445 Ga0070708_100017608 Ga0070708_1000176085 290
12 3300025922 Ga0207646_10072525 Ga0207646_100725253 290
13 3300021358 Ga0213873_10000001 Ga0213873_10000001642 291
14 3300021384 Ga0213876_10000002 Ga0213876_10000002900 291
15 3300039437 Ga0436365_0693404 Ga0436365_0693404_64039_64986 291
16 3300039453 Ga0436362_0984254 Ga0436362_0984254_310786_311733 291
17 3300005468 Ga0070707_100001974 Ga0070707_10000197417 292
18 3300025922 Ga0207646_10002966 Ga0207646_100029663 292
19 3300005445 Ga0070708_100006686 Ga0070708_1000066866 301
20 3300005545 Ga0070695_100002293 Ga0070695_1000022934 301
21 3300005546 Ga0070696_100004097 Ga0070696_1000040972 301
22 3300005549 Ga0070704_100002014 Ga0070704_1000020147 301
23 3300046462 Ga0495651_0323015 Ga0495651_0323015_87_1016 301
24 3300014325 Ga0163163_10001291 Ga0163163_100012912 302
25 3300026023 Ga0207677_10000003 Ga0207677_1000000371 304
26 3300003322 rootL2_10024844 rootL2_100248444 305
27 3300005329 Ga0070683_100000097 Ga0070683_10000009718 305
28 3300005329 Ga0070683_100044469 Ga0070683_1000444692 305
29 3300005329 Ga0070683_100207182 Ga0070683_1002071822 305
30 3300005329 Ga0070683_100222443 Ga0070683_1002224432 305
31 3300005331 Ga0070670_100010640 Ga0070670_1000106404 305
32 3300005331 Ga0070670_100013420 Ga0070670_1000134203 305
33 3300005334 Ga0068869_100001114 Ga0068869_1000011142 305
34 3300005334 Ga0068869_100004783 Ga0068869_1000047834 305
35 3300005338 Ga0068868_100000479 Ga0068868_10000047912 305
36 3300005338 Ga0068868_100003002 Ga0068868_1000030023 305
37 3300005344 Ga0070661_100045692 Ga0070661_1000456922 305
38 3300005344 Ga0070661_100216062 Ga0070661_1002160622 305
39 3300005344 Ga0070661_100356730 Ga0070661_1003567301 305
40 3300005354 Ga0070675_100051327 Ga0070675_1000513272 305
41 3300005355 Ga0070671_100007588 Ga0070671_1000075882 305
42 3300005355 Ga0070671_100017627 Ga0070671_1000176272 305
43 3300005355 Ga0070671_100029409 Ga0070671_1000294092 305
44 3300005367 Ga0070667_100000808 Ga0070667_10000080812 305
45 3300005367 Ga0070667_100045107 Ga0070667_1000451072 305
46 3300005439 Ga0070711_100123852 Ga0070711_1001238522 305
47 3300005455 Ga0070663_100003832 Ga0070663_1000038322 305
48 3300005456 Ga0070678_100005711 Ga0070678_1000057116 305
49 3300005457 Ga0070662_100002775 Ga0070662_1000027757 305
50 3300005458 Ga0070681_10418887 Ga0070681_104188872 305
51 3300005535 Ga0070684_100000031 Ga0070684_10000003153 305
52 3300005535 Ga0070684_100097193 Ga0070684_1000971933 305
53 3300005543 Ga0070672_100004476 Ga0070672_1000044767 305
54 3300005548 Ga0070665_100009991 Ga0070665_1000099919 305
55 3300005548 Ga0070665_100013260 Ga0070665_1000132604 305
56 3300005563 Ga0068855_100009684 Ga0068855_1000096848 305
57 3300005563 Ga0068855_100017878 Ga0068855_1000178786 305
58 3300005564 Ga0070664_100077832 Ga0070664_1000778323 305
59 3300005577 Ga0068857_100000602 Ga0068857_10000060213 305
60 3300005578 Ga0068854_100007505 Ga0068854_1000075056 305
61 3300005614 Ga0068856_100016636 Ga0068856_1000166366 305
62 3300005614 Ga0068856_100295138 Ga0068856_1002951382 305
63 3300005616 Ga0068852_100000032 Ga0068852_1000000328 305
64 3300005616 Ga0068852_100104777 Ga0068852_1001047772 305
65 3300005616 Ga0068852_100218104 Ga0068852_1002181042 305
66 3300005616 Ga0068852_100313696 Ga0068852_1003136962 305
67 3300005617 Ga0068859_100024506 Ga0068859_1000245067 305
68 3300005618 Ga0068864_100033344 Ga0068864_1000333443 305
69 3300005618 Ga0068864_100156212 Ga0068864_1001562122 305
70 3300005834 Ga0068851_10009873 Ga0068851_100098733 305
71 3300005841 Ga0068863_100003024 Ga0068863_1000030242 305
72 3300005841 Ga0068863_100123713 Ga0068863_1001237132 305
73 3300005841 Ga0068863_100127894 Ga0068863_1001278942 305
74 3300005842 Ga0068858_100005975 Ga0068858_1000059752 305
75 3300005843 Ga0068860_100000031 Ga0068860_10000003118 305
76 3300005843 Ga0068860_100047573 Ga0068860_1000475734 305
77 3300006028 Ga0070717_10005591 Ga0070717_100055915 305
78 3300006237 Ga0097621_100012626 Ga0097621_1000126265 305
79 3300006237 Ga0097621_100109589 Ga0097621_1001095892 305
80 3300006358 Ga0068871_100001244 Ga0068871_10000124418 305
81 3300006358 Ga0068871_100011283 Ga0068871_1000112832 305
82 3300006358 Ga0068871_100190361 Ga0068871_1001903612 305
83 3300006931 Ga0097620_100024506 Ga0097620_1000245067 305
84 3300009093 Ga0105240_10000135 Ga0105240_1000013549 305
85 3300009093 Ga0105240_10000451 Ga0105240_1000045118 305
86 3300009093 Ga0105240_10004680 Ga0105240_1000468016 305
87 3300009093 Ga0105240_10048663 Ga0105240_100486633 305
88 3300009093 Ga0105240_10372207 Ga0105240_103722072 305
89 3300009093 Ga0105240_10388657 Ga0105240_103886572 305
90 3300009093 Ga0105240_10439322 Ga0105240_104393222 305
91 3300009093 Ga0105240_10521159 Ga0105240_105211592 305
92 3300009098 Ga0105245_10002852 Ga0105245_100028522 305
93 3300009174 Ga0105241_10050809 Ga0105241_100508094 305
94 3300009177 Ga0105248_10009291 Ga0105248_100092912 305
95 3300009177 Ga0105248_10026710 Ga0105248_100267103 305
96 3300009545 Ga0105237_10297153 Ga0105237_102971532 305
97 3300009551 Ga0105238_10001963 Ga0105238_1000196318 305
98 3300009551 Ga0105238_10666499 Ga0105238_106664991 305
99 3300009553 Ga0105249_10119018 Ga0105249_101190182 305
100 3300009553 Ga0105249_10525790 Ga0105249_105257902 305
101 3300010375 Ga0105239_10111537 Ga0105239_101115373 305
102 3300010375 Ga0105239_10366714 Ga0105239_103667142 305
103 3300013104 Ga0157370_10000023 Ga0157370_1000002382 305
104 3300013104 Ga0157370_10015084 Ga0157370_100150844 305
