F477185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 293 | 718 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0002708|Ga0466967_0002708_3841_4920 |
| Length | 359 |
| Sequence | MERYAPEWPPTFGSNRQPQPNARQRSNEDEENFVSAIITDNVTRRFGDFTAVDRVSIRVEKGEVFGFLGPNGSGKTTLIKMLTGLLPLSEGSASVDDVDVTADPELVRERIGYMSQKFSLYDDLTVEENLTFYGRIYGLSPQRLRSRMDAIIETNGLAPYVRRSAAKLSGGWKQRLALGCAMLHEPRIMFLDEPTAGIDPVARRTLWDLLFQLSGQGITFFVTTHYMDEAERCSHVAYIYFGRIIADGTPDDLKEIPEINPPGTKRIEIDSSEVTRALMLAREFAGVRSATVFGQAIHALVDDRLSESALSEYLSREHIRVHEIRSLLPSLEDVFVELTYRRQAELEAENGVAKETVHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 194 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.9 |
| Rhizosphere | 94.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10019228 | 3300003203 | Bacteria | 2789 |
| 2 | rootL2_10024844 | 3300003322 | Bacteria | 7071 |
| 3 | Ga0065715_10095553 | 3300005293 | Bacteria | 4060 |
| 4 | Ga0070676_10002577 | 3300005328 | Bacteria | 9318 |
| 5 | Ga0070676_10013025 | 3300005328 | Bacteria | 4557 |
| 6 | Ga0070683_100000097 | 3300005329 | Bacteria | 57304 |
| 7 | Ga0070683_100015960 | 3300005329 | Bacteria | 6607 |
| 8 | Ga0070683_100022036 | 3300005329 | Bacteria | 5688 |
| 9 | Ga0070683_100044469 | 3300005329 | Bacteria | 4095 |
| 10 | Ga0070683_100207182 | 3300005329 | Bacteria | 1862 |
| 11 | Ga0070683_100222443 | 3300005329 | Bacteria | 1794 |
| 12 | Ga0070690_100002589 | 3300005330 | Bacteria | 9744 |
| 13 | Ga0070690_100012605 | 3300005330 | Bacteria | 4976 |
| 14 | Ga0070690_100097002 | 3300005330 | Bacteria | 1949 |
| 15 | Ga0070670_100010640 | 3300005331 | Bacteria | 7859 |
| 16 | Ga0070670_100013420 | 3300005331 | Bacteria | 7017 |
| 17 | Ga0070670_100175734 | 3300005331 | Bacteria | 1858 |
| 18 | Ga0068869_100001114 | 3300005334 | Bacteria | 15660 |
| 19 | Ga0068869_100004783 | 3300005334 | Bacteria | 8453 |
| 20 | Ga0070680_100010238 | 3300005336 | Bacteria | 7230 |
| 21 | Ga0070682_100000082 | 3300005337 | Bacteria | 85071 |
| 22 | Ga0070682_100064671 | 3300005337 | Bacteria | 2322 |
| 23 | Ga0068868_100000479 | 3300005338 | Bacteria | 26512 |
| 24 | Ga0068868_100003002 | 3300005338 | Bacteria | 11729 |
| 25 | Ga0068868_100226090 | 3300005338 | Bacteria | 1568 |
| 26 | Ga0070689_100000899 | 3300005340 | Bacteria | 18558 |
| 27 | Ga0070689_100030208 | 3300005340 | Bacteria | 4111 |
| 28 | Ga0070689_100290896 | 3300005340 | Bacteria | 1358 |
| 29 | Ga0070687_100131256 | 3300005343 | Bacteria | 1447 |
| 30 | Ga0070661_100005145 | 3300005344 | Bacteria | 9008 |
| 31 | Ga0070661_100005454 | 3300005344 | Bacteria | 8771 |
| 32 | Ga0070661_100045692 | 3300005344 | Bacteria | 3202 |
| 33 | Ga0070661_100216062 | 3300005344 | Unclassified | 1469 |
| 34 | Ga0070661_100356730 | 3300005344 | Bacteria | 1148 |
| 35 | Ga0070668_100168194 | 3300005347 | Bacteria | 1783 |
| 36 | Ga0070669_100004094 | 3300005353 | Bacteria | 10564 |
| 37 | Ga0070669_100100748 | 3300005353 | Bacteria | 2178 |
| 38 | Ga0070675_100000003 | 3300005354 | Bacteria | 422595 |
| 39 | Ga0070675_100029761 | 3300005354 | Bacteria | 4406 |
| 40 | Ga0070675_100051327 | 3300005354 | Bacteria | 3389 |
| 41 | Ga0070671_100007588 | 3300005355 | Bacteria | 8673 |
| 42 | Ga0070671_100017627 | 3300005355 | Bacteria | 5786 |
| 43 | Ga0070671_100029409 | 3300005355 | Bacteria | 4530 |
| 44 | Ga0070688_100046952 | 3300005365 | Bacteria | 2676 |
| 45 | Ga0070688_100137183 | 3300005365 | Bacteria | 1657 |
| 46 | Ga0070659_100004954 | 3300005366 | Bacteria | 9526 |
| 47 | Ga0070659_100404524 | 3300005366 | Bacteria | 1153 |
| 48 | Ga0070667_100000808 | 3300005367 | Bacteria | 29235 |
| 49 | Ga0070667_100045107 | 3300005367 | Bacteria | 3706 |
| 50 | Ga0070667_100050889 | 3300005367 | Bacteria | 3491 |
| 51 | Ga0070709_10080316 | 3300005434 | Bacteria | 2126 |
| 52 | Ga0070709_10096014 | 3300005434 | Bacteria | 1965 |
| 53 | Ga0070714_100123214 | 3300005435 | Bacteria | 2308 |
| 54 | Ga0070714_100207413 | 3300005435 | Unclassified | 1795 |
| 55 | Ga0070701_10026517 | 3300005438 | Bacteria | 2827 |
| 56 | Ga0070711_100018101 | 3300005439 | Bacteria | 4495 |
| 57 | Ga0070711_100123852 | 3300005439 | Bacteria | 1916 |
| 58 | Ga0070705_100002661 | 3300005440 | Bacteria | 8942 |
| 59 | Ga0070705_100043942 | 3300005440 | Bacteria | 2564 |
| 60 | Ga0070705_100173749 | 3300005440 | Unclassified | 1453 |
| 61 | Ga0070700_100000001 | 3300005441 | Bacteria | 346167 |
| 62 | Ga0070694_100016968 | 3300005444 | Bacteria | 4594 |
| 63 | Ga0070694_100311393 | 3300005444 | Bacteria | 1209 |
| 64 | Ga0070708_100006686 | 3300005445 | Bacteria | 9181 |
| 65 | Ga0070708_100017608 | 3300005445 | Bacteria | 5965 |
| 66 | Ga0070708_100040668 | 3300005445 | Unclassified | 4072 |
| 67 | Ga0070708_100443327 | 3300005445 | Bacteria | 1225 |
| 68 | Ga0070663_100002121 | 3300005455 | Bacteria | 11111 |
| 69 | Ga0070663_100003832 | 3300005455 | Bacteria | 8755 |
| 70 | Ga0070663_100075253 | 3300005455 | Bacteria | 2467 |
| 71 | Ga0070678_100005711 | 3300005456 | Bacteria | 7228 |
| 72 | Ga0070678_100255363 | 3300005456 | Bacteria | 1471 |
| 73 | Ga0070662_100000757 | 3300005457 | Bacteria | 19820 |
| 74 | Ga0070662_100002775 | 3300005457 | Bacteria | 10842 |
| 75 | Ga0070681_10418887 | 3300005458 | Bacteria | 1251 |
| 76 | Ga0068867_100004156 | 3300005459 | Bacteria | 10180 |
| 77 | Ga0070685_10003684 | 3300005466 | Bacteria | 7766 |
| 78 | Ga0070685_10064461 | 3300005466 | Bacteria | 2154 |
| 79 | Ga0070706_100006053 | 3300005467 | Bacteria | 11435 |
| 80 | Ga0070706_100012328 | 3300005467 | Bacteria | 7922 |
| 81 | Ga0070707_100001974 | 3300005468 | Bacteria | 19626 |
| 82 | Ga0070707_100003066 | 3300005468 | Bacteria | 15829 |
| 83 | Ga0070707_100004807 | 3300005468 | Bacteria | 12652 |
| 84 | Ga0070707_100024983 | 3300005468 | Bacteria | 5665 |
| 85 | Ga0070698_100006903 | 3300005471 | Bacteria | 12304 |
| 86 | Ga0070698_100022863 | 3300005471 | Bacteria | 6537 |
| 87 | Ga0070698_100034608 | 3300005471 | Bacteria | 5228 |
| 88 | Ga0070698_100157613 | 3300005471 | Bacteria | 2215 |
| 89 | Ga0070698_100195545 | 3300005471 | Bacteria | 1959 |
| 90 | Ga0070698_100278086 | 3300005471 | Bacteria | 1606 |
| 91 | Ga0070699_100011123 | 3300005518 | Bacteria | 7777 |
| 92 | Ga0070699_100015577 | 3300005518 | Bacteria | 6531 |
| 93 | Ga0070699_100033738 | 3300005518 | Bacteria | 4423 |
| 94 | Ga0070699_100047276 | 3300005518 | Unclassified | 3723 |
| 95 | Ga0070699_100099871 | 3300005518 | Bacteria | 2543 |
| 96 | Ga0070679_100069183 | 3300005530 | Bacteria | 3521 |
| 97 | Ga0070679_100079144 | 3300005530 | Bacteria | 3276 |
| 98 | Ga0070684_100000031 | 3300005535 | Bacteria | 106109 |
| 99 | Ga0070684_100016682 | 3300005535 | Bacteria | 6010 |
| 100 | Ga0070684_100097193 | 3300005535 | Bacteria | 2626 |
| 101 | Ga0070697_100007629 | 3300005536 | Bacteria | 8421 |
| 102 | Ga0070697_100009220 | 3300005536 | Bacteria | 7711 |
| 103 | Ga0068853_100006331 | 3300005539 | Bacteria | 9396 |
| 104 | Ga0068853_100025332 | 3300005539 | Bacteria | 4977 |
| 105 | Ga0070672_100000324 | 3300005543 | Bacteria | 27234 |
| 106 | Ga0070672_100004476 | 3300005543 | Bacteria | 9153 |
| 107 | Ga0070695_100002293 | 3300005545 | Bacteria | 10965 |
| 108 | Ga0070696_100004097 | 3300005546 | Bacteria | 9718 |
| 109 | Ga0070696_100167489 | 3300005546 | Bacteria | 1622 |
| 110 | Ga0070693_100000004 | 3300005547 | Bacteria | 94899 |
| 111 | Ga0070693_100005354 | 3300005547 | Bacteria | 6152 |
| 112 | Ga0070693_100007822 | 3300005547 | Bacteria | 5239 |
| 113 | Ga0070665_100003370 | 3300005548 | Bacteria | 17092 |
| 114 | Ga0070665_100009991 | 3300005548 | Bacteria | 9601 |
| 115 | Ga0070665_100013260 | 3300005548 | Bacteria | 8300 |
| 116 | Ga0070665_100019857 | 3300005548 | Bacteria | 6747 |
| 117 | Ga0070704_100002014 | 3300005549 | Bacteria | 11260 |
| 118 | Ga0068855_100009684 | 3300005563 | Bacteria | 11631 |
| 119 | Ga0068855_100014801 | 3300005563 | Bacteria | 9392 |
| 120 | Ga0068855_100017878 | 3300005563 | Bacteria | 8519 |
| 121 | Ga0068855_100743515 | 3300005563 | Bacteria | 1046 |
| 122 | Ga0070664_100077832 | 3300005564 | Bacteria | 2852 |
| 123 | Ga0070664_100119594 | 3300005564 | Bacteria | 2305 |
| 124 | Ga0068857_100000602 | 3300005577 | Bacteria | 26435 |
| 125 | Ga0068857_100003885 | 3300005577 | Bacteria | 12577 |
| 126 | Ga0068857_100004856 | 3300005577 | Bacteria | 11400 |
| 127 | Ga0068857_100015384 | 3300005577 | Bacteria | 6681 |
| 128 | Ga0068857_100178342 | 3300005577 | Bacteria | 1933 |
| 129 | Ga0068854_100000587 | 3300005578 | Bacteria | 21705 |
| 130 | Ga0068854_100007505 | 3300005578 | Bacteria | 6970 |
| 131 | Ga0068854_100178829 | 3300005578 | Bacteria | 1656 |
| 132 | Ga0068856_100009485 | 3300005614 | Bacteria | 9450 |
| 133 | Ga0068856_100016636 | 3300005614 | Bacteria | 7121 |
| 134 | Ga0068856_100039225 | 3300005614 | Bacteria | 4649 |
| 135 | Ga0068856_100295138 | 3300005614 | Bacteria | 1638 |
| 136 | Ga0070702_100003922 | 3300005615 | Bacteria | 6743 |
| 137 | Ga0070702_100014769 | 3300005615 | Bacteria | 3970 |
| 138 | Ga0068852_100000032 | 3300005616 | Bacteria | 102480 |
| 139 | Ga0068852_100002033 | 3300005616 | Bacteria | 13786 |
| 140 | Ga0068852_100104777 | 3300005616 | Bacteria | 2561 |
| 141 | Ga0068852_100218104 | 3300005616 | Unclassified | 1813 |
| 142 | Ga0068852_100313696 | 3300005616 | Bacteria | 1521 |
| 143 | Ga0068859_100015723 | 3300005617 | Bacteria | 7605 |
| 144 | Ga0068859_100024506 | 3300005617 | Bacteria | 6054 |
| 145 | Ga0068859_100112219 | 3300005617 | Bacteria | 2789 |
| 146 | Ga0068864_100000001 | 3300005618 | Bacteria | 686767 |
| 147 | Ga0068864_100011164 | 3300005618 | Bacteria | 7424 |
| 148 | Ga0068864_100033344 | 3300005618 | Bacteria | 4377 |
| 149 | Ga0068864_100156212 | 3300005618 | Bacteria | 2070 |
| 150 | Ga0068866_10009415 | 3300005718 | Bacteria | 4147 |
| 151 | Ga0068851_10007717 | 3300005834 | Bacteria | 4948 |
| 152 | Ga0068851_10009873 | 3300005834 | Bacteria | 4445 |
| 153 | Ga0068870_10001103 | 3300005840 | Bacteria | 10735 |
| 154 | Ga0068863_100003024 | 3300005841 | Bacteria | 16624 |
| 155 | Ga0068863_100011180 | 3300005841 | Bacteria | 8699 |
| 156 | Ga0068863_100058770 | 3300005841 | Bacteria | 3639 |
| 157 | Ga0068863_100082252 | 3300005841 | Unclassified | 3051 |
| 158 | Ga0068863_100123713 | 3300005841 | Bacteria | 2468 |
| 159 | Ga0068863_100127894 | 3300005841 | Bacteria | 2424 |
| 160 | Ga0068863_100283149 | 3300005841 | Bacteria | 1606 |
| 161 | Ga0068858_100001897 | 3300005842 | Bacteria | 21342 |
| 162 | Ga0068858_100005975 | 3300005842 | Bacteria | 11887 |
| 163 | Ga0068858_100008393 | 3300005842 | Bacteria | 9936 |
| 164 | Ga0068858_100013939 | 3300005842 | Bacteria | 7582 |
| 165 | Ga0068858_100149088 | 3300005842 | Bacteria | 2198 |
| 166 | Ga0068860_100000031 | 3300005843 | Bacteria | 255068 |
| 167 | Ga0068860_100047573 | 3300005843 | Bacteria | 4088 |
| 168 | Ga0068860_100073434 | 3300005843 | Bacteria | 3251 |
| 169 | Ga0068860_100144359 | 3300005843 | Bacteria | 2289 |
| 170 | Ga0068862_100003359 | 3300005844 | Bacteria | 13812 |
| 171 | Ga0068862_100008925 | 3300005844 | Bacteria | 8300 |
| 172 | Ga0081455_10007293 | 3300005937 | Bacteria | 11668 |
| 173 | Ga0081455_10065623 | 3300005937 | Unclassified | 3035 |
| 174 | Ga0081539_10018248 | 3300005985 | Bacteria | 4879 |
| 175 | Ga0070717_10005591 | 3300006028 | Bacteria | 9176 |
| 176 | Ga0070717_10527211 | 3300006028 | Bacteria | 1069 |
| 177 | Ga0070716_100000450 | 3300006173 | Bacteria | 17008 |