105 3300013105 Ga0157369_10000010 Ga0157369_10000010159 305
106 3300013105 Ga0157369_10035913 Ga0157369_100359134 305
107 3300013105 Ga0157369_10042861 Ga0157369_100428615 305
108 3300013105 Ga0157369_10062729 Ga0157369_100627294 305
109 3300013105 Ga0157369_10446150 Ga0157369_104461502 305
110 3300013296 Ga0157374_10001688 Ga0157374_100016889 305
111 3300013296 Ga0157374_10046796 Ga0157374_100467963 305
112 3300013296 Ga0157374_10047646 Ga0157374_100476463 305
113 3300013296 Ga0157374_10316594 Ga0157374_103165942 305
114 3300013297 Ga0157378_10006829 Ga0157378_100068294 305
115 3300013297 Ga0157378_10095021 Ga0157378_100950212 305
116 3300013297 Ga0157378_10304705 Ga0157378_103047052 305
117 3300013306 Ga0163162_10001495 Ga0163162_100014953 305
118 3300013306 Ga0163162_10017286 Ga0163162_100172864 305
119 3300013306 Ga0163162_10440447 Ga0163162_104404472 305
120 3300013307 Ga0157372_10000055 Ga0157372_1000005552 305
121 3300013307 Ga0157372_10007697 Ga0157372_100076975 305
122 3300013307 Ga0157372_10068306 Ga0157372_100683062 305
123 3300013307 Ga0157372_10104887 Ga0157372_101048872 305
124 3300013307 Ga0157372_10211618 Ga0157372_102116182 305
125 3300013307 Ga0157372_10223635 Ga0157372_102236352 305
126 3300013308 Ga0157375_10122045 Ga0157375_101220452 305
127 3300013308 Ga0157375_10247725 Ga0157375_102477252 305
128 3300013308 Ga0157375_10517914 Ga0157375_105179142 305
129 3300014325 Ga0163163_10004292 Ga0163163_1000429211 305
130 3300014325 Ga0163163_10011078 Ga0163163_100110787 305
131 3300014325 Ga0163163_10055189 Ga0163163_100551894 305
132 3300014745 Ga0157377_10000105 Ga0157377_100001056 305
133 3300014968 Ga0157379_10001222 Ga0157379_1000122217 305
134 3300014969 Ga0157376_10022142 Ga0157376_100221424 305
135 3300014969 Ga0157376_10068900 Ga0157376_100689003 305
136 3300014969 Ga0157376_10079463 Ga0157376_100794632 305
137 3300014969 Ga0157376_10118333 Ga0157376_101183332 305
138 3300014969 Ga0157376_10170736 Ga0157376_101707361 305
139 3300024227 Ga0228598_1024820 Ga0228598_10248202 305
140 3300025315 Ga0207697_10028981 Ga0207697_100289812 305
141 3300025321 Ga0207656_10009454 Ga0207656_100094543 305
142 3300025321 Ga0207656_10045886 Ga0207656_100458862 305
143 3300025900 Ga0207710_10001423 Ga0207710_100014236 305
144 3300025901 Ga0207688_10093320 Ga0207688_100933202 305
145 3300025903 Ga0207680_10042030 Ga0207680_100420302 305
146 3300025904 Ga0207647_10015179 Ga0207647_100151794 305
147 3300025907 Ga0207645_10040661 Ga0207645_100406613 305
148 3300025912 Ga0207707_10258700 Ga0207707_102587002 305
149 3300025912 Ga0207707_10350079 Ga0207707_103500791 305
150 3300025913 Ga0207695_10000050 Ga0207695_1000005053 305
151 3300025913 Ga0207695_10000075 Ga0207695_10000075241 305
152 3300025913 Ga0207695_10006933 Ga0207695_100069333 305
153 3300025913 Ga0207695_10049587 Ga0207695_100495872 305
154 3300025913 Ga0207695_10072236 Ga0207695_100722362 305
155 3300025913 Ga0207695_10373390 Ga0207695_103733902 305
156 3300025914 Ga0207671_10001031 Ga0207671_100010313 305
157 3300025914 Ga0207671_10061951 Ga0207671_100619512 305
158 3300025924 Ga0207694_10000024 Ga0207694_100000245 305
159 3300025925 Ga0207650_10031548 Ga0207650_100315483 305
160 3300025926 Ga0207659_10008490 Ga0207659_100084903 305
161 3300025927 Ga0207687_10002345 Ga0207687_100023453 305
162 3300025928 Ga0207700_10009425 Ga0207700_100094252 305
163 3300025929 Ga0207664_10276449 Ga0207664_102764492 305
164 3300025931 Ga0207644_10001997 Ga0207644_1000199710 305
165 3300025931 Ga0207644_10388516 Ga0207644_103885161 305
166 3300025933 Ga0207706_10009068 Ga0207706_100090684 305
167 3300025938 Ga0207704_10037110 Ga0207704_100371102 305
168 3300025939 Ga0207665_10218907 Ga0207665_102189072 305
169 3300025940 Ga0207691_10037155 Ga0207691_100371554 305
170 3300025941 Ga0207711_10016683 Ga0207711_100166836 305
171 3300025941 Ga0207711_10041585 Ga0207711_100415853 305
172 3300025942 Ga0207689_10051744 Ga0207689_100517442 305
173 3300025944 Ga0207661_10000069 Ga0207661_1000006924 305
174 3300025944 Ga0207661_10051554 Ga0207661_100515542 305
175 3300025944 Ga0207661_10481396 Ga0207661_104813962 305
176 3300025945 Ga0207679_10009655 Ga0207679_100096555 305
177 3300025949 Ga0207667_10001729 Ga0207667_1000172918 305
178 3300025949 Ga0207667_10035351 Ga0207667_100353515 305
179 3300025949 Ga0207667_10051783 Ga0207667_100517832 305
180 3300025949 Ga0207667_10058356 Ga0207667_100583563 305
181 3300025949 Ga0207667_10203137 Ga0207667_102031372 305
182 3300025949 Ga0207667_10233401 Ga0207667_102334012 305
183 3300025960 Ga0207651_10067331 Ga0207651_100673311 305
184 3300025981 Ga0207640_10305128 Ga0207640_103051282 305
185 3300025986 Ga0207658_10001141 Ga0207658_1000114118 305
186 3300026023 Ga0207677_10000034 Ga0207677_10000034111 305
187 3300026035 Ga0207703_10000839 Ga0207703_100008397 305
188 3300026041 Ga0207639_10114812 Ga0207639_101148122 305
189 3300026067 Ga0207678_10002652 Ga0207678_100026523 305
190 3300026078 Ga0207702_10004078 Ga0207702_100040783 305
191 3300026078 Ga0207702_10141454 Ga0207702_101414542 305
192 3300026088 Ga0207641_10002780 Ga0207641_100027807 305
193 3300026088 Ga0207641_10099035 Ga0207641_100990352 305
194 3300026089 Ga0207648_10009473 Ga0207648_100094732 305
195 3300026095 Ga0207676_10094434 Ga0207676_100944342 305
196 3300026095 Ga0207676_10133693 Ga0207676_101336932 305
197 3300026116 Ga0207674_10002167 Ga0207674_1000216721 305
198 3300026116 Ga0207674_10012889 Ga0207674_100128898 305
199 3300026121 Ga0207683_10000460 Ga0207683_1000046015 305
200 3300026142 Ga0207698_10000008 Ga0207698_10000008219 305
201 3300026142 Ga0207698_10300883 Ga0207698_103008832 305
202 3300026142 Ga0207698_10309124 Ga0207698_103091242 305
203 3300028379 Ga0268266_10055676 Ga0268266_100556762 305
204 3300028379 Ga0268266_10104266 Ga0268266_101042662 305
205 3300028381 Ga0268264_10000669 Ga0268264_1000066927 305
206 3300028381 Ga0268264_10248502 Ga0268264_102485022 305
207 3300028800 Ga0265338_10052974 Ga0265338_100529743 305
208 3300028800 Ga0265338_10180950 Ga0265338_101809502 305
209 3300031249 Ga0265339_10005498 Ga0265339_100054984 305
210 3300031344 Ga0265316_10041336 Ga0265316_100413362 305
211 3300031595 Ga0265313_10008888 Ga0265313_100088883 305
212 3300031711 Ga0265314_10007163 Ga0265314_100071636 305
213 3300031712 Ga0265342_10030322 Ga0265342_100303223 305
214 3300035117 Ga0373953_0082393 Ga0373953_0082393_302_1231 305
215 3300035724 Ga0373933_0039687 Ga0373933_0039687_694_1623 305
216 3300036401 Ga0373937_0097787 Ga0373937_0097787_1569_2498 305
217 3300046455 Ga0495603_0015962 Ga0495603_0015962_2711_3640 305
218 3300046459 Ga0495629_0013388 Ga0495629_0013388_3058_3987 305
219 3300046459 Ga0495629_0030616 Ga0495629_0030616_486_1415 305
220 3300046459 Ga0495629_0036209 Ga0495629_0036209_2135_3064 305
221 3300046459 Ga0495629_0184823 Ga0495629_0184823_168_1097 305
222 3300046473 Ga0495582_0042520 Ga0495582_0042520_760_1689 305
223 3300046477 Ga0495664_0006870 Ga0495664_0006870_2632_3561 305
224 3300046492 Ga0495585_0056531 Ga0495585_0056531_925_1854 305
225 3300046499 Ga0495594_0001319 Ga0495594_0001319_6839_7768 305
226 3300046499 Ga0495594_0001600 Ga0495594_0001600_1933_2862 305
227 3300046499 Ga0495594_0003442 Ga0495594_0003442_3451_4380 305
228 3300046506 Ga0495583_0040172 Ga0495583_0040172_198_1127 305
229 3300046507 Ga0495606_0031487 Ga0495606_0031487_93_1022 305
230 3300046507 Ga0495606_0144380 Ga0495606_0144380_407_1336 305
231 3300046513 Ga0495616_0037220 Ga0495616_0037220_852_1781 305
232 3300046531 Ga0495665_0004658 Ga0495665_0004658_3792_4721 305
233 3300046533 Ga0495640_0005257 Ga0495640_0005257_7064_7993 305
234 3300046536 Ga0495587_0118461 Ga0495587_0118461_294_1223 305
235 3300046538 Ga0495609_0033809 Ga0495609_0033809_852_1781 305
236 3300046543 Ga0495645_0016995 Ga0495645_0016995_3019_3948 305
237 3300046543 Ga0495645_0128538 Ga0495645_0128538_783_1712 305
238 3300046543 Ga0495645_0150100 Ga0495645_0150100_192_1121 305
239 3300046557 Ga0495622_0012938 Ga0495622_0012938_280_1209 305
240 3300046559 Ga0495667_0026544 Ga0495667_0026544_293_1222 305
241 3300046559 Ga0495667_0038489 Ga0495667_0038489_28_957 305
242 3300046642 Ga0495634_0032295 Ga0495634_0032295_798_1727 305
243 3300046660 Ga0495625_0039657 Ga0495625_0039657_736_1665 305
244 3300046663 Ga0495635_0210844 Ga0495635_0210844_74_1003 305
245 3300046663 Ga0495635_0249144 Ga0495635_0249144_51_980 305
246 3300046674 Ga0495588_0081695 Ga0495588_0081695_99_1028 305
247 3300046679 Ga0495623_0052314 Ga0495623_0052314_1033_1962 305
248 3300046684 Ga0495669_0002169 Ga0495669_0002169_480_1409 305
249 3300046689 Ga0495613_0004084 Ga0495613_0004084_5241_6170 305
250 3300046689 Ga0495613_0027378 Ga0495613_0027378_1916_2845 305
251 3300046689 Ga0495613_0062387 Ga0495613_0062387_79_1008 305
252 3300046690 Ga0495624_0051285 Ga0495624_0051285_1351_2280 305
253 3300046691 Ga0495670_0041221 Ga0495670_0041221_324_1253 305
254 3300046692 Ga0495671_0102202 Ga0495671_0102202_374_1303 305
255 3300046809 Ga0495600_0006833 Ga0495600_0006833_3791_4720 305
256 3300047317 Ga0495604_0029105 Ga0495604_0029105_34_963 305
257 3300047319 Ga0495674_0009174 Ga0495674_0009174_1916_2845 305
258 3300047319 Ga0495674_0035705 Ga0495674_0035705_2444_3373 305
259 3300047321 Ga0495676_0007774 Ga0495676_0007774_2089_3018 305
260 3300047444 Ga0495675_0021825 Ga0495675_0021825_863_1792 305
261 3300047673 Ga0495593_0040756 Ga0495593_0040756_1211_2140 305
262 3300048089 Ga0495614_0007434 Ga0495614_0007434_3142_4071 305
263 3300048089 Ga0495614_0021477 Ga0495614_0021477_1727_2656 305
264 3300048907 Ga0496104_0210221 Ga0496104_0210221_64_993 305
265 3300048908 Ga0496105_0048746 Ga0496105_0048746_2355_3284 305
266 3300048908 Ga0496105_0059250 Ga0496105_0059250_1510_2439 305
267 3300048909 Ga0496106_0070980 Ga0496106_0070980_1711_2640 305
268 3300048910 Ga0496107_0010356 Ga0496107_0010356_3352_4281 305
269 3300048915 Ga0496112_0309642 Ga0496112_0309642_505_1434 305
270 3300048917 Ga0496114_0022761 Ga0496114_0022761_3305_4234 305
271 3300048917 Ga0496114_0238661 Ga0496114_0238661_293_1222 305
272 3300048918 Ga0496115_0006563 Ga0496115_0006563_3017_3946 305
273 3300048918 Ga0496115_0045376 Ga0496115_0045376_1758_2687 305
274 3300042876 Ga0451577_0202079 Ga0451577_0202079_475_1449 306
275 3300050514 nmdc:mga08x19_57650_c1 nmdc:mga08x19_57650_c1_239_1240 307
276 3300005354 Ga0070675_100000003 Ga0070675_100000003372 308
277 3300005366 Ga0070659_100404524 Ga0070659_1004045242 308
278 3300006844 Ga0075428_100293309 Ga0075428_1002933092 308
279 3300006871 Ga0075434_100239241 Ga0075434_1002392412 308
280 3300009036 Ga0105244_10013367 Ga0105244_100133672 308
281 3300009098 Ga0105245_10238688 Ga0105245_102386882 308
282 3300025728 Ga0207655_1040181 Ga0207655_10401812 308
283 3300025926 Ga0207659_10000001 Ga0207659_10000001635 308
284 3300025934 Ga0207686_10031876 Ga0207686_100318762 308
285 3300050512 nmdc:mga0n895_100917_c1 nmdc:mga0n895_100917_c1_347_1291 308
286 3300005293 Ga0065715_10095553 Ga0065715_100955533 309