| 178 | Ga0070716_100003804 | 3300006173 | Bacteria | 7159 |
| 179 | Ga0070716_100004439 | 3300006173 | Bacteria | 6709 |
| 180 | Ga0070716_100030254 | 3300006173 | Bacteria | 2936 |
| 181 | Ga0070716_100136952 | 3300006173 | Bacteria | 1556 |
| 182 | Ga0070712_100054144 | 3300006175 | Bacteria | 2804 |
| 183 | Ga0097621_100012626 | 3300006237 | Bacteria | 6269 |
| 184 | Ga0097621_100109589 | 3300006237 | Bacteria | 2332 |
| 185 | Ga0097621_100185260 | 3300006237 | Bacteria | 1800 |
| 186 | Ga0097621_100279321 | 3300006237 | Bacteria | 1470 |
| 187 | Ga0068871_100001244 | 3300006358 | Bacteria | 17011 |
| 188 | Ga0068871_100011283 | 3300006358 | Bacteria | 6551 |
| 189 | Ga0068871_100190361 | 3300006358 | Bacteria | 1767 |
| 190 | Ga0075428_100031691 | 3300006844 | Bacteria | 5841 |
| 191 | Ga0075428_100293309 | 3300006844 | Bacteria | 1749 |
| 192 | Ga0075431_100018995 | 3300006847 | Bacteria | 7003 |
| 193 | Ga0075431_100136569 | 3300006847 | Bacteria | 2528 |
| 194 | Ga0075431_100402784 | 3300006847 | Bacteria | 1369 |
| 195 | Ga0075431_100430035 | 3300006847 | Bacteria | 1318 |
| 196 | Ga0075433_10035022 | 3300006852 | Bacteria | 4315 |
| 197 | Ga0075433_10131004 | 3300006852 | Bacteria | 2228 |
| 198 | Ga0075433_10280229 | 3300006852 | Bacteria | 1477 |
| 199 | Ga0075434_100003588 | 3300006871 | Bacteria | 13866 |
| 200 | Ga0075434_100030079 | 3300006871 | Bacteria | 5346 |
| 201 | Ga0075434_100055325 | 3300006871 | Bacteria | 3943 |
| 202 | Ga0075434_100239241 | 3300006871 | Bacteria | 1836 |
| 203 | Ga0075429_100263342 | 3300006880 | Bacteria | 1510 |
| 204 | Ga0068865_100002290 | 3300006881 | Bacteria | 11280 |
| 205 | Ga0068865_100039266 | 3300006881 | Bacteria | 3210 |
| 206 | Ga0075436_100000737 | 3300006914 | Bacteria | 21698 |
| 207 | Ga0075436_100005655 | 3300006914 | Bacteria | 8581 |
| 208 | Ga0075436_100026238 | 3300006914 | Unclassified | 4011 |
| 209 | Ga0097620_100015722 | 3300006931 | Bacteria | 7605 |
| 210 | Ga0097620_100024506 | 3300006931 | Bacteria | 6054 |
| 211 | Ga0097620_100112217 | 3300006931 | Bacteria | 2789 |
| 212 | Ga0075435_100058675 | 3300007076 | Bacteria | 3118 |
| 213 | Ga0075435_100093913 | 3300007076 | Unclassified | 2479 |
| 214 | Ga0075435_100336284 | 3300007076 | Unclassified | 1294 |
| 215 | Ga0099794_10006331 | 3300007265 | Bacteria | 4785 |
| 216 | Ga0099794_10023214 | 3300007265 | Bacteria | 2835 |
| 217 | Ga0099794_10045411 | 3300007265 | Bacteria | 2102 |
| 218 | Ga0099794_10148372 | 3300007265 | Bacteria | 1190 |
| 219 | Ga0099795_10025446 | 3300007788 | Bacteria | 1985 |
| 220 | Ga0105244_10013367 | 3300009036 | Bacteria | 4803 |
| 221 | Ga0105240_10000135 | 3300009093 | Bacteria | 151432 |
| 222 | Ga0105240_10000451 | 3300009093 | Bacteria | 75544 |
| 223 | Ga0105240_10004680 | 3300009093 | Bacteria | 20685 |
| 224 | Ga0105240_10010538 | 3300009093 | Bacteria | 12985 |
| 225 | Ga0105240_10017307 | 3300009093 | Bacteria | 9718 |
| 226 | Ga0105240_10048663 | 3300009093 | Bacteria | 5356 |
| 227 | Ga0105240_10172716 | 3300009093 | Bacteria | 2558 |
| 228 | Ga0105240_10372207 | 3300009093 | Bacteria | 1615 |
| 229 | Ga0105240_10388657 | 3300009093 | Bacteria | 1574 |
| 230 | Ga0105240_10439322 | 3300009093 | Bacteria | 1462 |
| 231 | Ga0105240_10521159 | 3300009093 | Bacteria | 1319 |
| 232 | Ga0105240_10543670 | 3300009093 | Bacteria | 1286 |
| 233 | Ga0105245_10000786 | 3300009098 | Bacteria | 28771 |
| 234 | Ga0105245_10002852 | 3300009098 | Bacteria | 15538 |
| 235 | Ga0105245_10016836 | 3300009098 | Bacteria | 6382 |
| 236 | Ga0105245_10040917 | 3300009098 | Bacteria | 4131 |
| 237 | Ga0105245_10238688 | 3300009098 | Bacteria | 1761 |
| 238 | Ga0114129_10157396 | 3300009147 | Bacteria | 3106 |
| 239 | Ga0114129_10239068 | 3300009147 | Bacteria | 2442 |
| 240 | Ga0105241_10010010 | 3300009174 | Bacteria | 6962 |
| 241 | Ga0105241_10021359 | 3300009174 | Bacteria | 4785 |
| 242 | Ga0105241_10050809 | 3300009174 | Bacteria | 3160 |
| 243 | Ga0105241_10171475 | 3300009174 | Bacteria | 1792 |
| 244 | Ga0105242_10002605 | 3300009176 | Bacteria | 14141 |
| 245 | Ga0105242_10011272 | 3300009176 | Bacteria | 6869 |
| 246 | Ga0105242_10024358 | 3300009176 | Bacteria | 4780 |
| 247 | Ga0105248_10009291 | 3300009177 | Bacteria | 10826 |
| 248 | Ga0105248_10026710 | 3300009177 | Bacteria | 6420 |
| 249 | Ga0105248_10076405 | 3300009177 | Bacteria | 3764 |
| 250 | Ga0105248_10186842 | 3300009177 | Bacteria | 2335 |
| 251 | Ga0105237_10017522 | 3300009545 | Bacteria | 7423 |
| 252 | Ga0105237_10021398 | 3300009545 | Bacteria | 6649 |
| 253 | Ga0105237_10297153 | 3300009545 | Bacteria | 1618 |
| 254 | Ga0105238_10001963 | 3300009551 | Bacteria | 20716 |
| 255 | Ga0105238_10666499 | 3300009551 | Bacteria | 1051 |
| 256 | Ga0105249_10039077 | 3300009553 | Bacteria | 4307 |
| 257 | Ga0105249_10089888 | 3300009553 | Bacteria | 2870 |
| 258 | Ga0105249_10119018 | 3300009553 | Unclassified | 2508 |
| 259 | Ga0105249_10525790 | 3300009553 | Bacteria | 1231 |
| 260 | Ga0099796_10000665 | 3300010159 | Bacteria | 6015 |
| 261 | Ga0105239_10035672 | 3300010375 | Bacteria | 5460 |
| 262 | Ga0105239_10057403 | 3300010375 | Unclassified | 4269 |
| 263 | Ga0105239_10111537 | 3300010375 | Unclassified | 3032 |
| 264 | Ga0105239_10366714 | 3300010375 | Bacteria | 1627 |
| 265 | Ga0105246_10001466 | 3300011119 | Bacteria | 14010 |
| 266 | Ga0105246_10085885 | 3300011119 | Bacteria | 2254 |
| 267 | Ga0157373_10003983 | 3300013100 | Bacteria | 11139 |
| 268 | Ga0157373_10004107 | 3300013100 | Bacteria | 10974 |
| 269 | Ga0157371_10043860 | 3300013102 | Bacteria | 3185 |
| 270 | Ga0157370_10000023 | 3300013104 | Bacteria | 161359 |
| 271 | Ga0157370_10015084 | 3300013104 | Bacteria | 7874 |
| 272 | Ga0157369_10000010 | 3300013105 | Bacteria | 273443 |
| 273 | Ga0157369_10035913 | 3300013105 | Bacteria | 5432 |
| 274 | Ga0157369_10042861 | 3300013105 | Unclassified | 4936 |
| 275 | Ga0157369_10062729 | 3300013105 | Bacteria | 4004 |
| 276 | Ga0157369_10213051 | 3300013105 | Bacteria | 2024 |
| 277 | Ga0157369_10446150 | 3300013105 | Bacteria | 1340 |
| 278 | Ga0157374_10001688 | 3300013296 | Bacteria | 18485 |
| 279 | Ga0157374_10046796 | 3300013296 | Bacteria | 4008 |
| 280 | Ga0157374_10047646 | 3300013296 | Bacteria | 3974 |
| 281 | Ga0157374_10239095 | 3300013296 | Unclassified | 1786 |
| 282 | Ga0157374_10316594 | 3300013296 | Bacteria | 1546 |
| 283 | Ga0157378_10000044 | 3300013297 | Bacteria | 106822 |
| 284 | Ga0157378_10002388 | 3300013297 | Bacteria | 16681 |
| 285 | Ga0157378_10006829 | 3300013297 | Bacteria | 9955 |
| 286 | Ga0157378_10016679 | 3300013297 | Bacteria | 6436 |
| 287 | Ga0157378_10095021 | 3300013297 | Unclassified | 2714 |
| 288 | Ga0157378_10193705 | 3300013297 | Bacteria | 1919 |
| 289 | Ga0157378_10304705 | 3300013297 | Bacteria | 1543 |
| 290 | Ga0163162_10001495 | 3300013306 | Bacteria | 21784 |
| 291 | Ga0163162_10007750 | 3300013306 | Bacteria | 10461 |
| 292 | Ga0163162_10010928 | 3300013306 | Bacteria | 8838 |
| 293 | Ga0163162_10017286 | 3300013306 | Bacteria | 7057 |
| 294 | Ga0163162_10176040 | 3300013306 | Bacteria | 2265 |
| 295 | Ga0163162_10440447 | 3300013306 | Unclassified | 1435 |
| 296 | Ga0163162_10555036 | 3300013306 | Bacteria | 1277 |
| 297 | Ga0157372_10000055 | 3300013307 | Bacteria | 126308 |
| 298 | Ga0157372_10007697 | 3300013307 | Bacteria | 11460 |
| 299 | Ga0157372_10008911 | 3300013307 | Bacteria | 10660 |
| 300 | Ga0157372_10068306 | 3300013307 | Bacteria | 3995 |
| 301 | Ga0157372_10104887 | 3300013307 | Bacteria | 3232 |
| 302 | Ga0157372_10211618 | 3300013307 | Bacteria | 2247 |
| 303 | Ga0157372_10223635 | 3300013307 | Bacteria | 2182 |
| 304 | Ga0157372_10250472 | 3300013307 | Unclassified | 2056 |
| 305 | Ga0157372_10372883 | 3300013307 | Bacteria | 1663 |
| 306 | Ga0157375_10000005 | 3300013308 | Bacteria | 429412 |
| 307 | Ga0157375_10000092 | 3300013308 | Bacteria | 90157 |
| 308 | Ga0157375_10122045 | 3300013308 | Bacteria | 2716 |
| 309 | Ga0157375_10247725 | 3300013308 | Bacteria | 1942 |
| 310 | Ga0157375_10517914 | 3300013308 | Bacteria | 1356 |
| 311 | Ga0163163_10001291 | 3300014325 | Bacteria | 21165 |
| 312 | Ga0163163_10004292 | 3300014325 | Bacteria | 12142 |
| 313 | Ga0163163_10004406 | 3300014325 | Bacteria | 11999 |
| 314 | Ga0163163_10011078 | 3300014325 | Bacteria | 8159 |
| 315 | Ga0163163_10055189 | 3300014325 | Unclassified | 3927 |
| 316 | Ga0163163_10086516 | 3300014325 | Unclassified | 3144 |
| 317 | Ga0157380_10362470 | 3300014326 | Unclassified | 1360 |
| 318 | Ga0157377_10000105 | 3300014745 | Bacteria | 57869 |
| 319 | Ga0157377_10000304 | 3300014745 | Bacteria | 22848 |
| 320 | Ga0157379_10001222 | 3300014968 | Bacteria | 20890 |
| 321 | Ga0157379_10008140 | 3300014968 | Bacteria | 9106 |
| 322 | Ga0157376_10000008 | 3300014969 | Bacteria | 351192 |
| 323 | Ga0157376_10002199 | 3300014969 | Bacteria | 13151 |
| 324 | Ga0157376_10018878 | 3300014969 | Bacteria | 5301 |
| 325 | Ga0157376_10022142 | 3300014969 | Bacteria | 4948 |
| 326 | Ga0157376_10068900 | 3300014969 | Unclassified | 2997 |
| 327 | Ga0157376_10079463 | 3300014969 | Bacteria | 2812 |
| 328 | Ga0157376_10118333 | 3300014969 | Bacteria | 2344 |
| 329 | Ga0157376_10170736 | 3300014969 | Bacteria | 1980 |
| 330 | Ga0157376_10570691 | 3300014969 | Bacteria | 1122 |
| 331 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 332 | Ga0213876_10000002 | 3300021384 | Bacteria | 1168769 |
| 333 | Ga0213876_10042452 | 3300021384 | Bacteria | 2403 |
| 334 | Ga0228598_1024820 | 3300024227 | Bacteria | 1179 |
| 335 | Ga0207697_10028981 | 3300025315 | Bacteria | 2265 |
| 336 | Ga0207656_10009454 | 3300025321 | Bacteria | 3622 |
| 337 | Ga0207656_10045886 | 3300025321 | Unclassified | 1872 |
| 338 | Ga0207655_1040181 | 3300025728 | Bacteria | 2022 |
| 339 | Ga0207653_10056710 | 3300025885 | Bacteria | 1314 |
| 340 | Ga0207682_10007200 | 3300025893 | Bacteria | 4450 |
| 341 | Ga0207710_10001423 | 3300025900 | Bacteria | 11961 |
| 342 | Ga0207688_10011349 | 3300025901 | Bacteria | 4852 |
| 343 | Ga0207688_10093320 | 3300025901 | Unclassified | 1731 |
| 344 | Ga0207680_10002500 | 3300025903 | Bacteria | 8573 |
| 345 | Ga0207680_10004549 | 3300025903 | Bacteria | 6585 |
| 346 | Ga0207680_10042030 | 3300025903 | Bacteria | 2671 |
| 347 | Ga0207647_10007389 | 3300025904 | Bacteria | 7943 |
| 348 | Ga0207647_10015179 | 3300025904 | Bacteria | 5290 |
| 349 | Ga0207685_10022938 | 3300025905 | Bacteria | 2117 |
| 350 | Ga0207699_10069725 | 3300025906 | Bacteria | 2145 |
| 351 | Ga0207645_10003138 | 3300025907 | Bacteria | 12670 |
| 352 | Ga0207645_10003581 | 3300025907 | Bacteria | 11749 |
| 353 | Ga0207645_10040661 | 3300025907 | Bacteria | 2977 |
| 354 | Ga0207643_10000247 | 3300025908 | Bacteria | 37737 |
| 355 | Ga0207684_10015257 | 3300025910 | Bacteria | 6618 |
| 356 | Ga0207684_10015510 | 3300025910 | Bacteria | 6554 |
| 357 | Ga0207684_10040516 | 3300025910 | Bacteria | 3948 |
| 358 | Ga0207654_10013984 | 3300025911 | Bacteria | 4138 |
| 359 | Ga0207654_10030271 | 3300025911 | Unclassified | 2970 |
| 360 | Ga0207654_10118775 | 3300025911 | Bacteria | 1657 |
| 361 | Ga0207707_10035921 | 3300025912 | Bacteria | 4333 |
| 362 | Ga0207707_10258700 | 3300025912 | Bacteria | 1511 |
| 363 | Ga0207707_10350079 | 3300025912 | Bacteria | 1273 |
| 364 | Ga0207695_10000050 | 3300025913 | Bacteria | 405727 |
| 365 | Ga0207695_10000075 | 3300025913 | Bacteria | 308496 |