287 3300005328 Ga0070676_10002577 Ga0070676_100025778 309
288 3300005328 Ga0070676_10013025 Ga0070676_100130252 309
289 3300005329 Ga0070683_100015960 Ga0070683_1000159605 309
290 3300005329 Ga0070683_100022036 Ga0070683_1000220363 309
291 3300005330 Ga0070690_100002589 Ga0070690_1000025895 309
292 3300005330 Ga0070690_100012605 Ga0070690_1000126052 309
293 3300005330 Ga0070690_100097002 Ga0070690_1000970022 309
294 3300005331 Ga0070670_100175734 Ga0070670_1001757342 309
295 3300005336 Ga0070680_100010238 Ga0070680_1000102387 309
296 3300005337 Ga0070682_100064671 Ga0070682_1000646712 309
297 3300005340 Ga0070689_100030208 Ga0070689_1000302086 309
298 3300005340 Ga0070689_100290896 Ga0070689_1002908962 309
299 3300005343 Ga0070687_100131256 Ga0070687_1001312562 309
300 3300005344 Ga0070661_100005145 Ga0070661_1000051457 309
301 3300005344 Ga0070661_100005454 Ga0070661_1000054545 309
302 3300005353 Ga0070669_100100748 Ga0070669_1001007482 309
303 3300005354 Ga0070675_100029761 Ga0070675_1000297613 309
304 3300005365 Ga0070688_100046952 Ga0070688_1000469523 309
305 3300005365 Ga0070688_100137183 Ga0070688_1001371832 309
306 3300005366 Ga0070659_100004954 Ga0070659_1000049545 309
307 3300005367 Ga0070667_100050889 Ga0070667_1000508893 309
308 3300005434 Ga0070709_10080316 Ga0070709_100803162 309
309 3300005434 Ga0070709_10096014 Ga0070709_100960142 309
310 3300005435 Ga0070714_100123214 Ga0070714_1001232142 309
311 3300005435 Ga0070714_100207413 Ga0070714_1002074132 309
312 3300005439 Ga0070711_100018101 Ga0070711_1000181012 309
313 3300005440 Ga0070705_100002661 Ga0070705_1000026615 309
314 3300005440 Ga0070705_100043942 Ga0070705_1000439422 309
315 3300005440 Ga0070705_100173749 Ga0070705_1001737492 309
316 3300005444 Ga0070694_100016968 Ga0070694_1000169683 309
317 3300005445 Ga0070708_100040668 Ga0070708_1000406683 309
318 3300005455 Ga0070663_100002121 Ga0070663_1000021217 309
319 3300005455 Ga0070663_100075253 Ga0070663_1000752532 309
320 3300005457 Ga0070662_100000757 Ga0070662_1000007573 309
321 3300005459 Ga0068867_100004156 Ga0068867_1000041563 309
322 3300005466 Ga0070685_10003684 Ga0070685_100036845 309
323 3300005466 Ga0070685_10064461 Ga0070685_100644612 309
324 3300005467 Ga0070706_100006053 Ga0070706_1000060536 309
325 3300005468 Ga0070707_100024983 Ga0070707_1000249832 309
326 3300005471 Ga0070698_100006903 Ga0070698_1000069035 309
327 3300005471 Ga0070698_100022863 Ga0070698_1000228636 309
328 3300005518 Ga0070699_100047276 Ga0070699_1000472763 309
329 3300005530 Ga0070679_100069183 Ga0070679_1000691832 309
330 3300005530 Ga0070679_100079144 Ga0070679_1000791442 309
331 3300005535 Ga0070684_100016682 Ga0070684_1000166827 309
332 3300005536 Ga0070697_100007629 Ga0070697_1000076292 309
333 3300005536 Ga0070697_100009220 Ga0070697_1000092207 309
334 3300005539 Ga0068853_100006331 Ga0068853_1000063315 309
335 3300005539 Ga0068853_100025332 Ga0068853_1000253323 309
336 3300005546 Ga0070696_100167489 Ga0070696_1001674892 309
337 3300005547 Ga0070693_100000004 Ga0070693_10000000466 309
338 3300005547 Ga0070693_100005354 Ga0070693_1000053541 309
339 3300005547 Ga0070693_100007822 Ga0070693_1000078222 309
340 3300005548 Ga0070665_100003370 Ga0070665_10000337013 309
341 3300005548 Ga0070665_100019857 Ga0070665_1000198574 309
342 3300005563 Ga0068855_100014801 Ga0068855_1000148014 309
343 3300005563 Ga0068855_100743515 Ga0068855_1007435151 309
344 3300005564 Ga0070664_100119594 Ga0070664_1001195942 309
345 3300005577 Ga0068857_100003885 Ga0068857_1000038855 309
346 3300005577 Ga0068857_100004856 Ga0068857_1000048564 309
347 3300005577 Ga0068857_100178342 Ga0068857_1001783422 309
348 3300005578 Ga0068854_100000587 Ga0068854_1000005878 309
349 3300005578 Ga0068854_100178829 Ga0068854_1001788292 309
350 3300005614 Ga0068856_100009485 Ga0068856_1000094856 309
351 3300005614 Ga0068856_100039225 Ga0068856_1000392254 309
352 3300005615 Ga0070702_100003922 Ga0070702_1000039222 309
353 3300005616 Ga0068852_100002033 Ga0068852_1000020332 309
354 3300005617 Ga0068859_100112219 Ga0068859_1001122193 309
355 3300005618 Ga0068864_100011164 Ga0068864_1000111642 309
356 3300005718 Ga0068866_10009415 Ga0068866_100094154 309
357 3300005834 Ga0068851_10007717 Ga0068851_100077175 309
358 3300005840 Ga0068870_10001103 Ga0068870_100011037 309
359 3300005841 Ga0068863_100011180 Ga0068863_1000111807 309
360 3300005841 Ga0068863_100082252 Ga0068863_1000822524 309
361 3300005841 Ga0068863_100283149 Ga0068863_1002831492 309
362 3300005842 Ga0068858_100008393 Ga0068858_1000083936 309
363 3300005842 Ga0068858_100013939 Ga0068858_1000139392 309
364 3300005842 Ga0068858_100149088 Ga0068858_1001490882 309
365 3300005843 Ga0068860_100073434 Ga0068860_1000734342 309
366 3300005843 Ga0068860_100144359 Ga0068860_1001443592 309
367 3300005844 Ga0068862_100003359 Ga0068862_1000033594 309
368 3300006173 Ga0070716_100000450 Ga0070716_1000004509 309
369 3300006173 Ga0070716_100003804 Ga0070716_1000038043 309
370 3300006173 Ga0070716_100004439 Ga0070716_1000044392 309
371 3300006173 Ga0070716_100030254 Ga0070716_1000302542 309
372 3300006173 Ga0070716_100136952 Ga0070716_1001369522 309
373 3300006175 Ga0070712_100054144 Ga0070712_1000541442 309
374 3300006237 Ga0097621_100185260 Ga0097621_1001852602 309
375 3300006237 Ga0097621_100279321 Ga0097621_1002793212 309
376 3300006847 Ga0075431_100018995 Ga0075431_1000189956 309
377 3300006852 Ga0075433_10131004 Ga0075433_101310042 309
378 3300006871 Ga0075434_100030079 Ga0075434_1000300792 309
379 3300006871 Ga0075434_100055325 Ga0075434_1000553254 309
380 3300006881 Ga0068865_100002290 Ga0068865_1000022905 309
381 3300006914 Ga0075436_100000737 Ga0075436_1000007374 309
382 3300006914 Ga0075436_100005655 Ga0075436_1000056556 309
383 3300006914 Ga0075436_100026238 Ga0075436_1000262383 309
384 3300006931 Ga0097620_100112217 Ga0097620_1001122173 309
385 3300007076 Ga0075435_100058675 Ga0075435_1000586752 309
386 3300007076 Ga0075435_100336284 Ga0075435_1003362842 309
387 3300007265 Ga0099794_10006331 Ga0099794_100063312 309
388 3300007265 Ga0099794_10023214 Ga0099794_100232142 309
389 3300007265 Ga0099794_10045411 Ga0099794_100454112 309
390 3300007265 Ga0099794_10148372 Ga0099794_101483721 309
391 3300007788 Ga0099795_10025446 Ga0099795_100254462 309
392 3300009093 Ga0105240_10010538 Ga0105240_100105387 309
393 3300009093 Ga0105240_10172716 Ga0105240_101727162 309
394 3300009093 Ga0105240_10543670 Ga0105240_105436702 309
395 3300009098 Ga0105245_10040917 Ga0105245_100409176 309
396 3300009174 Ga0105241_10010010 Ga0105241_100100102 309
397 3300009174 Ga0105241_10021359 Ga0105241_100213592 309
398 3300009174 Ga0105241_10171475 Ga0105241_101714752 309
399 3300009176 Ga0105242_10002605 Ga0105242_100026056 309
400 3300009176 Ga0105242_10024358 Ga0105242_100243586 309
401 3300009177 Ga0105248_10076405 Ga0105248_100764054 309
402 3300009177 Ga0105248_10186842 Ga0105248_101868422 309
403 3300009545 Ga0105237_10017522 Ga0105237_100175225 309
404 3300009545 Ga0105237_10021398 Ga0105237_100213983 309
405 3300009553 Ga0105249_10039077 Ga0105249_100390772 309
406 3300009553 Ga0105249_10089888 Ga0105249_100898882 309
407 3300010159 Ga0099796_10000665 Ga0099796_100006652 309
408 3300010375 Ga0105239_10035672 Ga0105239_100356723 309
409 3300010375 Ga0105239_10057403 Ga0105239_100574032 309
410 3300011119 Ga0105246_10001466 Ga0105246_100014669 309
411 3300011119 Ga0105246_10085885 Ga0105246_100858852 309
412 3300013100 Ga0157373_10003983 Ga0157373_100039836 309
413 3300013100 Ga0157373_10004107 Ga0157373_100041078 309
414 3300013102 Ga0157371_10043860 Ga0157371_100438602 309
415 3300013105 Ga0157369_10213051 Ga0157369_102130512 309
416 3300013296 Ga0157374_10239095 Ga0157374_102390952 309
417 3300013297 Ga0157378_10000044 Ga0157378_100000444 309
418 3300013297 Ga0157378_10002388 Ga0157378_100023885 309
419 3300013297 Ga0157378_10193705 Ga0157378_101937052 309
420 3300013306 Ga0163162_10010928 Ga0163162_100109286 309
421 3300013306 Ga0163162_10176040 Ga0163162_101760402 309
422 3300013306 Ga0163162_10555036 Ga0163162_105550362 309
423 3300013307 Ga0157372_10008911 Ga0157372_100089113 309
424 3300013307 Ga0157372_10250472 Ga0157372_102504722 309
425 3300013307 Ga0157372_10372883 Ga0157372_103728832 309
426 3300014325 Ga0163163_10004406 Ga0163163_100044065 309
427 3300014325 Ga0163163_10086516 Ga0163163_100865162 309
428 3300014745 Ga0157377_10000304 Ga0157377_1000030411 309
429 3300014968 Ga0157379_10008140 Ga0157379_100081403 309
430 3300014969 Ga0157376_10000008 Ga0157376_10000008292 309
431 3300014969 Ga0157376_10002199 Ga0157376_100021993 309
432 3300014969 Ga0157376_10018878 Ga0157376_100188782 309
433 3300025885 Ga0207653_10056710 Ga0207653_100567101 309
434 3300025893 Ga0207682_10007200 Ga0207682_100072003 309
435 3300025901 Ga0207688_10011349 Ga0207688_100113494 309
436 3300025903 Ga0207680_10002500 Ga0207680_100025001 309
437 3300025903 Ga0207680_10004549 Ga0207680_100045495 309
438 3300025904 Ga0207647_10007389 Ga0207647_100073896 309
439 3300025905 Ga0207685_10022938 Ga0207685_100229382 309
440 3300025906 Ga0207699_10069725 Ga0207699_100697252 309
441 3300025907 Ga0207645_10003138 Ga0207645_100031389 309
442 3300025907 Ga0207645_10003581 Ga0207645_100035816 309
443 3300025908 Ga0207643_10000247 Ga0207643_100002475 309
444 3300025910 Ga0207684_10015257 Ga0207684_100152574 309
445 3300025910 Ga0207684_10040516 Ga0207684_100405162 309
446 3300025911 Ga0207654_10013984 Ga0207654_100139843 309
447 3300025911 Ga0207654_10030271 Ga0207654_100302713 309
448 3300025911 Ga0207654_10118775 Ga0207654_101187752 309
449 3300025912 Ga0207707_10035921 Ga0207707_100359215 309
450 3300025913 Ga0207695_10002642 Ga0207695_1000264216 309
451 3300025914 Ga0207671_10010247 Ga0207671_100102472 309
452 3300025914 Ga0207671_10060918 Ga0207671_100609183 309
453 3300025914 Ga0207671_10142339 Ga0207671_101423392 309
454 3300025915 Ga0207693_10044049 Ga0207693_100440492 309
455 3300025915 Ga0207693_10060064 Ga0207693_100600642 309
456 3300025916 Ga0207663_10010895 Ga0207663_100108955 309
457 3300025916 Ga0207663_10014302 Ga0207663_100143022 309
458 3300025916 Ga0207663_10039572 Ga0207663_100395722 309
459 3300025916 Ga0207663_10062463 Ga0207663_100624632 309
460 3300025919 Ga0207657_10001280 Ga0207657_100012806 309
461 3300025919 Ga0207657_10008909 Ga0207657_100089096 309
462 3300025920 Ga0207649_10000566 Ga0207649_100005665 309
463 3300025921 Ga0207652_10029113 Ga0207652_100291134 309
464 3300025921 Ga0207652_10105765 Ga0207652_101057652 309
465 3300025921 Ga0207652_10165814 Ga0207652_101658142 309
466 3300025922 Ga0207646_10002647 Ga0207646_100026479 309
467 3300025922 Ga0207646_10161234 Ga0207646_101612342 309
468 3300025925 Ga0207650_10000051 Ga0207650_10000051119 309
469 3300025927 Ga0207687_10001469 Ga0207687_100014698 309
470 3300025927 Ga0207687_10018255 Ga0207687_100182552 309
471 3300025928 Ga0207700_10025361 Ga0207700_100253613 309
472 3300025929 Ga0207664_10146730 Ga0207664_101467302 309