| 366 | Ga0207695_10002642 | 3300025913 | Bacteria | 26207 |
| 367 | Ga0207695_10006933 | 3300025913 | Bacteria | 14557 |
| 368 | Ga0207695_10028415 | 3300025913 | Bacteria | 6202 |
| 369 | Ga0207695_10049587 | 3300025913 | Bacteria | 4424 |
| 370 | Ga0207695_10072236 | 3300025913 | Bacteria | 3522 |
| 371 | Ga0207695_10373390 | 3300025913 | Unclassified | 1312 |
| 372 | Ga0207671_10001031 | 3300025914 | Bacteria | 33913 |
| 373 | Ga0207671_10010247 | 3300025914 | Bacteria | 7755 |
| 374 | Ga0207671_10060918 | 3300025914 | Unclassified | 2800 |
| 375 | Ga0207671_10061951 | 3300025914 | Bacteria | 2777 |
| 376 | Ga0207671_10142339 | 3300025914 | Bacteria | 1848 |
| 377 | Ga0207693_10044049 | 3300025915 | Bacteria | 3507 |
| 378 | Ga0207693_10046145 | 3300025915 | Bacteria | 3423 |
| 379 | Ga0207693_10052328 | 3300025915 | Bacteria | 3203 |
| 380 | Ga0207693_10060064 | 3300025915 | Bacteria | 2978 |
| 381 | Ga0207663_10010895 | 3300025916 | Bacteria | 4857 |
| 382 | Ga0207663_10014302 | 3300025916 | Bacteria | 4339 |
| 383 | Ga0207663_10039572 | 3300025916 | Bacteria | 2858 |
| 384 | Ga0207663_10062463 | 3300025916 | Bacteria | 2368 |
| 385 | Ga0207657_10001280 | 3300025919 | Bacteria | 26783 |
| 386 | Ga0207657_10008909 | 3300025919 | Bacteria | 10144 |
| 387 | Ga0207649_10000566 | 3300025920 | Bacteria | 25447 |
| 388 | Ga0207652_10029113 | 3300025921 | Bacteria | 4615 |
| 389 | Ga0207652_10105765 | 3300025921 | Bacteria | 2490 |
| 390 | Ga0207652_10165814 | 3300025921 | Bacteria | 1981 |
| 391 | Ga0207646_10002647 | 3300025922 | Bacteria | 21021 |
| 392 | Ga0207646_10002966 | 3300025922 | Bacteria | 19640 |
| 393 | Ga0207646_10010731 | 3300025922 | Bacteria | 8911 |
| 394 | Ga0207646_10014722 | 3300025922 | Bacteria | 7410 |
| 395 | Ga0207646_10072525 | 3300025922 | Bacteria | 3076 |
| 396 | Ga0207646_10161234 | 3300025922 | Unclassified | 2024 |
| 397 | Ga0207681_10045028 | 3300025923 | Bacteria | 2960 |
| 398 | Ga0207694_10000024 | 3300025924 | Bacteria | 259443 |
| 399 | Ga0207650_10000051 | 3300025925 | Bacteria | 168652 |
| 400 | Ga0207650_10031548 | 3300025925 | Bacteria | 3828 |
| 401 | Ga0207659_10000001 | 3300025926 | Bacteria | 660958 |
| 402 | Ga0207659_10008490 | 3300025926 | Bacteria | 6381 |
| 403 | Ga0207687_10000623 | 3300025927 | Bacteria | 23906 |
| 404 | Ga0207687_10001469 | 3300025927 | Bacteria | 16181 |
| 405 | Ga0207687_10001653 | 3300025927 | Bacteria | 15376 |
| 406 | Ga0207687_10002345 | 3300025927 | Bacteria | 12888 |
| 407 | Ga0207687_10018255 | 3300025927 | Bacteria | 4628 |
| 408 | Ga0207700_10009425 | 3300025928 | Bacteria | 6097 |
| 409 | Ga0207700_10025361 | 3300025928 | Bacteria | 4115 |
| 410 | Ga0207664_10146730 | 3300025929 | Bacteria | 2001 |
| 411 | Ga0207664_10276449 | 3300025929 | Bacteria | 1473 |
| 412 | Ga0207664_10292927 | 3300025929 | Bacteria | 1430 |
| 413 | Ga0207644_10001997 | 3300025931 | Bacteria | 13209 |
| 414 | Ga0207644_10002704 | 3300025931 | Bacteria | 11422 |
| 415 | Ga0207644_10388516 | 3300025931 | Unclassified | 1139 |
| 416 | Ga0207690_10028250 | 3300025932 | Bacteria | 3554 |
| 417 | Ga0207706_10000339 | 3300025933 | Bacteria | 50795 |
| 418 | Ga0207706_10004876 | 3300025933 | Bacteria | 12553 |
| 419 | Ga0207706_10009068 | 3300025933 | Bacteria | 9151 |
| 420 | Ga0207686_10013161 | 3300025934 | Bacteria | 4571 |
| 421 | Ga0207686_10031876 | 3300025934 | Bacteria | 3133 |
| 422 | Ga0207670_10000778 | 3300025936 | Bacteria | 16755 |
| 423 | Ga0207670_10287211 | 3300025936 | Bacteria | 1284 |
| 424 | Ga0207669_10063345 | 3300025937 | Bacteria | 2282 |
| 425 | Ga0207704_10029097 | 3300025938 | Bacteria | 3075 |
| 426 | Ga0207704_10037110 | 3300025938 | Unclassified | 2812 |
| 427 | Ga0207704_10148443 | 3300025938 | Bacteria | 1651 |
| 428 | Ga0207665_10010339 | 3300025939 | Bacteria | 6127 |
| 429 | Ga0207665_10014588 | 3300025939 | Bacteria | 5173 |
| 430 | Ga0207665_10048966 | 3300025939 | Unclassified | 2838 |
| 431 | Ga0207665_10218907 | 3300025939 | Bacteria | 1394 |
| 432 | Ga0207691_10001710 | 3300025940 | Bacteria | 21634 |
| 433 | Ga0207691_10001789 | 3300025940 | Bacteria | 21139 |
| 434 | Ga0207691_10037155 | 3300025940 | Unclassified | 4511 |
| 435 | Ga0207711_10013284 | 3300025941 | Bacteria | 6842 |
| 436 | Ga0207711_10016683 | 3300025941 | Bacteria | 6098 |
| 437 | Ga0207711_10041585 | 3300025941 | Bacteria | 3915 |
| 438 | Ga0207689_10000184 | 3300025942 | Bacteria | 54232 |
| 439 | Ga0207689_10051744 | 3300025942 | Unclassified | 3385 |
| 440 | Ga0207661_10000069 | 3300025944 | Bacteria | 70656 |
| 441 | Ga0207661_10051554 | 3300025944 | Bacteria | 3284 |
| 442 | Ga0207661_10481396 | 3300025944 | Bacteria | 1133 |
| 443 | Ga0207679_10000101 | 3300025945 | Bacteria | 71096 |
| 444 | Ga0207679_10009655 | 3300025945 | Bacteria | 6186 |
| 445 | Ga0207667_10001729 | 3300025949 | Bacteria | 27497 |
| 446 | Ga0207667_10005590 | 3300025949 | Bacteria | 15338 |
| 447 | Ga0207667_10035351 | 3300025949 | Bacteria | 5359 |
| 448 | Ga0207667_10051783 | 3300025949 | Bacteria | 4327 |
| 449 | Ga0207667_10058356 | 3300025949 | Bacteria | 4048 |
| 450 | Ga0207667_10203137 | 3300025949 | Unclassified | 2033 |
| 451 | Ga0207667_10233401 | 3300025949 | Bacteria | 1883 |
| 452 | Ga0207651_10067331 | 3300025960 | Unclassified | 2520 |
| 453 | Ga0207712_10017344 | 3300025961 | Bacteria | 4675 |
| 454 | Ga0207712_10131552 | 3300025961 | Bacteria | 1907 |
| 455 | Ga0207668_10030920 | 3300025972 | Bacteria | 3522 |
| 456 | Ga0207640_10102348 | 3300025981 | Bacteria | 2011 |
| 457 | Ga0207640_10305128 | 3300025981 | Bacteria | 1261 |
| 458 | Ga0207658_10001141 | 3300025986 | Bacteria | 21288 |
| 459 | Ga0207658_10003193 | 3300025986 | Bacteria | 11675 |
| 460 | Ga0207658_10019055 | 3300025986 | Bacteria | 4746 |
| 461 | Ga0207677_10000003 | 3300026023 | Bacteria | 450061 |
| 462 | Ga0207677_10000034 | 3300026023 | Bacteria | 117922 |
| 463 | Ga0207703_10000019 | 3300026035 | Bacteria | 254885 |
| 464 | Ga0207703_10000839 | 3300026035 | Bacteria | 30236 |
| 465 | Ga0207703_10041152 | 3300026035 | Bacteria | 3700 |
| 466 | Ga0207703_10290434 | 3300026035 | Bacteria | 1488 |
| 467 | Ga0207639_10000005 | 3300026041 | Bacteria | 579948 |
| 468 | Ga0207639_10025342 | 3300026041 | Bacteria | 4300 |
| 469 | Ga0207639_10114812 | 3300026041 | Bacteria | 2201 |
| 470 | Ga0207639_10264938 | 3300026041 | Bacteria | 1505 |
| 471 | Ga0207639_10268059 | 3300026041 | Bacteria | 1497 |
| 472 | Ga0207678_10000921 | 3300026067 | Bacteria | 26925 |
| 473 | Ga0207678_10002190 | 3300026067 | Bacteria | 17649 |
| 474 | Ga0207678_10002652 | 3300026067 | Bacteria | 16263 |
| 475 | Ga0207708_10000024 | 3300026075 | Bacteria | 172863 |
| 476 | Ga0207702_10004078 | 3300026078 | Bacteria | 13112 |
| 477 | Ga0207702_10008197 | 3300026078 | Bacteria | 8831 |
| 478 | Ga0207702_10141454 | 3300026078 | Bacteria | 2178 |
| 479 | Ga0207702_10208082 | 3300026078 | Unclassified | 1817 |
| 480 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 481 | Ga0207641_10002780 | 3300026088 | Bacteria | 15941 |
| 482 | Ga0207641_10006018 | 3300026088 | Bacteria | 10281 |
| 483 | Ga0207641_10047752 | 3300026088 | Bacteria | 3611 |
| 484 | Ga0207641_10099035 | 3300026088 | Bacteria | 2564 |
| 485 | Ga0207641_10102806 | 3300026088 | Bacteria | 2520 |
| 486 | Ga0207641_10392045 | 3300026088 | Unclassified | 1332 |
| 487 | Ga0207648_10000664 | 3300026089 | Bacteria | 38538 |
| 488 | Ga0207648_10003349 | 3300026089 | Bacteria | 16845 |
| 489 | Ga0207648_10009473 | 3300026089 | Bacteria | 9324 |
| 490 | Ga0207676_10000002 | 3300026095 | Bacteria | 1198607 |
| 491 | Ga0207676_10002185 | 3300026095 | Bacteria | 14106 |
| 492 | Ga0207676_10094434 | 3300026095 | Bacteria | 2464 |
| 493 | Ga0207676_10133693 | 3300026095 | Bacteria | 2113 |
| 494 | Ga0207674_10002167 | 3300026116 | Bacteria | 24843 |
| 495 | Ga0207674_10009736 | 3300026116 | Bacteria | 10951 |
| 496 | Ga0207674_10012889 | 3300026116 | Bacteria | 9329 |
| 497 | Ga0207674_10017826 | 3300026116 | Bacteria | 7739 |
| 498 | Ga0207674_10230528 | 3300026116 | Bacteria | 1799 |
| 499 | Ga0207675_100106512 | 3300026118 | Bacteria | 2643 |
| 500 | Ga0207683_10000460 | 3300026121 | Bacteria | 37808 |
| 501 | Ga0207683_10001670 | 3300026121 | Bacteria | 19882 |
| 502 | Ga0207683_10099462 | 3300026121 | Bacteria | 2596 |
| 503 | Ga0207698_10000008 | 3300026142 | Bacteria | 281991 |
| 504 | Ga0207698_10101694 | 3300026142 | Bacteria | 2384 |
| 505 | Ga0207698_10300883 | 3300026142 | Bacteria | 1493 |
| 506 | Ga0207698_10309124 | 3300026142 | Unclassified | 1475 |
| 507 | Ga0209588_1011308 | 3300027671 | Bacteria | 2695 |
| 508 | Ga0207428_10138319 | 3300027907 | Bacteria | 1861 |
| 509 | Ga0265354_1000021 | 3300028016 | Bacteria | 24904 |
| 510 | Ga0265354_1001873 | 3300028016 | Bacteria | 2813 |
| 511 | Ga0268266_10000153 | 3300028379 | Bacteria | 131887 |
| 512 | Ga0268266_10002191 | 3300028379 | Bacteria | 21364 |
| 513 | Ga0268266_10013979 | 3300028379 | Bacteria | 6911 |
| 514 | Ga0268266_10055676 | 3300028379 | Bacteria | 3400 |
| 515 | Ga0268266_10104266 | 3300028379 | Bacteria | 2504 |
| 516 | Ga0268265_10011994 | 3300028380 | Bacteria | 5865 |
| 517 | Ga0268265_10299912 | 3300028380 | Bacteria | 1446 |
| 518 | Ga0268264_10000669 | 3300028381 | Bacteria | 40172 |
| 519 | Ga0268264_10001226 | 3300028381 | Bacteria | 24663 |
| 520 | Ga0268264_10045316 | 3300028381 | Bacteria | 3651 |
| 521 | Ga0268264_10167702 | 3300028381 | Bacteria | 1983 |
| 522 | Ga0268264_10248502 | 3300028381 | Unclassified | 1651 |
| 523 | Ga0265338_10052974 | 3300028800 | Bacteria | 3635 |
| 524 | Ga0265338_10180950 | 3300028800 | Bacteria | 1607 |
| 525 | Ga0265770_1001287 | 3300030878 | Bacteria | 3462 |
| 526 | Ga0265770_1003233 | 3300030878 | Bacteria | 2216 |
| 527 | Ga0265765_1003655 | 3300030879 | Bacteria | 1550 |
| 528 | Ga0265339_10005498 | 3300031249 | Bacteria | 8440 |
| 529 | Ga0265331_10128639 | 3300031250 | Bacteria | 1156 |
| 530 | Ga0265316_10041336 | 3300031344 | Bacteria | 3690 |
| 531 | Ga0265313_10008888 | 3300031595 | Bacteria | 6607 |
| 532 | Ga0265314_10007163 | 3300031711 | Bacteria | 9707 |
| 533 | Ga0265342_10030322 | 3300031712 | Bacteria | 3352 |
| 534 | Ga0307416_100123614 | 3300032002 | Bacteria | 2313 |
| 535 | Ga0316212_1001185 | 3300033547 | Bacteria | 3487 |
| 536 | Ga0373926_0000636 | 3300035083 | Bacteria | 9569 |
| 537 | Ga0373934_0000710 | 3300035086 | Bacteria | 11888 |
| 538 | Ga0373953_0082393 | 3300035117 | Unclassified | 1339 |
| 539 | Ga0373954_0007118 | 3300035118 | Bacteria | 4883 |
| 540 | Ga0373956_0009696 | 3300035119 | Bacteria | 3921 |
| 541 | Ga0373956_0018682 | 3300035119 | Bacteria | 2937 |
| 542 | Ga0373946_0001883 | 3300035171 | Bacteria | 7325 |
| 543 | Ga0373955_0005463 | 3300035172 | Bacteria | 5713 |
| 544 | Ga0373955_0054539 | 3300035172 | Bacteria | 2186 |
| 545 | Ga0373955_0076666 | 3300035172 | Bacteria | 1881 |
| 546 | Ga0373961_0026879 | 3300035241 | Bacteria | 1576 |
| 547 | Ga0373924_0011060 | 3300035410 | Bacteria | 3344 |
| 548 | Ga0373931_0008198 | 3300035691 | Bacteria | 4949 |
| 549 | Ga0373931_0045338 | 3300035691 | Bacteria | 2322 |
| 550 | Ga0373935_0159403 | 3300035692 | Bacteria | 1537 |
| 551 | Ga0373927_0000782 | 3300035695 | Bacteria | 24268 |
| 552 | Ga0373933_0009110 | 3300035724 | Bacteria | 5418 |
| 553 | Ga0373933_0039687 | 3300035724 | Bacteria | 2771 |
| 554 | Ga0373947_0017268 | 3300035725 | Bacteria | 4150 |
| 555 | Ga0373947_0073749 | 3300035725 | Bacteria | 2098 |
| 556 | Ga0373937_0000349 | 3300036401 | Bacteria | 43599 |
| 557 | Ga0373937_0096703 | 3300036401 | Bacteria | 2739 |
| 558 | Ga0373937_0097787 | 3300036401 | Bacteria | 2723 |
| 559 | Ga0373925_0000717 | 3300037068 | Bacteria | 30876 |
| 560 | Ga0373925_0021689 | 3300037068 | Bacteria | 4681 |
| 561 | Ga0373925_0243120 | 3300037068 | Bacteria | 1442 |
| 562 | Ga0395905_0007860 | 3300037471 | Bacteria | 10563 |
| 563 | Ga0395905_0094350 | 3300037471 | Bacteria | 2807 |
| 564 | Ga0436365_0235218 | 3300039437 | Bacteria | 5170 |
| 565 | Ga0436365_0693404 | 3300039437 | Bacteria | 102624 |
| 566 | Ga0436365_1172964 | 3300039437 | Bacteria | 3139 |
| 567 | Ga0436363_0124748 | 3300039450 | Bacteria | 1401 |
| 568 | Ga0436363_1479800 | 3300039450 | Bacteria | 7165 |
| 569 | Ga0436362_0984254 | 3300039453 | Bacteria | 405590 |
| 570 | Ga0451577_0033406 | 3300042876 | Bacteria | 4638 |
| 571 | Ga0451577_0202079 | 3300042876 | Bacteria | 1794 |
| 572 | Ga0453683_0028024 | 3300044673 | Bacteria | 3568 |
| 573 | Ga0466963_0031125 | 3300044694 | Bacteria | 3447 |
| 574 | Ga0451576_0234056 | 3300045051 | Bacteria | 1918 |
| 575 | Ga0466967_0002708 | 3300045976 | Bacteria | 11201 |
| 576 | Ga0466967_0143575 | 3300045976 | Bacteria | 2225 |
| 577 | Ga0466967_0420615 | 3300045976 | Archaea | 1302 |
| 578 | Ga0495603_0001224 | 3300046455 | Bacteria | 14983 |
| 579 | Ga0495603_0015962 | 3300046455 | Bacteria | 4539 |
| 580 | Ga0495629_0013388 | 3300046459 | Bacteria | 5918 |
| 581 | Ga0495629_0030616 | 3300046459 | Bacteria | 3815 |
| 582 | Ga0495629_0036209 | 3300046459 | Bacteria | 3485 |
| 583 | Ga0495629_0140932 | 3300046459 | Bacteria | 1677 |
| 584 | Ga0495629_0184823 | 3300046459 | Bacteria | 1444 |
| 585 | Ga0495641_0013483 | 3300046461 | Bacteria | 4486 |
| 586 | Ga0495641_0018646 | 3300046461 | Bacteria | 3576 |
| 587 | Ga0495651_0023136 | 3300046462 | Bacteria | 4833 |
| 588 | Ga0495651_0323015 | 3300046462 | Bacteria | 1028 |
| 589 | Ga0495653_0156588 | 3300046463 | Bacteria | 1586 |
| 590 | Ga0495580_0001359 | 3300046472 | Bacteria | 21509 |
| 591 | Ga0495580_0021567 | 3300046472 | Bacteria | 4750 |
| 592 | Ga0495580_0039037 | 3300046472 | Bacteria | 3397 |
| 593 | Ga0495580_0142280 | 3300046472 | Bacteria | 1663 |
| 594 | Ga0495582_0000382 | 3300046473 | Bacteria | 24110 |
| 595 | Ga0495582_0042520 | 3300046473 | Bacteria | 2503 |
| 596 | Ga0495582_0061327 | 3300046473 | Bacteria | 2076 |
| 597 | Ga0495639_0001243 | 3300046475 | Bacteria | 11478 |
| 598 | Ga0495639_0097343 | 3300046475 | Bacteria | 1386 |
| 599 | Ga0495662_0031837 | 3300046476 | Bacteria | 2548 |
| 600 | Ga0495664_0006870 | 3300046477 | Bacteria | 6297 |
| 601 | Ga0495664_0095376 | 3300046477 | Bacteria | 1791 |
| 602 | Ga0495585_0056531 | 3300046492 | Bacteria | 2167 |
| 603 | Ga0495594_0001319 | 3300046499 | Bacteria | 12905 |
| 604 | Ga0495594_0001600 | 3300046499 | Bacteria | 11779 |
| 605 | Ga0495594_0003442 | 3300046499 | Bacteria | 8169 |
| 606 | Ga0495583_0040172 | 3300046506 | Bacteria | 2200 |
| 607 | Ga0495606_0031487 | 3300046507 | Bacteria | 3687 |
| 608 | Ga0495606_0144380 | 3300046507 | Bacteria | 1403 |
| 609 | Ga0495616_0037220 | 3300046513 | Bacteria | 2505 |
| 610 | Ga0495630_0012090 | 3300046517 | Bacteria | 6259 |
| 611 | Ga0495666_0021800 | 3300046526 | Bacteria | 3171 |
| 612 | Ga0495665_0004658 | 3300046531 | Bacteria | 7396 |
| 613 | Ga0495665_0029902 | 3300046531 | Bacteria | 2917 |
| 614 | Ga0495640_0005257 | 3300046533 | Bacteria | 10292 |
| 615 | Ga0495640_0017251 | 3300046533 | Bacteria | 5384 |
| 616 | Ga0495586_0003873 | 3300046535 | Bacteria | 8019 |
| 617 | Ga0495587_0041029 | 3300046536 | Bacteria | 2763 |
| 618 | Ga0495587_0118461 | 3300046536 | Bacteria | 1517 |
| 619 | Ga0495609_0033809 | 3300046538 | Bacteria | 2320 |
| 620 | Ga0495645_0016995 | 3300046543 | Bacteria | 5208 |
| 621 | Ga0495645_0040549 | 3300046543 | Bacteria | 3396 |
| 622 | Ga0495645_0128538 | 3300046543 | Bacteria | 1778 |
| 623 | Ga0495645_0150100 | 3300046543 | Bacteria | 1620 |
| 624 | Ga0495622_0012938 | 3300046557 | Bacteria | 3870 |
| 625 | Ga0495667_0026544 | 3300046559 | Bacteria | 3904 |
| 626 | Ga0495667_0038489 | 3300046559 | Bacteria | 3184 |
| 627 | Ga0495634_0032295 | 3300046642 | Bacteria | 3601 |
| 628 | Ga0495625_0039657 | 3300046660 | Bacteria | 3438 |
| 629 | Ga0495635_0117040 | 3300046663 | Bacteria | 1819 |
| 630 | Ga0495635_0210844 | 3300046663 | Bacteria | 1315 |
| 631 | Ga0495635_0249144 | 3300046663 | Bacteria | 1198 |
| 632 | Ga0495588_0081695 | 3300046674 | Bacteria | 1687 |
| 633 | Ga0495657_0108859 | 3300046675 | Bacteria | 1758 |
| 634 | Ga0495623_0052314 | 3300046679 | Bacteria | 2581 |
| 635 | Ga0495647_0003725 | 3300046681 | Bacteria | 4897 |
| 636 | Ga0495669_0001925 | 3300046684 | Bacteria | 8523 |
| 637 | Ga0495669_0002169 | 3300046684 | Bacteria | 8054 |
| 638 | Ga0495669_0012854 | 3300046684 | Unclassified | 3564 |
| 639 | Ga0495613_0004084 | 3300046689 | Bacteria | 10908 |
| 640 | Ga0495613_0027378 | 3300046689 | Bacteria | 4242 |
| 641 | Ga0495613_0062387 | 3300046689 | Bacteria | 2728 |
| 642 | Ga0495624_0051285 | 3300046690 | Bacteria | 2612 |
| 643 | Ga0495670_0041221 | 3300046691 | Bacteria | 2303 |
| 644 | Ga0495671_0102202 | 3300046692 | Bacteria | 1401 |
| 645 | Ga0495600_0006833 | 3300046809 | Bacteria | 6956 |
| 646 | Ga0495600_0019628 | 3300046809 | Bacteria | 4319 |
| 647 | Ga0495581_0013471 | 3300047315 | Bacteria | 4742 |
| 648 | Ga0495581_0038031 | 3300047315 | Bacteria | 2784 |
| 649 | Ga0495604_0001770 | 3300047317 | Bacteria | 17631 |
| 650 | Ga0495604_0029105 | 3300047317 | Bacteria | 4395 |
| 651 | Ga0495674_0009174 | 3300047319 | Bacteria | 9399 |
| 652 | Ga0495674_0035705 | 3300047319 | Bacteria | 4482 |
| 653 | Ga0495674_0036725 | 3300047319 | Bacteria | 4407 |
| 654 | Ga0495676_0001777 | 3300047321 | Bacteria | 18840 |
| 655 | Ga0495676_0007774 | 3300047321 | Bacteria | 9836 |
| 656 | Ga0495675_0021825 | 3300047444 | Bacteria | 4079 |
| 657 | Ga0495684_0011951 | 3300047471 | Bacteria | 6696 |
| 658 | Ga0495684_0060732 | 3300047471 | Bacteria | 2876 |
| 659 | Ga0495593_0040756 | 3300047673 | Bacteria | 2499 |
| 660 | Ga0495602_0013387 | 3300048088 | Bacteria | 8386 |
| 661 | Ga0495614_0007434 | 3300048089 | Bacteria | 4877 |
| 662 | Ga0495614_0021477 | 3300048089 | Bacteria | 2788 |
| 663 | Ga0496101_0081230 | 3300048904 | Bacteria | 2397 |
| 664 | Ga0496102_0003513 | 3300048905 | Bacteria | 13281 |
| 665 | Ga0496102_0004269 | 3300048905 | Bacteria | 12085 |
| 666 | Ga0496103_0015318 | 3300048906 | Bacteria | 4561 |
| 667 | Ga0496104_0210221 | 3300048907 | Bacteria | 1857 |
| 668 | Ga0496104_0217841 | 3300048907 | Bacteria | 1821 |
| 669 | Ga0496105_0048746 | 3300048908 | Bacteria | 3496 |
| 670 | Ga0496105_0059250 | 3300048908 | Bacteria | 3160 |
| 671 | Ga0496106_0070980 | 3300048909 | Bacteria | 2661 |
| 672 | Ga0496107_0010356 | 3300048910 | Bacteria | 6478 |
| 673 | Ga0496108_0000095 | 3300048911 | Bacteria | 92520 |
| 674 | Ga0496108_0113319 | 3300048911 | Bacteria | 2321 |
| 675 | Ga0496109_0000126 | 3300048912 | Bacteria | 77920 |
| 676 | Ga0496109_0000410 | 3300048912 | Bacteria | 38147 |
| 677 | Ga0496110_0002871 | 3300048913 | Bacteria | 13020 |
| 678 | Ga0496111_0007966 | 3300048914 | Bacteria | 6985 |
| 679 | Ga0496112_0000615 | 3300048915 | Bacteria | 24595 |
| 680 | Ga0496112_0005230 | 3300048915 | Bacteria | 11169 |
| 681 | Ga0496112_0017844 | 3300048915 | Bacteria | 6679 |
| 682 | Ga0496112_0309642 | 3300048915 | Bacteria | 1524 |
| 683 | Ga0496113_0003748 | 3300048916 | Bacteria | 9167 |
| 684 | Ga0496113_0357896 | 3300048916 | Unclassified | 1171 |
| 685 | Ga0496114_0022761 | 3300048917 | Bacteria | 5107 |
| 686 | Ga0496114_0030844 | 3300048917 | Bacteria | 4410 |
| 687 | Ga0496114_0238661 | 3300048917 | Bacteria | 1598 |
| 688 | Ga0496115_0006563 | 3300048918 | Bacteria | 8528 |
| 689 | Ga0496115_0009132 | 3300048918 | Bacteria | 7359 |
| 690 | Ga0496115_0045376 | 3300048918 | Unclassified | 3508 |
| 691 | Ga0501073_0012134 | 3300049589 | Bacteria | 6291 |
| 692 | Ga0501080_0001025 | 3300049742 | Bacteria | 22971 |
| 693 | Ga0501081_0147021 | 3300049743 | Bacteria | 1692 |
| 694 | nmdc:mga05p37_22163_c1 | 3300050507 | Bacteria | 7700 |
| 695 | nmdc:mga06r32_217866_c1 | 3300050510 | Bacteria | 1897 |
| 696 | nmdc:mga06r32_299693_c1 | 3300050510 | Bacteria | 1594 |
| 697 | nmdc:mga06r32_367438_c1 | 3300050510 | Bacteria | 1422 |
| 698 | nmdc:mga06r32_9974_c1 | 3300050510 | Bacteria | 8568 |
| 699 | nmdc:mga08y16_35772_c1 | 3300050511 | Bacteria | 5216 |
| 700 | nmdc:mga0n895_100917_c1 | 3300050512 | Bacteria | 2368 |
| 701 | nmdc:mga0n895_51073_c1 | 3300050512 | Bacteria | 4055 |
| 702 | nmdc:mga0n895_907_c1 | 3300050512 | Bacteria | 14186 |
| 703 | nmdc:mga0rr50_10588_c1 | 3300050513 | Bacteria | 5861 |
| 704 | nmdc:mga0rr50_275741_c1 | 3300050513 | Bacteria | 1402 |
| 705 | nmdc:mga0rr50_49268_c1 | 3300050513 | Bacteria | 3118 |
| 706 | nmdc:mga0rr50_64144_c1 | 3300050513 | Unclassified | 2777 |
| 707 | nmdc:mga08x19_146_c1 | 3300050514 | Bacteria | 60222 |
| 708 | nmdc:mga08x19_2567_c1 | 3300050514 | Bacteria | 11042 |
| 709 | nmdc:mga08x19_57650_c1 | 3300050514 | Bacteria | 2510 |
| 710 | nmdc:mga08x19_6583_c1 | 3300050514 | Bacteria | 6885 |
| 711 | nmdc:mga08x19_689_c1 | 3300050514 | Bacteria | 21661 |
| 712 | nmdc:mga0a205_141703_c1 | 3300050515 | Bacteria | 2304 |
| 713 | nmdc:mga0a205_37552_c1 | 3300050515 | Bacteria | 4658 |
| 714 | nmdc:mga0a205_46298_c1 | 3300050515 | Bacteria | 4194 |
| 715 | Ga0495619_0015727 | 3300053085 | Bacteria | 4791 |
| 716 | Ga0501084_0018572 | 3300054114 | Bacteria | 5788 |
| 717 | Ga0501084_0089633 | 3300054114 | Bacteria | 2582 |
| 718 | Ga0501082_0131148 | 3300060353 | Bacteria | 2175 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0108859 | Ga0495657_0108859_12_884 | 282 |
| 2 | 3300054114 | Ga0501084_0089633 | Ga0501084_0089633_1378_2340 | 283 |
| 3 | 3300025939 | Ga0207665_10048966 | Ga0207665_100489663 | 285 |
| 4 | 3300006852 | Ga0075433_10035022 | Ga0075433_100350223 | 288 |
| 5 | 3300006871 | Ga0075434_100003588 | Ga0075434_1000035885 | 288 |
| 6 | 3300007076 | Ga0075435_100093913 | Ga0075435_1000939132 | 288 |
| 7 | 3300050512 | nmdc:mga0n895_907_c1 | nmdc:mga0n895_907_c1_7727_8680 | 288 |
| 8 | 3300050513 | nmdc:mga0rr50_64144_c1 | nmdc:mga0rr50_64144_c1_1387_2340 | 288 |
| 9 | 3300050515 | nmdc:mga0a205_37552_c1 | nmdc:mga0a205_37552_c1_1570_2523 | 288 |
| 10 | 3300025915 | Ga0207693_10046145 | Ga0207693_100461452 | 289 |
| 11 | 3300005445 | Ga0070708_100017608 | Ga0070708_1000176085 | 290 |
| 12 | 3300025922 | Ga0207646_10072525 | Ga0207646_100725253 | 290 |
| 13 | 3300021358 | Ga0213873_10000001 | Ga0213873_10000001642 | 291 |
| 14 | 3300021384 | Ga0213876_10000002 | Ga0213876_10000002900 | 291 |
| 15 | 3300039437 | Ga0436365_0693404 | Ga0436365_0693404_64039_64986 | 291 |
| 16 | 3300039453 | Ga0436362_0984254 | Ga0436362_0984254_310786_311733 | 291 |
| 17 | 3300005468 | Ga0070707_100001974 | Ga0070707_10000197417 | 292 |
| 18 | 3300025922 | Ga0207646_10002966 | Ga0207646_100029663 | 292 |
| 19 | 3300005445 | Ga0070708_100006686 | Ga0070708_1000066866 | 301 |
| 20 | 3300005545 | Ga0070695_100002293 | Ga0070695_1000022934 | 301 |
| 21 | 3300005546 | Ga0070696_100004097 | Ga0070696_1000040972 | 301 |