473 3300025929 Ga0207664_10292927 Ga0207664_102929272 309
474 3300025931 Ga0207644_10002704 Ga0207644_100027045 309
475 3300025932 Ga0207690_10028250 Ga0207690_100282502 309
476 3300025933 Ga0207706_10000339 Ga0207706_1000033932 309
477 3300025933 Ga0207706_10004876 Ga0207706_100048768 309
478 3300025937 Ga0207669_10063345 Ga0207669_100633452 309
479 3300025938 Ga0207704_10148443 Ga0207704_101484432 309
480 3300025939 Ga0207665_10010339 Ga0207665_100103392 309
481 3300025939 Ga0207665_10014588 Ga0207665_100145882 309
482 3300025940 Ga0207691_10001789 Ga0207691_100017898 309
483 3300025941 Ga0207711_10013284 Ga0207711_100132844 309
484 3300025942 Ga0207689_10000184 Ga0207689_1000018444 309
485 3300025945 Ga0207679_10000101 Ga0207679_100001019 309
486 3300025949 Ga0207667_10005590 Ga0207667_100055908 309
487 3300025961 Ga0207712_10017344 Ga0207712_100173442 309
488 3300025961 Ga0207712_10131552 Ga0207712_101315522 309
489 3300025972 Ga0207668_10030920 Ga0207668_100309202 309
490 3300025981 Ga0207640_10102348 Ga0207640_101023482 309
491 3300025986 Ga0207658_10003193 Ga0207658_100031932 309
492 3300025986 Ga0207658_10019055 Ga0207658_100190552 309
493 3300026035 Ga0207703_10041152 Ga0207703_100411522 309
494 3300026035 Ga0207703_10290434 Ga0207703_102904342 309
495 3300026041 Ga0207639_10025342 Ga0207639_100253422 309
496 3300026041 Ga0207639_10264938 Ga0207639_102649382 309
497 3300026041 Ga0207639_10268059 Ga0207639_102680592 309
498 3300026067 Ga0207678_10000921 Ga0207678_1000092113 309
499 3300026067 Ga0207678_10002190 Ga0207678_100021905 309
500 3300026078 Ga0207702_10008197 Ga0207702_100081973 309
501 3300026078 Ga0207702_10208082 Ga0207702_102080822 309
502 3300026088 Ga0207641_10000006 Ga0207641_10000006329 309
503 3300026088 Ga0207641_10006018 Ga0207641_100060188 309
504 3300026088 Ga0207641_10102806 Ga0207641_101028062 309
505 3300026088 Ga0207641_10392045 Ga0207641_103920452 309
506 3300026089 Ga0207648_10000664 Ga0207648_1000066427 309
507 3300026089 Ga0207648_10003349 Ga0207648_100033495 309
508 3300026095 Ga0207676_10002185 Ga0207676_100021856 309
509 3300026116 Ga0207674_10009736 Ga0207674_100097363 309
510 3300026116 Ga0207674_10230528 Ga0207674_102305282 309
511 3300026118 Ga0207675_100106512 Ga0207675_1001065122 309
512 3300026121 Ga0207683_10001670 Ga0207683_100016707 309
513 3300026142 Ga0207698_10101694 Ga0207698_101016942 309
514 3300027671 Ga0209588_1011308 Ga0209588_10113082 309
515 3300028016 Ga0265354_1000021 Ga0265354_100002115 309
516 3300028016 Ga0265354_1001873 Ga0265354_10018732 309
517 3300028379 Ga0268266_10000153 Ga0268266_1000015352 309
518 3300028379 Ga0268266_10002191 Ga0268266_100021919 309
519 3300028379 Ga0268266_10013979 Ga0268266_100139793 309
520 3300028380 Ga0268265_10299912 Ga0268265_102999122 309
521 3300028381 Ga0268264_10001226 Ga0268264_100012266 309
522 3300028381 Ga0268264_10045316 Ga0268264_100453162 309
523 3300028381 Ga0268264_10167702 Ga0268264_101677022 309
524 3300030878 Ga0265770_1001287 Ga0265770_10012872 309
525 3300030878 Ga0265770_1003233 Ga0265770_10032333 309
526 3300030879 Ga0265765_1003655 Ga0265765_10036552 309
527 3300031250 Ga0265331_10128639 Ga0265331_101286392 309
528 3300033547 Ga0316212_1001185 Ga0316212_10011852 309
529 3300035083 Ga0373926_0000636 Ga0373926_0000636_3163_4146 309
530 3300035086 Ga0373934_0000710 Ga0373934_0000710_4264_5235 309
531 3300035118 Ga0373954_0007118 Ga0373954_0007118_2844_3815 309
532 3300035119 Ga0373956_0009696 Ga0373956_0009696_1872_2843 309
533 3300035119 Ga0373956_0018682 Ga0373956_0018682_129_1100 309
534 3300035171 Ga0373946_0001883 Ga0373946_0001883_340_1323 309
535 3300035172 Ga0373955_0005463 Ga0373955_0005463_3483_4454 309
536 3300035172 Ga0373955_0054539 Ga0373955_0054539_249_1220 309
537 3300035172 Ga0373955_0076666 Ga0373955_0076666_172_1128 309
538 3300035241 Ga0373961_0026879 Ga0373961_0026879_259_1209 309
539 3300035410 Ga0373924_0011060 Ga0373924_0011060_1966_2937 309
540 3300035691 Ga0373931_0008198 Ga0373931_0008198_1515_2465 309
541 3300035691 Ga0373931_0045338 Ga0373931_0045338_159_1187 309
542 3300035692 Ga0373935_0159403 Ga0373935_0159403_473_1429 309
543 3300035695 Ga0373927_0000782 Ga0373927_0000782_5980_6963 309
544 3300035724 Ga0373933_0009110 Ga0373933_0009110_2667_3638 309
545 3300035725 Ga0373947_0017268 Ga0373947_0017268_2944_3927 309
546 3300035725 Ga0373947_0073749 Ga0373947_0073749_98_1054 309
547 3300036401 Ga0373937_0000349 Ga0373937_0000349_10152_11123 309
548 3300036401 Ga0373937_0096703 Ga0373937_0096703_773_1729 309
549 3300037068 Ga0373925_0000717 Ga0373925_0000717_12460_13443 309
550 3300037068 Ga0373925_0021689 Ga0373925_0021689_3461_4432 309
551 3300037471 Ga0395905_0007860 Ga0395905_0007860_6395_7357 309
552 3300037471 Ga0395905_0094350 Ga0395905_0094350_1178_2137 309
553 3300039450 Ga0436363_0124748 Ga0436363_0124748_340_1314 309
554 3300039450 Ga0436363_1479800 Ga0436363_1479800_1825_2787 309
555 3300044694 Ga0466963_0031125 Ga0466963_0031125_2097_3077 309
556 3300045051 Ga0451576_0234056 Ga0451576_0234056_864_1817 309
557 3300045976 Ga0466967_0002708 Ga0466967_0002708_3841_4920 309
558 3300045976 Ga0466967_0143575 Ga0466967_0143575_985_1977 309
559 3300045976 Ga0466967_0420615 Ga0466967_0420615_322_1272 309
560 3300046461 Ga0495641_0013483 Ga0495641_0013483_3325_4356 309
561 3300046462 Ga0495651_0023136 Ga0495651_0023136_2612_3583 309
562 3300046463 Ga0495653_0156588 Ga0495653_0156588_393_1364 309
563 3300046472 Ga0495580_0001359 Ga0495580_0001359_2010_3041 309