| 22 | 3300005549 | Ga0070704_100002014 | Ga0070704_1000020147 | 301 |
| 23 | 3300046462 | Ga0495651_0323015 | Ga0495651_0323015_87_1016 | 301 |
| 24 | 3300014325 | Ga0163163_10001291 | Ga0163163_100012912 | 302 |
| 25 | 3300026023 | Ga0207677_10000003 | Ga0207677_1000000371 | 304 |
| 26 | 3300003322 | rootL2_10024844 | rootL2_100248444 | 305 |
| 27 | 3300005329 | Ga0070683_100000097 | Ga0070683_10000009718 | 305 |
| 28 | 3300005329 | Ga0070683_100044469 | Ga0070683_1000444692 | 305 |
| 29 | 3300005329 | Ga0070683_100207182 | Ga0070683_1002071822 | 305 |
| 30 | 3300005329 | Ga0070683_100222443 | Ga0070683_1002224432 | 305 |
| 31 | 3300005331 | Ga0070670_100010640 | Ga0070670_1000106404 | 305 |
| 32 | 3300005331 | Ga0070670_100013420 | Ga0070670_1000134203 | 305 |
| 33 | 3300005334 | Ga0068869_100001114 | Ga0068869_1000011142 | 305 |
| 34 | 3300005334 | Ga0068869_100004783 | Ga0068869_1000047834 | 305 |
| 35 | 3300005338 | Ga0068868_100000479 | Ga0068868_10000047912 | 305 |
| 36 | 3300005338 | Ga0068868_100003002 | Ga0068868_1000030023 | 305 |
| 37 | 3300005344 | Ga0070661_100045692 | Ga0070661_1000456922 | 305 |
| 38 | 3300005344 | Ga0070661_100216062 | Ga0070661_1002160622 | 305 |
| 39 | 3300005344 | Ga0070661_100356730 | Ga0070661_1003567301 | 305 |
| 40 | 3300005354 | Ga0070675_100051327 | Ga0070675_1000513272 | 305 |
| 41 | 3300005355 | Ga0070671_100007588 | Ga0070671_1000075882 | 305 |
| 42 | 3300005355 | Ga0070671_100017627 | Ga0070671_1000176272 | 305 |
| 43 | 3300005355 | Ga0070671_100029409 | Ga0070671_1000294092 | 305 |
| 44 | 3300005367 | Ga0070667_100000808 | Ga0070667_10000080812 | 305 |
| 45 | 3300005367 | Ga0070667_100045107 | Ga0070667_1000451072 | 305 |
| 46 | 3300005439 | Ga0070711_100123852 | Ga0070711_1001238522 | 305 |
| 47 | 3300005455 | Ga0070663_100003832 | Ga0070663_1000038322 | 305 |
| 48 | 3300005456 | Ga0070678_100005711 | Ga0070678_1000057116 | 305 |
| 49 | 3300005457 | Ga0070662_100002775 | Ga0070662_1000027757 | 305 |
| 50 | 3300005458 | Ga0070681_10418887 | Ga0070681_104188872 | 305 |
| 51 | 3300005535 | Ga0070684_100000031 | Ga0070684_10000003153 | 305 |
| 52 | 3300005535 | Ga0070684_100097193 | Ga0070684_1000971933 | 305 |
| 53 | 3300005543 | Ga0070672_100004476 | Ga0070672_1000044767 | 305 |
| 54 | 3300005548 | Ga0070665_100009991 | Ga0070665_1000099919 | 305 |
| 55 | 3300005548 | Ga0070665_100013260 | Ga0070665_1000132604 | 305 |
| 56 | 3300005563 | Ga0068855_100009684 | Ga0068855_1000096848 | 305 |
| 57 | 3300005563 | Ga0068855_100017878 | Ga0068855_1000178786 | 305 |
| 58 | 3300005564 | Ga0070664_100077832 | Ga0070664_1000778323 | 305 |
| 59 | 3300005577 | Ga0068857_100000602 | Ga0068857_10000060213 | 305 |
| 60 | 3300005578 | Ga0068854_100007505 | Ga0068854_1000075056 | 305 |
| 61 | 3300005614 | Ga0068856_100016636 | Ga0068856_1000166366 | 305 |
| 62 | 3300005614 | Ga0068856_100295138 | Ga0068856_1002951382 | 305 |
| 63 | 3300005616 | Ga0068852_100000032 | Ga0068852_1000000328 | 305 |
| 64 | 3300005616 | Ga0068852_100104777 | Ga0068852_1001047772 | 305 |
| 65 | 3300005616 | Ga0068852_100218104 | Ga0068852_1002181042 | 305 |
| 66 | 3300005616 | Ga0068852_100313696 | Ga0068852_1003136962 | 305 |
| 67 | 3300005617 | Ga0068859_100024506 | Ga0068859_1000245067 | 305 |
| 68 | 3300005618 | Ga0068864_100033344 | Ga0068864_1000333443 | 305 |
| 69 | 3300005618 | Ga0068864_100156212 | Ga0068864_1001562122 | 305 |
| 70 | 3300005834 | Ga0068851_10009873 | Ga0068851_100098733 | 305 |
| 71 | 3300005841 | Ga0068863_100003024 | Ga0068863_1000030242 | 305 |
| 72 | 3300005841 | Ga0068863_100123713 | Ga0068863_1001237132 | 305 |
| 73 | 3300005841 | Ga0068863_100127894 | Ga0068863_1001278942 | 305 |
| 74 | 3300005842 | Ga0068858_100005975 | Ga0068858_1000059752 | 305 |
| 75 | 3300005843 | Ga0068860_100000031 | Ga0068860_10000003118 | 305 |
| 76 | 3300005843 | Ga0068860_100047573 | Ga0068860_1000475734 | 305 |
| 77 | 3300006028 | Ga0070717_10005591 | Ga0070717_100055915 | 305 |
| 78 | 3300006237 | Ga0097621_100012626 | Ga0097621_1000126265 | 305 |
| 79 | 3300006237 | Ga0097621_100109589 | Ga0097621_1001095892 | 305 |
| 80 | 3300006358 | Ga0068871_100001244 | Ga0068871_10000124418 | 305 |
| 81 | 3300006358 | Ga0068871_100011283 | Ga0068871_1000112832 | 305 |
| 82 | 3300006358 | Ga0068871_100190361 | Ga0068871_1001903612 | 305 |
| 83 | 3300006931 | Ga0097620_100024506 | Ga0097620_1000245067 | 305 |
| 84 | 3300009093 | Ga0105240_10000135 | Ga0105240_1000013549 | 305 |
| 85 | 3300009093 | Ga0105240_10000451 | Ga0105240_1000045118 | 305 |
| 86 | 3300009093 | Ga0105240_10004680 | Ga0105240_1000468016 | 305 |
| 87 | 3300009093 | Ga0105240_10048663 | Ga0105240_100486633 | 305 |
| 88 | 3300009093 | Ga0105240_10372207 | Ga0105240_103722072 | 305 |
| 89 | 3300009093 | Ga0105240_10388657 | Ga0105240_103886572 | 305 |
| 90 | 3300009093 | Ga0105240_10439322 | Ga0105240_104393222 | 305 |
| 91 | 3300009093 | Ga0105240_10521159 | Ga0105240_105211592 | 305 |
| 92 | 3300009098 | Ga0105245_10002852 | Ga0105245_100028522 | 305 |
| 93 | 3300009174 | Ga0105241_10050809 | Ga0105241_100508094 | 305 |
| 94 | 3300009177 | Ga0105248_10009291 | Ga0105248_100092912 | 305 |
| 95 | 3300009177 | Ga0105248_10026710 | Ga0105248_100267103 | 305 |
| 96 | 3300009545 | Ga0105237_10297153 | Ga0105237_102971532 | 305 |
| 97 | 3300009551 | Ga0105238_10001963 | Ga0105238_1000196318 | 305 |
| 98 | 3300009551 | Ga0105238_10666499 | Ga0105238_106664991 | 305 |
| 99 | 3300009553 | Ga0105249_10119018 | Ga0105249_101190182 | 305 |
| 100 | 3300009553 | Ga0105249_10525790 | Ga0105249_105257902 | 305 |
| 101 | 3300010375 | Ga0105239_10111537 | Ga0105239_101115373 | 305 |
| 102 | 3300010375 | Ga0105239_10366714 | Ga0105239_103667142 | 305 |
| 103 | 3300013104 | Ga0157370_10000023 | Ga0157370_1000002382 | 305 |
| 104 | 3300013104 | Ga0157370_10015084 | Ga0157370_100150844 | 305 |
| 105 | 3300013105 | Ga0157369_10000010 | Ga0157369_10000010159 | 305 |
| 106 | 3300013105 | Ga0157369_10035913 | Ga0157369_100359134 | 305 |
| 107 | 3300013105 | Ga0157369_10042861 | Ga0157369_100428615 | 305 |
| 108 | 3300013105 | Ga0157369_10062729 | Ga0157369_100627294 | 305 |
| 109 | 3300013105 | Ga0157369_10446150 | Ga0157369_104461502 | 305 |
| 110 | 3300013296 | Ga0157374_10001688 | Ga0157374_100016889 | 305 |
| 111 | 3300013296 | Ga0157374_10046796 | Ga0157374_100467963 | 305 |
| 112 | 3300013296 | Ga0157374_10047646 | Ga0157374_100476463 | 305 |
| 113 | 3300013296 | Ga0157374_10316594 | Ga0157374_103165942 | 305 |
| 114 | 3300013297 | Ga0157378_10006829 | Ga0157378_100068294 | 305 |
| 115 | 3300013297 | Ga0157378_10095021 | Ga0157378_100950212 | 305 |
| 116 | 3300013297 | Ga0157378_10304705 | Ga0157378_103047052 | 305 |
| 117 | 3300013306 | Ga0163162_10001495 | Ga0163162_100014953 | 305 |
| 118 | 3300013306 | Ga0163162_10017286 | Ga0163162_100172864 | 305 |
| 119 | 3300013306 | Ga0163162_10440447 | Ga0163162_104404472 | 305 |
| 120 | 3300013307 | Ga0157372_10000055 | Ga0157372_1000005552 | 305 |
| 121 | 3300013307 | Ga0157372_10007697 | Ga0157372_100076975 | 305 |
| 122 | 3300013307 | Ga0157372_10068306 | Ga0157372_100683062 | 305 |
| 123 | 3300013307 | Ga0157372_10104887 | Ga0157372_101048872 | 305 |
| 124 | 3300013307 | Ga0157372_10211618 | Ga0157372_102116182 | 305 |
| 125 | 3300013307 | Ga0157372_10223635 | Ga0157372_102236352 | 305 |
| 126 | 3300013308 | Ga0157375_10122045 | Ga0157375_101220452 | 305 |
| 127 | 3300013308 | Ga0157375_10247725 | Ga0157375_102477252 | 305 |
| 128 | 3300013308 | Ga0157375_10517914 | Ga0157375_105179142 | 305 |
| 129 | 3300014325 | Ga0163163_10004292 | Ga0163163_1000429211 | 305 |
| 130 | 3300014325 | Ga0163163_10011078 | Ga0163163_100110787 | 305 |
| 131 | 3300014325 | Ga0163163_10055189 | Ga0163163_100551894 | 305 |
| 132 | 3300014745 | Ga0157377_10000105 | Ga0157377_100001056 | 305 |
| 133 | 3300014968 | Ga0157379_10001222 | Ga0157379_1000122217 | 305 |
| 134 | 3300014969 | Ga0157376_10022142 | Ga0157376_100221424 | 305 |
| 135 | 3300014969 | Ga0157376_10068900 | Ga0157376_100689003 | 305 |
| 136 | 3300014969 | Ga0157376_10079463 | Ga0157376_100794632 | 305 |
| 137 | 3300014969 | Ga0157376_10118333 | Ga0157376_101183332 | 305 |
| 138 | 3300014969 | Ga0157376_10170736 | Ga0157376_101707361 | 305 |
| 139 | 3300024227 | Ga0228598_1024820 | Ga0228598_10248202 | 305 |
| 140 | 3300025315 | Ga0207697_10028981 | Ga0207697_100289812 | 305 |
| 141 | 3300025321 | Ga0207656_10009454 | Ga0207656_100094543 | 305 |
| 142 | 3300025321 | Ga0207656_10045886 | Ga0207656_100458862 | 305 |
| 143 | 3300025900 | Ga0207710_10001423 | Ga0207710_100014236 | 305 |
| 144 | 3300025901 | Ga0207688_10093320 | Ga0207688_100933202 | 305 |
| 145 | 3300025903 | Ga0207680_10042030 | Ga0207680_100420302 | 305 |
| 146 | 3300025904 | Ga0207647_10015179 | Ga0207647_100151794 | 305 |
| 147 | 3300025907 | Ga0207645_10040661 | Ga0207645_100406613 | 305 |
| 148 | 3300025912 | Ga0207707_10258700 | Ga0207707_102587002 | 305 |
| 149 | 3300025912 | Ga0207707_10350079 | Ga0207707_103500791 | 305 |
| 150 | 3300025913 | Ga0207695_10000050 | Ga0207695_1000005053 | 305 |
| 151 | 3300025913 | Ga0207695_10000075 | Ga0207695_10000075241 | 305 |
| 152 | 3300025913 | Ga0207695_10006933 | Ga0207695_100069333 | 305 |
| 153 | 3300025913 | Ga0207695_10049587 | Ga0207695_100495872 | 305 |
| 154 | 3300025913 | Ga0207695_10072236 | Ga0207695_100722362 | 305 |
| 155 | 3300025913 | Ga0207695_10373390 | Ga0207695_103733902 | 305 |
| 156 | 3300025914 | Ga0207671_10001031 | Ga0207671_100010313 | 305 |
| 157 | 3300025914 | Ga0207671_10061951 | Ga0207671_100619512 | 305 |
| 158 | 3300025924 | Ga0207694_10000024 | Ga0207694_100000245 | 305 |
| 159 | 3300025925 | Ga0207650_10031548 | Ga0207650_100315483 | 305 |
| 160 | 3300025926 | Ga0207659_10008490 | Ga0207659_100084903 | 305 |
| 161 | 3300025927 | Ga0207687_10002345 | Ga0207687_100023453 | 305 |
| 162 | 3300025928 | Ga0207700_10009425 | Ga0207700_100094252 | 305 |
| 163 | 3300025929 | Ga0207664_10276449 | Ga0207664_102764492 | 305 |
| 164 | 3300025931 | Ga0207644_10001997 | Ga0207644_1000199710 | 305 |
| 165 | 3300025931 | Ga0207644_10388516 | Ga0207644_103885161 | 305 |
| 166 | 3300025933 | Ga0207706_10009068 | Ga0207706_100090684 | 305 |
| 167 | 3300025938 | Ga0207704_10037110 | Ga0207704_100371102 | 305 |
| 168 | 3300025939 | Ga0207665_10218907 | Ga0207665_102189072 | 305 |
| 169 | 3300025940 | Ga0207691_10037155 | Ga0207691_100371554 | 305 |
| 170 | 3300025941 | Ga0207711_10016683 | Ga0207711_100166836 | 305 |
| 171 | 3300025941 | Ga0207711_10041585 | Ga0207711_100415853 | 305 |
| 172 | 3300025942 | Ga0207689_10051744 | Ga0207689_100517442 | 305 |
| 173 | 3300025944 | Ga0207661_10000069 | Ga0207661_1000006924 | 305 |
| 174 | 3300025944 | Ga0207661_10051554 | Ga0207661_100515542 | 305 |
| 175 | 3300025944 | Ga0207661_10481396 | Ga0207661_104813962 | 305 |
| 176 | 3300025945 | Ga0207679_10009655 | Ga0207679_100096555 | 305 |
| 177 | 3300025949 | Ga0207667_10001729 | Ga0207667_1000172918 | 305 |
| 178 | 3300025949 | Ga0207667_10035351 | Ga0207667_100353515 | 305 |
| 179 | 3300025949 | Ga0207667_10051783 | Ga0207667_100517832 | 305 |
| 180 | 3300025949 | Ga0207667_10058356 | Ga0207667_100583563 | 305 |
| 181 | 3300025949 | Ga0207667_10203137 | Ga0207667_102031372 | 305 |
| 182 | 3300025949 | Ga0207667_10233401 | Ga0207667_102334012 | 305 |
| 183 | 3300025960 | Ga0207651_10067331 | Ga0207651_100673311 | 305 |
| 184 | 3300025981 | Ga0207640_10305128 | Ga0207640_103051282 | 305 |
| 185 | 3300025986 | Ga0207658_10001141 | Ga0207658_1000114118 | 305 |
| 186 | 3300026023 | Ga0207677_10000034 | Ga0207677_10000034111 | 305 |
| 187 | 3300026035 | Ga0207703_10000839 | Ga0207703_100008397 | 305 |
| 188 | 3300026041 | Ga0207639_10114812 | Ga0207639_101148122 | 305 |
| 189 | 3300026067 | Ga0207678_10002652 | Ga0207678_100026523 | 305 |
| 190 | 3300026078 | Ga0207702_10004078 | Ga0207702_100040783 | 305 |
| 191 | 3300026078 | Ga0207702_10141454 | Ga0207702_101414542 | 305 |
| 192 | 3300026088 | Ga0207641_10002780 | Ga0207641_100027807 | 305 |
| 193 | 3300026088 | Ga0207641_10099035 | Ga0207641_100990352 | 305 |
| 194 | 3300026089 | Ga0207648_10009473 | Ga0207648_100094732 | 305 |
| 195 | 3300026095 | Ga0207676_10094434 | Ga0207676_100944342 | 305 |
| 196 | 3300026095 | Ga0207676_10133693 | Ga0207676_101336932 | 305 |
| 197 | 3300026116 | Ga0207674_10002167 | Ga0207674_1000216721 | 305 |
| 198 | 3300026116 | Ga0207674_10012889 | Ga0207674_100128898 | 305 |
| 199 | 3300026121 | Ga0207683_10000460 | Ga0207683_1000046015 | 305 |
| 200 | 3300026142 | Ga0207698_10000008 | Ga0207698_10000008219 | 305 |
| 201 | 3300026142 | Ga0207698_10300883 | Ga0207698_103008832 | 305 |
| 202 | 3300026142 | Ga0207698_10309124 | Ga0207698_103091242 | 305 |
| 203 | 3300028379 | Ga0268266_10055676 | Ga0268266_100556762 | 305 |
| 204 | 3300028379 | Ga0268266_10104266 | Ga0268266_101042662 | 305 |
| 205 | 3300028381 | Ga0268264_10000669 | Ga0268264_1000066927 | 305 |
| 206 | 3300028381 | Ga0268264_10248502 | Ga0268264_102485022 | 305 |
| 207 | 3300028800 | Ga0265338_10052974 | Ga0265338_100529743 | 305 |
| 208 | 3300028800 | Ga0265338_10180950 | Ga0265338_101809502 | 305 |
| 209 | 3300031249 | Ga0265339_10005498 | Ga0265339_100054984 | 305 |
| 210 | 3300031344 | Ga0265316_10041336 | Ga0265316_100413362 | 305 |
| 211 | 3300031595 | Ga0265313_10008888 | Ga0265313_100088883 | 305 |
| 212 | 3300031711 | Ga0265314_10007163 | Ga0265314_100071636 | 305 |
| 213 | 3300031712 | Ga0265342_10030322 | Ga0265342_100303223 | 305 |
| 214 | 3300035117 | Ga0373953_0082393 | Ga0373953_0082393_302_1231 | 305 |
| 215 | 3300035724 | Ga0373933_0039687 | Ga0373933_0039687_694_1623 | 305 |
| 216 | 3300036401 | Ga0373937_0097787 | Ga0373937_0097787_1569_2498 | 305 |
| 217 | 3300046455 | Ga0495603_0015962 | Ga0495603_0015962_2711_3640 | 305 |
| 218 | 3300046459 | Ga0495629_0013388 | Ga0495629_0013388_3058_3987 | 305 |
| 219 | 3300046459 | Ga0495629_0030616 | Ga0495629_0030616_486_1415 | 305 |
| 220 | 3300046459 | Ga0495629_0036209 | Ga0495629_0036209_2135_3064 | 305 |
| 221 | 3300046459 | Ga0495629_0184823 | Ga0495629_0184823_168_1097 | 305 |
| 222 | 3300046473 | Ga0495582_0042520 | Ga0495582_0042520_760_1689 | 305 |
| 223 | 3300046477 | Ga0495664_0006870 | Ga0495664_0006870_2632_3561 | 305 |
| 224 | 3300046492 | Ga0495585_0056531 | Ga0495585_0056531_925_1854 | 305 |
| 225 | 3300046499 | Ga0495594_0001319 | Ga0495594_0001319_6839_7768 | 305 |
| 226 | 3300046499 | Ga0495594_0001600 | Ga0495594_0001600_1933_2862 | 305 |
| 227 | 3300046499 | Ga0495594_0003442 | Ga0495594_0003442_3451_4380 | 305 |
| 228 | 3300046506 | Ga0495583_0040172 | Ga0495583_0040172_198_1127 | 305 |
| 229 | 3300046507 | Ga0495606_0031487 | Ga0495606_0031487_93_1022 | 305 |
| 230 | 3300046507 | Ga0495606_0144380 | Ga0495606_0144380_407_1336 | 305 |
| 231 | 3300046513 | Ga0495616_0037220 | Ga0495616_0037220_852_1781 | 305 |
| 232 | 3300046531 | Ga0495665_0004658 | Ga0495665_0004658_3792_4721 | 305 |
| 233 | 3300046533 | Ga0495640_0005257 | Ga0495640_0005257_7064_7993 | 305 |
| 234 | 3300046536 | Ga0495587_0118461 | Ga0495587_0118461_294_1223 | 305 |
| 235 | 3300046538 | Ga0495609_0033809 | Ga0495609_0033809_852_1781 | 305 |
| 236 | 3300046543 | Ga0495645_0016995 | Ga0495645_0016995_3019_3948 | 305 |
| 237 | 3300046543 | Ga0495645_0128538 | Ga0495645_0128538_783_1712 | 305 |
| 238 | 3300046543 | Ga0495645_0150100 | Ga0495645_0150100_192_1121 | 305 |
| 239 | 3300046557 | Ga0495622_0012938 | Ga0495622_0012938_280_1209 | 305 |
| 240 | 3300046559 | Ga0495667_0026544 | Ga0495667_0026544_293_1222 | 305 |
| 241 | 3300046559 | Ga0495667_0038489 | Ga0495667_0038489_28_957 | 305 |
| 242 | 3300046642 | Ga0495634_0032295 | Ga0495634_0032295_798_1727 | 305 |
| 243 | 3300046660 | Ga0495625_0039657 | Ga0495625_0039657_736_1665 | 305 |
| 244 | 3300046663 | Ga0495635_0210844 | Ga0495635_0210844_74_1003 | 305 |
| 245 | 3300046663 | Ga0495635_0249144 | Ga0495635_0249144_51_980 | 305 |
| 246 | 3300046674 | Ga0495588_0081695 | Ga0495588_0081695_99_1028 | 305 |
| 247 | 3300046679 | Ga0495623_0052314 | Ga0495623_0052314_1033_1962 | 305 |
| 248 | 3300046684 | Ga0495669_0002169 | Ga0495669_0002169_480_1409 | 305 |
| 249 | 3300046689 | Ga0495613_0004084 | Ga0495613_0004084_5241_6170 | 305 |
| 250 | 3300046689 | Ga0495613_0027378 | Ga0495613_0027378_1916_2845 | 305 |
| 251 | 3300046689 | Ga0495613_0062387 | Ga0495613_0062387_79_1008 | 305 |
| 252 | 3300046690 | Ga0495624_0051285 | Ga0495624_0051285_1351_2280 | 305 |
| 253 | 3300046691 | Ga0495670_0041221 | Ga0495670_0041221_324_1253 | 305 |
| 254 | 3300046692 | Ga0495671_0102202 | Ga0495671_0102202_374_1303 | 305 |
| 255 | 3300046809 | Ga0495600_0006833 | Ga0495600_0006833_3791_4720 | 305 |
| 256 | 3300047317 | Ga0495604_0029105 | Ga0495604_0029105_34_963 | 305 |
| 257 | 3300047319 | Ga0495674_0009174 | Ga0495674_0009174_1916_2845 | 305 |
| 258 | 3300047319 | Ga0495674_0035705 | Ga0495674_0035705_2444_3373 | 305 |
| 259 | 3300047321 | Ga0495676_0007774 | Ga0495676_0007774_2089_3018 | 305 |
| 260 | 3300047444 | Ga0495675_0021825 | Ga0495675_0021825_863_1792 | 305 |
| 261 | 3300047673 | Ga0495593_0040756 | Ga0495593_0040756_1211_2140 | 305 |
| 262 | 3300048089 | Ga0495614_0007434 | Ga0495614_0007434_3142_4071 | 305 |
| 263 | 3300048089 | Ga0495614_0021477 | Ga0495614_0021477_1727_2656 | 305 |
| 264 | 3300048907 | Ga0496104_0210221 | Ga0496104_0210221_64_993 | 305 |
| 265 | 3300048908 | Ga0496105_0048746 | Ga0496105_0048746_2355_3284 | 305 |
| 266 | 3300048908 | Ga0496105_0059250 | Ga0496105_0059250_1510_2439 | 305 |
| 267 | 3300048909 | Ga0496106_0070980 | Ga0496106_0070980_1711_2640 | 305 |
| 268 | 3300048910 | Ga0496107_0010356 | Ga0496107_0010356_3352_4281 | 305 |
| 269 | 3300048915 | Ga0496112_0309642 | Ga0496112_0309642_505_1434 | 305 |
| 270 | 3300048917 | Ga0496114_0022761 | Ga0496114_0022761_3305_4234 | 305 |
| 271 | 3300048917 | Ga0496114_0238661 | Ga0496114_0238661_293_1222 | 305 |
| 272 | 3300048918 | Ga0496115_0006563 | Ga0496115_0006563_3017_3946 | 305 |
| 273 | 3300048918 | Ga0496115_0045376 | Ga0496115_0045376_1758_2687 | 305 |
| 274 | 3300042876 | Ga0451577_0202079 | Ga0451577_0202079_475_1449 | 306 |
| 275 | 3300050514 | nmdc:mga08x19_57650_c1 | nmdc:mga08x19_57650_c1_239_1240 | 307 |
| 276 | 3300005354 | Ga0070675_100000003 | Ga0070675_100000003372 | 308 |
| 277 | 3300005366 | Ga0070659_100404524 | Ga0070659_1004045242 | 308 |
| 278 | 3300006844 | Ga0075428_100293309 | Ga0075428_1002933092 | 308 |
| 279 | 3300006871 | Ga0075434_100239241 | Ga0075434_1002392412 | 308 |
| 280 | 3300009036 | Ga0105244_10013367 | Ga0105244_100133672 | 308 |
| 281 | 3300009098 | Ga0105245_10238688 | Ga0105245_102386882 | 308 |
| 282 | 3300025728 | Ga0207655_1040181 | Ga0207655_10401812 | 308 |
| 283 | 3300025926 | Ga0207659_10000001 | Ga0207659_10000001635 | 308 |
| 284 | 3300025934 | Ga0207686_10031876 | Ga0207686_100318762 | 308 |
| 285 | 3300050512 | nmdc:mga0n895_100917_c1 | nmdc:mga0n895_100917_c1_347_1291 | 308 |
| 286 | 3300005293 | Ga0065715_10095553 | Ga0065715_100955533 | 309 |
| 287 | 3300005328 | Ga0070676_10002577 | Ga0070676_100025778 | 309 |
| 288 | 3300005328 | Ga0070676_10013025 | Ga0070676_100130252 | 309 |
| 289 | 3300005329 | Ga0070683_100015960 | Ga0070683_1000159605 | 309 |
| 290 | 3300005329 | Ga0070683_100022036 | Ga0070683_1000220363 | 309 |
| 291 | 3300005330 | Ga0070690_100002589 | Ga0070690_1000025895 | 309 |
| 292 | 3300005330 | Ga0070690_100012605 | Ga0070690_1000126052 | 309 |
| 293 | 3300005330 | Ga0070690_100097002 | Ga0070690_1000970022 | 309 |
| 294 | 3300005331 | Ga0070670_100175734 | Ga0070670_1001757342 | 309 |
| 295 | 3300005336 | Ga0070680_100010238 | Ga0070680_1000102387 | 309 |
| 296 | 3300005337 | Ga0070682_100064671 | Ga0070682_1000646712 | 309 |
| 297 | 3300005340 | Ga0070689_100030208 | Ga0070689_1000302086 | 309 |
| 298 | 3300005340 | Ga0070689_100290896 | Ga0070689_1002908962 | 309 |
| 299 | 3300005343 | Ga0070687_100131256 | Ga0070687_1001312562 | 309 |
| 300 | 3300005344 | Ga0070661_100005145 | Ga0070661_1000051457 | 309 |
| 301 | 3300005344 | Ga0070661_100005454 | Ga0070661_1000054545 | 309 |
| 302 | 3300005353 | Ga0070669_100100748 | Ga0070669_1001007482 | 309 |
| 303 | 3300005354 | Ga0070675_100029761 | Ga0070675_1000297613 | 309 |
| 304 | 3300005365 | Ga0070688_100046952 | Ga0070688_1000469523 | 309 |
| 305 | 3300005365 | Ga0070688_100137183 | Ga0070688_1001371832 | 309 |
| 306 | 3300005366 | Ga0070659_100004954 | Ga0070659_1000049545 | 309 |
| 307 | 3300005367 | Ga0070667_100050889 | Ga0070667_1000508893 | 309 |
| 308 | 3300005434 | Ga0070709_10080316 | Ga0070709_100803162 | 309 |
| 309 | 3300005434 | Ga0070709_10096014 | Ga0070709_100960142 | 309 |
| 310 | 3300005435 | Ga0070714_100123214 | Ga0070714_1001232142 | 309 |
| 311 | 3300005435 | Ga0070714_100207413 | Ga0070714_1002074132 | 309 |
| 312 | 3300005439 | Ga0070711_100018101 | Ga0070711_1000181012 | 309 |
| 313 | 3300005440 | Ga0070705_100002661 | Ga0070705_1000026615 | 309 |
| 314 | 3300005440 | Ga0070705_100043942 | Ga0070705_1000439422 | 309 |
| 315 | 3300005440 | Ga0070705_100173749 | Ga0070705_1001737492 | 309 |
| 316 | 3300005444 | Ga0070694_100016968 | Ga0070694_1000169683 | 309 |
| 317 | 3300005445 | Ga0070708_100040668 | Ga0070708_1000406683 | 309 |
| 318 | 3300005455 | Ga0070663_100002121 | Ga0070663_1000021217 | 309 |
| 319 | 3300005455 | Ga0070663_100075253 | Ga0070663_1000752532 | 309 |
| 320 | 3300005457 | Ga0070662_100000757 | Ga0070662_1000007573 | 309 |
| 321 | 3300005459 | Ga0068867_100004156 | Ga0068867_1000041563 | 309 |
| 322 | 3300005466 | Ga0070685_10003684 | Ga0070685_100036845 | 309 |
| 323 | 3300005466 | Ga0070685_10064461 | Ga0070685_100644612 | 309 |
| 324 | 3300005467 | Ga0070706_100006053 | Ga0070706_1000060536 | 309 |
| 325 | 3300005468 | Ga0070707_100024983 | Ga0070707_1000249832 | 309 |
| 326 | 3300005471 | Ga0070698_100006903 | Ga0070698_1000069035 | 309 |
| 327 | 3300005471 | Ga0070698_100022863 | Ga0070698_1000228636 | 309 |
| 328 | 3300005518 | Ga0070699_100047276 | Ga0070699_1000472763 | 309 |
| 329 | 3300005530 | Ga0070679_100069183 | Ga0070679_1000691832 | 309 |
| 330 | 3300005530 | Ga0070679_100079144 | Ga0070679_1000791442 | 309 |
| 331 | 3300005535 | Ga0070684_100016682 | Ga0070684_1000166827 | 309 |
| 332 | 3300005536 | Ga0070697_100007629 | Ga0070697_1000076292 | 309 |
| 333 | 3300005536 | Ga0070697_100009220 | Ga0070697_1000092207 | 309 |
| 334 | 3300005539 | Ga0068853_100006331 | Ga0068853_1000063315 | 309 |
| 335 | 3300005539 | Ga0068853_100025332 | Ga0068853_1000253323 | 309 |
| 336 | 3300005546 | Ga0070696_100167489 | Ga0070696_1001674892 | 309 |
| 337 | 3300005547 | Ga0070693_100000004 | Ga0070693_10000000466 | 309 |
| 338 | 3300005547 | Ga0070693_100005354 | Ga0070693_1000053541 | 309 |
| 339 | 3300005547 | Ga0070693_100007822 | Ga0070693_1000078222 | 309 |
| 340 | 3300005548 | Ga0070665_100003370 | Ga0070665_10000337013 | 309 |