564 3300046472 Ga0495580_0021567 Ga0495580_0021567_347_1330 309
565 3300046472 Ga0495580_0142280 Ga0495580_0142280_647_1630 309
566 3300046473 Ga0495582_0000382 Ga0495582_0000382_3892_4923 309
567 3300046475 Ga0495639_0097343 Ga0495639_0097343_13_984 309
568 3300046477 Ga0495664_0095376 Ga0495664_0095376_305_1261 309
569 3300046517 Ga0495630_0012090 Ga0495630_0012090_3303_4286 309
570 3300046536 Ga0495587_0041029 Ga0495587_0041029_449_1438 309
571 3300046543 Ga0495645_0040549 Ga0495645_0040549_907_1890 309
572 3300046684 Ga0495669_0001925 Ga0495669_0001925_5682_6641 309
573 3300046684 Ga0495669_0012854 Ga0495669_0012854_633_1589 309
574 3300046809 Ga0495600_0019628 Ga0495600_0019628_2232_3203 309
575 3300047315 Ga0495581_0013471 Ga0495581_0013471_2346_3317 309
576 3300047317 Ga0495604_0001770 Ga0495604_0001770_8516_9487 309
577 3300047471 Ga0495684_0060732 Ga0495684_0060732_110_1081 309
578 3300048088 Ga0495602_0013387 Ga0495602_0013387_5883_6854 309
579 3300048905 Ga0496102_0003513 Ga0496102_0003513_11928_12881 309
580 3300048905 Ga0496102_0004269 Ga0496102_0004269_1263_2264 309
581 3300048906 Ga0496103_0015318 Ga0496103_0015318_2603_3604 309
582 3300048907 Ga0496104_0217841 Ga0496104_0217841_138_1091 309
583 3300048911 Ga0496108_0000095 Ga0496108_0000095_2099_3052 309
584 3300048911 Ga0496108_0113319 Ga0496108_0113319_290_1240 309
585 3300048912 Ga0496109_0000126 Ga0496109_0000126_53021_53974 309
586 3300048913 Ga0496110_0002871 Ga0496110_0002871_10368_11321 309
587 3300048914 Ga0496111_0007966 Ga0496111_0007966_3153_4106 309
588 3300048915 Ga0496112_0000615 Ga0496112_0000615_5706_6659 309
589 3300048915 Ga0496112_0005230 Ga0496112_0005230_2201_3157 309
590 3300048915 Ga0496112_0017844 Ga0496112_0017844_5262_6212 309
591 3300048916 Ga0496113_0003748 Ga0496113_0003748_7525_8478 309
592 3300048916 Ga0496113_0357896 Ga0496113_0357896_191_1147 309
593 3300048917 Ga0496114_0030844 Ga0496114_0030844_432_1463 309
594 3300048918 Ga0496115_0009132 Ga0496115_0009132_5830_6861 309
595 3300050510 nmdc:mga06r32_9974_c1 nmdc:mga06r32_9974_c1_1735_2679 309
596 3300050512 nmdc:mga0n895_51073_c1 nmdc:mga0n895_51073_c1_2929_3975 309
597 3300050513 nmdc:mga0rr50_275741_c1 nmdc:mga0rr50_275741_c1_41_1024 309
598 3300050513 nmdc:mga0rr50_49268_c1 nmdc:mga0rr50_49268_c1_1463_2494 309
599 3300050514 nmdc:mga08x19_146_c1 nmdc:mga08x19_146_c1_18623_19606 309
600 3300050514 nmdc:mga08x19_2567_c1 nmdc:mga08x19_2567_c1_523_1506 309
601 3300050514 nmdc:mga08x19_6583_c1 nmdc:mga08x19_6583_c1_5424_6407 309
602 3300050514 nmdc:mga08x19_689_c1 nmdc:mga08x19_689_c1_6360_7319 309
603 3300050515 nmdc:mga0a205_141703_c1 nmdc:mga0a205_141703_c1_1056_2084 309
604 3300053085 Ga0495619_0015727 Ga0495619_0015727_1834_2805 309
605 3300005337 Ga0070682_100000082 Ga0070682_10000008266 310
606 3300005338 Ga0068868_100226090 Ga0068868_1002260901 310
607 3300005340 Ga0070689_100000899 Ga0070689_1000008994 310
608 3300005438 Ga0070701_10026517 Ga0070701_100265172 310
609 3300005441 Ga0070700_100000001 Ga0070700_100000001221 310
610 3300005444 Ga0070694_100311393 Ga0070694_1003113932 310
611 3300005445 Ga0070708_100443327 Ga0070708_1004433271 310
612 3300005456 Ga0070678_100255363 Ga0070678_1002553631 310
613 3300005467 Ga0070706_100012328 Ga0070706_1000123285 310
614 3300005468 Ga0070707_100004807 Ga0070707_1000048077 310
615 3300005471 Ga0070698_100034608 Ga0070698_1000346085 310
616 3300005471 Ga0070698_100157613 Ga0070698_1001576132 310
617 3300005471 Ga0070698_100195545 Ga0070698_1001955452 310
618 3300005471 Ga0070698_100278086 Ga0070698_1002780861 310
619 3300005518 Ga0070699_100011123 Ga0070699_1000111236 310
620 3300005518 Ga0070699_100015577 Ga0070699_1000155777 310
621 3300005518 Ga0070699_100033738 Ga0070699_1000337383 310
622 3300005543 Ga0070672_100000324 Ga0070672_10000032421 310
623 3300005577 Ga0068857_100015384 Ga0068857_1000153843 310
624 3300005615 Ga0070702_100014769 Ga0070702_1000147692 310
625 3300005617 Ga0068859_100015723 Ga0068859_1000157236 310
626 3300005618 Ga0068864_100000001 Ga0068864_100000001390 310
627 3300005841 Ga0068863_100058770 Ga0068863_1000587704 310
628 3300005842 Ga0068858_100001897 Ga0068858_10000189721 310
629 3300005844 Ga0068862_100008925 Ga0068862_1000089252 310
630 3300006028 Ga0070717_10527211 Ga0070717_105272111 310
631 3300006844 Ga0075428_100031691 Ga0075428_1000316914 310
632 3300006881 Ga0068865_100039266 Ga0068865_1000392664 310
633 3300006931 Ga0097620_100015722 Ga0097620_1000157226 310
634 3300009093 Ga0105240_10017307 Ga0105240_100173074 310
635 3300009098 Ga0105245_10000786 Ga0105245_1000078613 310
636 3300009098 Ga0105245_10016836 Ga0105245_100168362 310
637 3300009147 Ga0114129_10239068 Ga0114129_102390682 310
638 3300009176 Ga0105242_10011272 Ga0105242_100112724 310
639 3300013297 Ga0157378_10016679 Ga0157378_100166793 310
640 3300013306 Ga0163162_10007750 Ga0163162_100077505 310
641 3300013308 Ga0157375_10000005 Ga0157375_10000005259 310
642 3300013308 Ga0157375_10000092 Ga0157375_1000009255 310
643 3300014969 Ga0157376_10570691 Ga0157376_105706912 310
644 3300021384 Ga0213876_10042452 Ga0213876_100424522 310
645 3300025910 Ga0207684_10015510 Ga0207684_100155103 310
646 3300025913 Ga0207695_10028415 Ga0207695_100284155 310
647 3300025915 Ga0207693_10052328 Ga0207693_100523284 310
648 3300025922 Ga0207646_10010731 Ga0207646_100107315 310
649 3300025927 Ga0207687_10000623 Ga0207687_100006232 310
650 3300025927 Ga0207687_10001653 Ga0207687_1000165313 310