| 341 | 3300005548 | Ga0070665_100019857 | Ga0070665_1000198574 | 309 |
| 342 | 3300005563 | Ga0068855_100014801 | Ga0068855_1000148014 | 309 |
| 343 | 3300005563 | Ga0068855_100743515 | Ga0068855_1007435151 | 309 |
| 344 | 3300005564 | Ga0070664_100119594 | Ga0070664_1001195942 | 309 |
| 345 | 3300005577 | Ga0068857_100003885 | Ga0068857_1000038855 | 309 |
| 346 | 3300005577 | Ga0068857_100004856 | Ga0068857_1000048564 | 309 |
| 347 | 3300005577 | Ga0068857_100178342 | Ga0068857_1001783422 | 309 |
| 348 | 3300005578 | Ga0068854_100000587 | Ga0068854_1000005878 | 309 |
| 349 | 3300005578 | Ga0068854_100178829 | Ga0068854_1001788292 | 309 |
| 350 | 3300005614 | Ga0068856_100009485 | Ga0068856_1000094856 | 309 |
| 351 | 3300005614 | Ga0068856_100039225 | Ga0068856_1000392254 | 309 |
| 352 | 3300005615 | Ga0070702_100003922 | Ga0070702_1000039222 | 309 |
| 353 | 3300005616 | Ga0068852_100002033 | Ga0068852_1000020332 | 309 |
| 354 | 3300005617 | Ga0068859_100112219 | Ga0068859_1001122193 | 309 |
| 355 | 3300005618 | Ga0068864_100011164 | Ga0068864_1000111642 | 309 |
| 356 | 3300005718 | Ga0068866_10009415 | Ga0068866_100094154 | 309 |
| 357 | 3300005834 | Ga0068851_10007717 | Ga0068851_100077175 | 309 |
| 358 | 3300005840 | Ga0068870_10001103 | Ga0068870_100011037 | 309 |
| 359 | 3300005841 | Ga0068863_100011180 | Ga0068863_1000111807 | 309 |
| 360 | 3300005841 | Ga0068863_100082252 | Ga0068863_1000822524 | 309 |
| 361 | 3300005841 | Ga0068863_100283149 | Ga0068863_1002831492 | 309 |
| 362 | 3300005842 | Ga0068858_100008393 | Ga0068858_1000083936 | 309 |
| 363 | 3300005842 | Ga0068858_100013939 | Ga0068858_1000139392 | 309 |
| 364 | 3300005842 | Ga0068858_100149088 | Ga0068858_1001490882 | 309 |
| 365 | 3300005843 | Ga0068860_100073434 | Ga0068860_1000734342 | 309 |
| 366 | 3300005843 | Ga0068860_100144359 | Ga0068860_1001443592 | 309 |
| 367 | 3300005844 | Ga0068862_100003359 | Ga0068862_1000033594 | 309 |
| 368 | 3300006173 | Ga0070716_100000450 | Ga0070716_1000004509 | 309 |
| 369 | 3300006173 | Ga0070716_100003804 | Ga0070716_1000038043 | 309 |
| 370 | 3300006173 | Ga0070716_100004439 | Ga0070716_1000044392 | 309 |
| 371 | 3300006173 | Ga0070716_100030254 | Ga0070716_1000302542 | 309 |
| 372 | 3300006173 | Ga0070716_100136952 | Ga0070716_1001369522 | 309 |
| 373 | 3300006175 | Ga0070712_100054144 | Ga0070712_1000541442 | 309 |
| 374 | 3300006237 | Ga0097621_100185260 | Ga0097621_1001852602 | 309 |
| 375 | 3300006237 | Ga0097621_100279321 | Ga0097621_1002793212 | 309 |
| 376 | 3300006847 | Ga0075431_100018995 | Ga0075431_1000189956 | 309 |
| 377 | 3300006852 | Ga0075433_10131004 | Ga0075433_101310042 | 309 |
| 378 | 3300006871 | Ga0075434_100030079 | Ga0075434_1000300792 | 309 |
| 379 | 3300006871 | Ga0075434_100055325 | Ga0075434_1000553254 | 309 |
| 380 | 3300006881 | Ga0068865_100002290 | Ga0068865_1000022905 | 309 |
| 381 | 3300006914 | Ga0075436_100000737 | Ga0075436_1000007374 | 309 |
| 382 | 3300006914 | Ga0075436_100005655 | Ga0075436_1000056556 | 309 |
| 383 | 3300006914 | Ga0075436_100026238 | Ga0075436_1000262383 | 309 |
| 384 | 3300006931 | Ga0097620_100112217 | Ga0097620_1001122173 | 309 |
| 385 | 3300007076 | Ga0075435_100058675 | Ga0075435_1000586752 | 309 |
| 386 | 3300007076 | Ga0075435_100336284 | Ga0075435_1003362842 | 309 |
| 387 | 3300007265 | Ga0099794_10006331 | Ga0099794_100063312 | 309 |
| 388 | 3300007265 | Ga0099794_10023214 | Ga0099794_100232142 | 309 |
| 389 | 3300007265 | Ga0099794_10045411 | Ga0099794_100454112 | 309 |
| 390 | 3300007265 | Ga0099794_10148372 | Ga0099794_101483721 | 309 |
| 391 | 3300007788 | Ga0099795_10025446 | Ga0099795_100254462 | 309 |
| 392 | 3300009093 | Ga0105240_10010538 | Ga0105240_100105387 | 309 |
| 393 | 3300009093 | Ga0105240_10172716 | Ga0105240_101727162 | 309 |
| 394 | 3300009093 | Ga0105240_10543670 | Ga0105240_105436702 | 309 |
| 395 | 3300009098 | Ga0105245_10040917 | Ga0105245_100409176 | 309 |
| 396 | 3300009174 | Ga0105241_10010010 | Ga0105241_100100102 | 309 |
| 397 | 3300009174 | Ga0105241_10021359 | Ga0105241_100213592 | 309 |
| 398 | 3300009174 | Ga0105241_10171475 | Ga0105241_101714752 | 309 |
| 399 | 3300009176 | Ga0105242_10002605 | Ga0105242_100026056 | 309 |
| 400 | 3300009176 | Ga0105242_10024358 | Ga0105242_100243586 | 309 |
| 401 | 3300009177 | Ga0105248_10076405 | Ga0105248_100764054 | 309 |
| 402 | 3300009177 | Ga0105248_10186842 | Ga0105248_101868422 | 309 |
| 403 | 3300009545 | Ga0105237_10017522 | Ga0105237_100175225 | 309 |
| 404 | 3300009545 | Ga0105237_10021398 | Ga0105237_100213983 | 309 |
| 405 | 3300009553 | Ga0105249_10039077 | Ga0105249_100390772 | 309 |
| 406 | 3300009553 | Ga0105249_10089888 | Ga0105249_100898882 | 309 |
| 407 | 3300010159 | Ga0099796_10000665 | Ga0099796_100006652 | 309 |
| 408 | 3300010375 | Ga0105239_10035672 | Ga0105239_100356723 | 309 |
| 409 | 3300010375 | Ga0105239_10057403 | Ga0105239_100574032 | 309 |
| 410 | 3300011119 | Ga0105246_10001466 | Ga0105246_100014669 | 309 |
| 411 | 3300011119 | Ga0105246_10085885 | Ga0105246_100858852 | 309 |
| 412 | 3300013100 | Ga0157373_10003983 | Ga0157373_100039836 | 309 |
| 413 | 3300013100 | Ga0157373_10004107 | Ga0157373_100041078 | 309 |
| 414 | 3300013102 | Ga0157371_10043860 | Ga0157371_100438602 | 309 |
| 415 | 3300013105 | Ga0157369_10213051 | Ga0157369_102130512 | 309 |
| 416 | 3300013296 | Ga0157374_10239095 | Ga0157374_102390952 | 309 |
| 417 | 3300013297 | Ga0157378_10000044 | Ga0157378_100000444 | 309 |
| 418 | 3300013297 | Ga0157378_10002388 | Ga0157378_100023885 | 309 |
| 419 | 3300013297 | Ga0157378_10193705 | Ga0157378_101937052 | 309 |
| 420 | 3300013306 | Ga0163162_10010928 | Ga0163162_100109286 | 309 |
| 421 | 3300013306 | Ga0163162_10176040 | Ga0163162_101760402 | 309 |
| 422 | 3300013306 | Ga0163162_10555036 | Ga0163162_105550362 | 309 |
| 423 | 3300013307 | Ga0157372_10008911 | Ga0157372_100089113 | 309 |
| 424 | 3300013307 | Ga0157372_10250472 | Ga0157372_102504722 | 309 |
| 425 | 3300013307 | Ga0157372_10372883 | Ga0157372_103728832 | 309 |
| 426 | 3300014325 | Ga0163163_10004406 | Ga0163163_100044065 | 309 |
| 427 | 3300014325 | Ga0163163_10086516 | Ga0163163_100865162 | 309 |
| 428 | 3300014745 | Ga0157377_10000304 | Ga0157377_1000030411 | 309 |
| 429 | 3300014968 | Ga0157379_10008140 | Ga0157379_100081403 | 309 |
| 430 | 3300014969 | Ga0157376_10000008 | Ga0157376_10000008292 | 309 |
| 431 | 3300014969 | Ga0157376_10002199 | Ga0157376_100021993 | 309 |
| 432 | 3300014969 | Ga0157376_10018878 | Ga0157376_100188782 | 309 |
| 433 | 3300025885 | Ga0207653_10056710 | Ga0207653_100567101 | 309 |
| 434 | 3300025893 | Ga0207682_10007200 | Ga0207682_100072003 | 309 |
| 435 | 3300025901 | Ga0207688_10011349 | Ga0207688_100113494 | 309 |
| 436 | 3300025903 | Ga0207680_10002500 | Ga0207680_100025001 | 309 |
| 437 | 3300025903 | Ga0207680_10004549 | Ga0207680_100045495 | 309 |
| 438 | 3300025904 | Ga0207647_10007389 | Ga0207647_100073896 | 309 |
| 439 | 3300025905 | Ga0207685_10022938 | Ga0207685_100229382 | 309 |
| 440 | 3300025906 | Ga0207699_10069725 | Ga0207699_100697252 | 309 |
| 441 | 3300025907 | Ga0207645_10003138 | Ga0207645_100031389 | 309 |
| 442 | 3300025907 | Ga0207645_10003581 | Ga0207645_100035816 | 309 |
| 443 | 3300025908 | Ga0207643_10000247 | Ga0207643_100002475 | 309 |
| 444 | 3300025910 | Ga0207684_10015257 | Ga0207684_100152574 | 309 |
| 445 | 3300025910 | Ga0207684_10040516 | Ga0207684_100405162 | 309 |
| 446 | 3300025911 | Ga0207654_10013984 | Ga0207654_100139843 | 309 |
| 447 | 3300025911 | Ga0207654_10030271 | Ga0207654_100302713 | 309 |
| 448 | 3300025911 | Ga0207654_10118775 | Ga0207654_101187752 | 309 |
| 449 | 3300025912 | Ga0207707_10035921 | Ga0207707_100359215 | 309 |
| 450 | 3300025913 | Ga0207695_10002642 | Ga0207695_1000264216 | 309 |
| 451 | 3300025914 | Ga0207671_10010247 | Ga0207671_100102472 | 309 |
| 452 | 3300025914 | Ga0207671_10060918 | Ga0207671_100609183 | 309 |
| 453 | 3300025914 | Ga0207671_10142339 | Ga0207671_101423392 | 309 |
| 454 | 3300025915 | Ga0207693_10044049 | Ga0207693_100440492 | 309 |
| 455 | 3300025915 | Ga0207693_10060064 | Ga0207693_100600642 | 309 |
| 456 | 3300025916 | Ga0207663_10010895 | Ga0207663_100108955 | 309 |
| 457 | 3300025916 | Ga0207663_10014302 | Ga0207663_100143022 | 309 |
| 458 | 3300025916 | Ga0207663_10039572 | Ga0207663_100395722 | 309 |
| 459 | 3300025916 | Ga0207663_10062463 | Ga0207663_100624632 | 309 |
| 460 | 3300025919 | Ga0207657_10001280 | Ga0207657_100012806 | 309 |
| 461 | 3300025919 | Ga0207657_10008909 | Ga0207657_100089096 | 309 |
| 462 | 3300025920 | Ga0207649_10000566 | Ga0207649_100005665 | 309 |
| 463 | 3300025921 | Ga0207652_10029113 | Ga0207652_100291134 | 309 |
| 464 | 3300025921 | Ga0207652_10105765 | Ga0207652_101057652 | 309 |
| 465 | 3300025921 | Ga0207652_10165814 | Ga0207652_101658142 | 309 |
| 466 | 3300025922 | Ga0207646_10002647 | Ga0207646_100026479 | 309 |
| 467 | 3300025922 | Ga0207646_10161234 | Ga0207646_101612342 | 309 |
| 468 | 3300025925 | Ga0207650_10000051 | Ga0207650_10000051119 | 309 |
| 469 | 3300025927 | Ga0207687_10001469 | Ga0207687_100014698 | 309 |
| 470 | 3300025927 | Ga0207687_10018255 | Ga0207687_100182552 | 309 |
| 471 | 3300025928 | Ga0207700_10025361 | Ga0207700_100253613 | 309 |
| 472 | 3300025929 | Ga0207664_10146730 | Ga0207664_101467302 | 309 |
| 473 | 3300025929 | Ga0207664_10292927 | Ga0207664_102929272 | 309 |
| 474 | 3300025931 | Ga0207644_10002704 | Ga0207644_100027045 | 309 |
| 475 | 3300025932 | Ga0207690_10028250 | Ga0207690_100282502 | 309 |
| 476 | 3300025933 | Ga0207706_10000339 | Ga0207706_1000033932 | 309 |
| 477 | 3300025933 | Ga0207706_10004876 | Ga0207706_100048768 | 309 |
| 478 | 3300025937 | Ga0207669_10063345 | Ga0207669_100633452 | 309 |
| 479 | 3300025938 | Ga0207704_10148443 | Ga0207704_101484432 | 309 |
| 480 | 3300025939 | Ga0207665_10010339 | Ga0207665_100103392 | 309 |
| 481 | 3300025939 | Ga0207665_10014588 | Ga0207665_100145882 | 309 |
| 482 | 3300025940 | Ga0207691_10001789 | Ga0207691_100017898 | 309 |
| 483 | 3300025941 | Ga0207711_10013284 | Ga0207711_100132844 | 309 |
| 484 | 3300025942 | Ga0207689_10000184 | Ga0207689_1000018444 | 309 |
| 485 | 3300025945 | Ga0207679_10000101 | Ga0207679_100001019 | 309 |
| 486 | 3300025949 | Ga0207667_10005590 | Ga0207667_100055908 | 309 |
| 487 | 3300025961 | Ga0207712_10017344 | Ga0207712_100173442 | 309 |
| 488 | 3300025961 | Ga0207712_10131552 | Ga0207712_101315522 | 309 |
| 489 | 3300025972 | Ga0207668_10030920 | Ga0207668_100309202 | 309 |
| 490 | 3300025981 | Ga0207640_10102348 | Ga0207640_101023482 | 309 |
| 491 | 3300025986 | Ga0207658_10003193 | Ga0207658_100031932 | 309 |
| 492 | 3300025986 | Ga0207658_10019055 | Ga0207658_100190552 | 309 |
| 493 | 3300026035 | Ga0207703_10041152 | Ga0207703_100411522 | 309 |
| 494 | 3300026035 | Ga0207703_10290434 | Ga0207703_102904342 | 309 |
| 495 | 3300026041 | Ga0207639_10025342 | Ga0207639_100253422 | 309 |
| 496 | 3300026041 | Ga0207639_10264938 | Ga0207639_102649382 | 309 |
| 497 | 3300026041 | Ga0207639_10268059 | Ga0207639_102680592 | 309 |
| 498 | 3300026067 | Ga0207678_10000921 | Ga0207678_1000092113 | 309 |
| 499 | 3300026067 | Ga0207678_10002190 | Ga0207678_100021905 | 309 |
| 500 | 3300026078 | Ga0207702_10008197 | Ga0207702_100081973 | 309 |
| 501 | 3300026078 | Ga0207702_10208082 | Ga0207702_102080822 | 309 |
| 502 | 3300026088 | Ga0207641_10000006 | Ga0207641_10000006329 | 309 |