651 3300025934 Ga0207686_10013161 Ga0207686_100131615 310
652 3300025936 Ga0207670_10000778 Ga0207670_100007783 310
653 3300025936 Ga0207670_10287211 Ga0207670_102872112 310
654 3300025938 Ga0207704_10029097 Ga0207704_100290974 310
655 3300025940 Ga0207691_10001710 Ga0207691_1000171015 310
656 3300026035 Ga0207703_10000019 Ga0207703_10000019168 310
657 3300026041 Ga0207639_10000005 Ga0207639_10000005134 310
658 3300026075 Ga0207708_10000024 Ga0207708_10000024123 310
659 3300026088 Ga0207641_10047752 Ga0207641_100477522 310
660 3300026095 Ga0207676_10000002 Ga0207676_10000002444 310
661 3300026116 Ga0207674_10017826 Ga0207674_100178261 310
662 3300026121 Ga0207683_10099462 Ga0207683_100994623 310
663 3300028380 Ga0268265_10011994 Ga0268265_100119944 310
664 3300032002 Ga0307416_100123614 Ga0307416_1001236142 310
665 3300037068 Ga0373925_0243120 Ga0373925_0243120_393_1415 310
666 3300039437 Ga0436365_0235218 Ga0436365_0235218_3501_4508 310
667 3300039437 Ga0436365_1172964 Ga0436365_1172964_862_1851 310
668 3300042876 Ga0451577_0033406 Ga0451577_0033406_1967_2950 310
669 3300044673 Ga0453683_0028024 Ga0453683_0028024_777_1760 310
670 3300046455 Ga0495603_0001224 Ga0495603_0001224_2988_4010 310
671 3300046459 Ga0495629_0140932 Ga0495629_0140932_121_1143 310
672 3300046461 Ga0495641_0018646 Ga0495641_0018646_2171_3193 310
673 3300046472 Ga0495580_0039037 Ga0495580_0039037_458_1480 310
674 3300046473 Ga0495582_0061327 Ga0495582_0061327_710_1732 310
675 3300046475 Ga0495639_0001243 Ga0495639_0001243_5893_6915 310
676 3300046476 Ga0495662_0031837 Ga0495662_0031837_133_1155 310
677 3300046526 Ga0495666_0021800 Ga0495666_0021800_263_1285 310
678 3300046531 Ga0495665_0029902 Ga0495665_0029902_1272_2294 310
679 3300046533 Ga0495640_0017251 Ga0495640_0017251_2653_3675 310
680 3300046535 Ga0495586_0003873 Ga0495586_0003873_3779_4801 310
681 3300046663 Ga0495635_0117040 Ga0495635_0117040_14_1036 310
682 3300046681 Ga0495647_0003725 Ga0495647_0003725_2976_3998 310
683 3300047315 Ga0495581_0038031 Ga0495581_0038031_226_1248 310
684 3300047319 Ga0495674_0036725 Ga0495674_0036725_1740_2762 310
685 3300047321 Ga0495676_0001777 Ga0495676_0001777_2716_3738 310
686 3300047471 Ga0495684_0011951 Ga0495684_0011951_1084_2106 310
687 3300048904 Ga0496101_0081230 Ga0496101_0081230_437_1459 310
688 3300049589 Ga0501073_0012134 Ga0501073_0012134_1493_2458 310
689 3300049742 Ga0501080_0001025 Ga0501080_0001025_2039_3004 310
690 3300050513 nmdc:mga0rr50_10588_c1 nmdc:mga0rr50_10588_c1_4274_5233 310
691 3300003203 JGI25406J46586_10019228 JGI25406J46586_100192282 311
692 3300005347 Ga0070668_100168194 Ga0070668_1001681941 311
693 3300005353 Ga0070669_100004094 Ga0070669_1000040946 311
694 3300005468 Ga0070707_100003066 Ga0070707_10000306611 311
695 3300005518 Ga0070699_100099871 Ga0070699_1000998713 311
696 3300005937 Ga0081455_10007293 Ga0081455_100072934 311
697 3300005937 Ga0081455_10065623 Ga0081455_100656232 311
698 3300005985 Ga0081539_10018248 Ga0081539_100182483 311
699 3300006847 Ga0075431_100136569 Ga0075431_1001365692 311
700 3300006847 Ga0075431_100402784 Ga0075431_1004027841 311
701 3300006847 Ga0075431_100430035 Ga0075431_1004300351 311
702 3300006852 Ga0075433_10280229 Ga0075433_102802292 311
703 3300006880 Ga0075429_100263342 Ga0075429_1002633422 311
704 3300009147 Ga0114129_10157396 Ga0114129_101573962 311
705 3300014326 Ga0157380_10362470 Ga0157380_103624701 311
706 3300025922 Ga0207646_10014722 Ga0207646_100147224 311
707 3300025923 Ga0207681_10045028 Ga0207681_100450282 311
708 3300027907 Ga0207428_10138319 Ga0207428_101383192 311
709 3300048912 Ga0496109_0000410 Ga0496109_0000410_35956_36891 311
710 3300049743 Ga0501081_0147021 Ga0501081_0147021_223_1161 311
711 3300050507 nmdc:mga05p37_22163_c1 nmdc:mga05p37_22163_c1_63_998 311
712 3300050510 nmdc:mga06r32_217866_c1 nmdc:mga06r32_217866_c1_402_1337 311
713 3300050510 nmdc:mga06r32_299693_c1 nmdc:mga06r32_299693_c1_528_1472 311
714 3300050510 nmdc:mga06r32_367438_c1 nmdc:mga06r32_367438_c1_170_1105 311
715 3300050511 nmdc:mga08y16_35772_c1 nmdc:mga08y16_35772_c1_854_1789 311
716 3300050515 nmdc:mga0a205_46298_c1 nmdc:mga0a205_46298_c1_3078_4013 311
717 3300054114 Ga0501084_0018572 Ga0501084_0018572_2560_3498 311
718 3300060353 Ga0501082_0131148 Ga0501082_0131148_658_1596 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9546 3 222
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9442 1 216
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.933 1 222
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9326 1 216
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.929 4 223
ID Description Score Start End Superfamily
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.966 4 224 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9636 2 220 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9595 2 221 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9552 1 221 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9547 4 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D2QAU4-F1-model_v4 ABC transporter ATP-binding protein 0.9789 3 153 GO:0005524
GO:0016887
AF-A0A358GWI5-F1-model_v4 deleted 0.9727 2 224
AF-A0A7Y8LYW3-F1-model_v4 ABC transporter ATP-binding protein 0.9715 2 181 GO:0005524
GO:0016887
AF-Q8VR06-F1-model_v4 Putative ABC transporter protein 0.971 81 222 GO:0005524
GO:0016887
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9684 1 183 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
94.51 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map