| 503 | 3300026088 | Ga0207641_10006018 | Ga0207641_100060188 | 309 |
| 504 | 3300026088 | Ga0207641_10102806 | Ga0207641_101028062 | 309 |
| 505 | 3300026088 | Ga0207641_10392045 | Ga0207641_103920452 | 309 |
| 506 | 3300026089 | Ga0207648_10000664 | Ga0207648_1000066427 | 309 |
| 507 | 3300026089 | Ga0207648_10003349 | Ga0207648_100033495 | 309 |
| 508 | 3300026095 | Ga0207676_10002185 | Ga0207676_100021856 | 309 |
| 509 | 3300026116 | Ga0207674_10009736 | Ga0207674_100097363 | 309 |
| 510 | 3300026116 | Ga0207674_10230528 | Ga0207674_102305282 | 309 |
| 511 | 3300026118 | Ga0207675_100106512 | Ga0207675_1001065122 | 309 |
| 512 | 3300026121 | Ga0207683_10001670 | Ga0207683_100016707 | 309 |
| 513 | 3300026142 | Ga0207698_10101694 | Ga0207698_101016942 | 309 |
| 514 | 3300027671 | Ga0209588_1011308 | Ga0209588_10113082 | 309 |
| 515 | 3300028016 | Ga0265354_1000021 | Ga0265354_100002115 | 309 |
| 516 | 3300028016 | Ga0265354_1001873 | Ga0265354_10018732 | 309 |
| 517 | 3300028379 | Ga0268266_10000153 | Ga0268266_1000015352 | 309 |
| 518 | 3300028379 | Ga0268266_10002191 | Ga0268266_100021919 | 309 |
| 519 | 3300028379 | Ga0268266_10013979 | Ga0268266_100139793 | 309 |
| 520 | 3300028380 | Ga0268265_10299912 | Ga0268265_102999122 | 309 |
| 521 | 3300028381 | Ga0268264_10001226 | Ga0268264_100012266 | 309 |
| 522 | 3300028381 | Ga0268264_10045316 | Ga0268264_100453162 | 309 |
| 523 | 3300028381 | Ga0268264_10167702 | Ga0268264_101677022 | 309 |
| 524 | 3300030878 | Ga0265770_1001287 | Ga0265770_10012872 | 309 |
| 525 | 3300030878 | Ga0265770_1003233 | Ga0265770_10032333 | 309 |
| 526 | 3300030879 | Ga0265765_1003655 | Ga0265765_10036552 | 309 |
| 527 | 3300031250 | Ga0265331_10128639 | Ga0265331_101286392 | 309 |
| 528 | 3300033547 | Ga0316212_1001185 | Ga0316212_10011852 | 309 |
| 529 | 3300035083 | Ga0373926_0000636 | Ga0373926_0000636_3163_4146 | 309 |
| 530 | 3300035086 | Ga0373934_0000710 | Ga0373934_0000710_4264_5235 | 309 |
| 531 | 3300035118 | Ga0373954_0007118 | Ga0373954_0007118_2844_3815 | 309 |
| 532 | 3300035119 | Ga0373956_0009696 | Ga0373956_0009696_1872_2843 | 309 |
| 533 | 3300035119 | Ga0373956_0018682 | Ga0373956_0018682_129_1100 | 309 |
| 534 | 3300035171 | Ga0373946_0001883 | Ga0373946_0001883_340_1323 | 309 |
| 535 | 3300035172 | Ga0373955_0005463 | Ga0373955_0005463_3483_4454 | 309 |
| 536 | 3300035172 | Ga0373955_0054539 | Ga0373955_0054539_249_1220 | 309 |
| 537 | 3300035172 | Ga0373955_0076666 | Ga0373955_0076666_172_1128 | 309 |
| 538 | 3300035241 | Ga0373961_0026879 | Ga0373961_0026879_259_1209 | 309 |
| 539 | 3300035410 | Ga0373924_0011060 | Ga0373924_0011060_1966_2937 | 309 |
| 540 | 3300035691 | Ga0373931_0008198 | Ga0373931_0008198_1515_2465 | 309 |
| 541 | 3300035691 | Ga0373931_0045338 | Ga0373931_0045338_159_1187 | 309 |
| 542 | 3300035692 | Ga0373935_0159403 | Ga0373935_0159403_473_1429 | 309 |
| 543 | 3300035695 | Ga0373927_0000782 | Ga0373927_0000782_5980_6963 | 309 |
| 544 | 3300035724 | Ga0373933_0009110 | Ga0373933_0009110_2667_3638 | 309 |
| 545 | 3300035725 | Ga0373947_0017268 | Ga0373947_0017268_2944_3927 | 309 |
| 546 | 3300035725 | Ga0373947_0073749 | Ga0373947_0073749_98_1054 | 309 |
| 547 | 3300036401 | Ga0373937_0000349 | Ga0373937_0000349_10152_11123 | 309 |
| 548 | 3300036401 | Ga0373937_0096703 | Ga0373937_0096703_773_1729 | 309 |
| 549 | 3300037068 | Ga0373925_0000717 | Ga0373925_0000717_12460_13443 | 309 |
| 550 | 3300037068 | Ga0373925_0021689 | Ga0373925_0021689_3461_4432 | 309 |
| 551 | 3300037471 | Ga0395905_0007860 | Ga0395905_0007860_6395_7357 | 309 |
| 552 | 3300037471 | Ga0395905_0094350 | Ga0395905_0094350_1178_2137 | 309 |
| 553 | 3300039450 | Ga0436363_0124748 | Ga0436363_0124748_340_1314 | 309 |
| 554 | 3300039450 | Ga0436363_1479800 | Ga0436363_1479800_1825_2787 | 309 |
| 555 | 3300044694 | Ga0466963_0031125 | Ga0466963_0031125_2097_3077 | 309 |
| 556 | 3300045051 | Ga0451576_0234056 | Ga0451576_0234056_864_1817 | 309 |
| 557 | 3300045976 | Ga0466967_0002708 | Ga0466967_0002708_3841_4920 | 309 |
| 558 | 3300045976 | Ga0466967_0143575 | Ga0466967_0143575_985_1977 | 309 |
| 559 | 3300045976 | Ga0466967_0420615 | Ga0466967_0420615_322_1272 | 309 |
| 560 | 3300046461 | Ga0495641_0013483 | Ga0495641_0013483_3325_4356 | 309 |
| 561 | 3300046462 | Ga0495651_0023136 | Ga0495651_0023136_2612_3583 | 309 |
| 562 | 3300046463 | Ga0495653_0156588 | Ga0495653_0156588_393_1364 | 309 |
| 563 | 3300046472 | Ga0495580_0001359 | Ga0495580_0001359_2010_3041 | 309 |
| 564 | 3300046472 | Ga0495580_0021567 | Ga0495580_0021567_347_1330 | 309 |
| 565 | 3300046472 | Ga0495580_0142280 | Ga0495580_0142280_647_1630 | 309 |
| 566 | 3300046473 | Ga0495582_0000382 | Ga0495582_0000382_3892_4923 | 309 |
| 567 | 3300046475 | Ga0495639_0097343 | Ga0495639_0097343_13_984 | 309 |
| 568 | 3300046477 | Ga0495664_0095376 | Ga0495664_0095376_305_1261 | 309 |
| 569 | 3300046517 | Ga0495630_0012090 | Ga0495630_0012090_3303_4286 | 309 |
| 570 | 3300046536 | Ga0495587_0041029 | Ga0495587_0041029_449_1438 | 309 |
| 571 | 3300046543 | Ga0495645_0040549 | Ga0495645_0040549_907_1890 | 309 |
| 572 | 3300046684 | Ga0495669_0001925 | Ga0495669_0001925_5682_6641 | 309 |
| 573 | 3300046684 | Ga0495669_0012854 | Ga0495669_0012854_633_1589 | 309 |
| 574 | 3300046809 | Ga0495600_0019628 | Ga0495600_0019628_2232_3203 | 309 |
| 575 | 3300047315 | Ga0495581_0013471 | Ga0495581_0013471_2346_3317 | 309 |
| 576 | 3300047317 | Ga0495604_0001770 | Ga0495604_0001770_8516_9487 | 309 |
| 577 | 3300047471 | Ga0495684_0060732 | Ga0495684_0060732_110_1081 | 309 |
| 578 | 3300048088 | Ga0495602_0013387 | Ga0495602_0013387_5883_6854 | 309 |
| 579 | 3300048905 | Ga0496102_0003513 | Ga0496102_0003513_11928_12881 | 309 |
| 580 | 3300048905 | Ga0496102_0004269 | Ga0496102_0004269_1263_2264 | 309 |
| 581 | 3300048906 | Ga0496103_0015318 | Ga0496103_0015318_2603_3604 | 309 |
| 582 | 3300048907 | Ga0496104_0217841 | Ga0496104_0217841_138_1091 | 309 |
| 583 | 3300048911 | Ga0496108_0000095 | Ga0496108_0000095_2099_3052 | 309 |
| 584 | 3300048911 | Ga0496108_0113319 | Ga0496108_0113319_290_1240 | 309 |
| 585 | 3300048912 | Ga0496109_0000126 | Ga0496109_0000126_53021_53974 | 309 |
| 586 | 3300048913 | Ga0496110_0002871 | Ga0496110_0002871_10368_11321 | 309 |
| 587 | 3300048914 | Ga0496111_0007966 | Ga0496111_0007966_3153_4106 | 309 |
| 588 | 3300048915 | Ga0496112_0000615 | Ga0496112_0000615_5706_6659 | 309 |
| 589 | 3300048915 | Ga0496112_0005230 | Ga0496112_0005230_2201_3157 | 309 |
| 590 | 3300048915 | Ga0496112_0017844 | Ga0496112_0017844_5262_6212 | 309 |
| 591 | 3300048916 | Ga0496113_0003748 | Ga0496113_0003748_7525_8478 | 309 |
| 592 | 3300048916 | Ga0496113_0357896 | Ga0496113_0357896_191_1147 | 309 |
| 593 | 3300048917 | Ga0496114_0030844 | Ga0496114_0030844_432_1463 | 309 |
| 594 | 3300048918 | Ga0496115_0009132 | Ga0496115_0009132_5830_6861 | 309 |
| 595 | 3300050510 | nmdc:mga06r32_9974_c1 | nmdc:mga06r32_9974_c1_1735_2679 | 309 |
| 596 | 3300050512 | nmdc:mga0n895_51073_c1 | nmdc:mga0n895_51073_c1_2929_3975 | 309 |
| 597 | 3300050513 | nmdc:mga0rr50_275741_c1 | nmdc:mga0rr50_275741_c1_41_1024 | 309 |
| 598 | 3300050513 | nmdc:mga0rr50_49268_c1 | nmdc:mga0rr50_49268_c1_1463_2494 | 309 |
| 599 | 3300050514 | nmdc:mga08x19_146_c1 | nmdc:mga08x19_146_c1_18623_19606 | 309 |
| 600 | 3300050514 | nmdc:mga08x19_2567_c1 | nmdc:mga08x19_2567_c1_523_1506 | 309 |
| 601 | 3300050514 | nmdc:mga08x19_6583_c1 | nmdc:mga08x19_6583_c1_5424_6407 | 309 |
| 602 | 3300050514 | nmdc:mga08x19_689_c1 | nmdc:mga08x19_689_c1_6360_7319 | 309 |
| 603 | 3300050515 | nmdc:mga0a205_141703_c1 | nmdc:mga0a205_141703_c1_1056_2084 | 309 |
| 604 | 3300053085 | Ga0495619_0015727 | Ga0495619_0015727_1834_2805 | 309 |
| 605 | 3300005337 | Ga0070682_100000082 | Ga0070682_10000008266 | 310 |
| 606 | 3300005338 | Ga0068868_100226090 | Ga0068868_1002260901 | 310 |
| 607 | 3300005340 | Ga0070689_100000899 | Ga0070689_1000008994 | 310 |
| 608 | 3300005438 | Ga0070701_10026517 | Ga0070701_100265172 | 310 |
| 609 | 3300005441 | Ga0070700_100000001 | Ga0070700_100000001221 | 310 |
| 610 | 3300005444 | Ga0070694_100311393 | Ga0070694_1003113932 | 310 |
| 611 | 3300005445 | Ga0070708_100443327 | Ga0070708_1004433271 | 310 |
| 612 | 3300005456 | Ga0070678_100255363 | Ga0070678_1002553631 | 310 |
| 613 | 3300005467 | Ga0070706_100012328 | Ga0070706_1000123285 | 310 |
| 614 | 3300005468 | Ga0070707_100004807 | Ga0070707_1000048077 | 310 |
| 615 | 3300005471 | Ga0070698_100034608 | Ga0070698_1000346085 | 310 |
| 616 | 3300005471 | Ga0070698_100157613 | Ga0070698_1001576132 | 310 |
| 617 | 3300005471 | Ga0070698_100195545 | Ga0070698_1001955452 | 310 |
| 618 | 3300005471 | Ga0070698_100278086 | Ga0070698_1002780861 | 310 |
| 619 | 3300005518 | Ga0070699_100011123 | Ga0070699_1000111236 | 310 |
| 620 | 3300005518 | Ga0070699_100015577 | Ga0070699_1000155777 | 310 |
| 621 | 3300005518 | Ga0070699_100033738 | Ga0070699_1000337383 | 310 |
| 622 | 3300005543 | Ga0070672_100000324 | Ga0070672_10000032421 | 310 |
| 623 | 3300005577 | Ga0068857_100015384 | Ga0068857_1000153843 | 310 |
| 624 | 3300005615 | Ga0070702_100014769 | Ga0070702_1000147692 | 310 |
| 625 | 3300005617 | Ga0068859_100015723 | Ga0068859_1000157236 | 310 |
| 626 | 3300005618 | Ga0068864_100000001 | Ga0068864_100000001390 | 310 |
| 627 | 3300005841 | Ga0068863_100058770 | Ga0068863_1000587704 | 310 |
| 628 | 3300005842 | Ga0068858_100001897 | Ga0068858_10000189721 | 310 |
| 629 | 3300005844 | Ga0068862_100008925 | Ga0068862_1000089252 | 310 |
| 630 | 3300006028 | Ga0070717_10527211 | Ga0070717_105272111 | 310 |
| 631 | 3300006844 | Ga0075428_100031691 | Ga0075428_1000316914 | 310 |
| 632 | 3300006881 | Ga0068865_100039266 | Ga0068865_1000392664 | 310 |
| 633 | 3300006931 | Ga0097620_100015722 | Ga0097620_1000157226 | 310 |
| 634 | 3300009093 | Ga0105240_10017307 | Ga0105240_100173074 | 310 |
| 635 | 3300009098 | Ga0105245_10000786 | Ga0105245_1000078613 | 310 |
| 636 | 3300009098 | Ga0105245_10016836 | Ga0105245_100168362 | 310 |
| 637 | 3300009147 | Ga0114129_10239068 | Ga0114129_102390682 | 310 |
| 638 | 3300009176 | Ga0105242_10011272 | Ga0105242_100112724 | 310 |
| 639 | 3300013297 | Ga0157378_10016679 | Ga0157378_100166793 | 310 |
| 640 | 3300013306 | Ga0163162_10007750 | Ga0163162_100077505 | 310 |
| 641 | 3300013308 | Ga0157375_10000005 | Ga0157375_10000005259 | 310 |
| 642 | 3300013308 | Ga0157375_10000092 | Ga0157375_1000009255 | 310 |
| 643 | 3300014969 | Ga0157376_10570691 | Ga0157376_105706912 | 310 |
| 644 | 3300021384 | Ga0213876_10042452 | Ga0213876_100424522 | 310 |
| 645 | 3300025910 | Ga0207684_10015510 | Ga0207684_100155103 | 310 |
| 646 | 3300025913 | Ga0207695_10028415 | Ga0207695_100284155 | 310 |
| 647 | 3300025915 | Ga0207693_10052328 | Ga0207693_100523284 | 310 |
| 648 | 3300025922 | Ga0207646_10010731 | Ga0207646_100107315 | 310 |
| 649 | 3300025927 | Ga0207687_10000623 | Ga0207687_100006232 | 310 |
| 650 | 3300025927 | Ga0207687_10001653 | Ga0207687_1000165313 | 310 |
| 651 | 3300025934 | Ga0207686_10013161 | Ga0207686_100131615 | 310 |
| 652 | 3300025936 | Ga0207670_10000778 | Ga0207670_100007783 | 310 |
| 653 | 3300025936 | Ga0207670_10287211 | Ga0207670_102872112 | 310 |
| 654 | 3300025938 | Ga0207704_10029097 | Ga0207704_100290974 | 310 |
| 655 | 3300025940 | Ga0207691_10001710 | Ga0207691_1000171015 | 310 |
| 656 | 3300026035 | Ga0207703_10000019 | Ga0207703_10000019168 | 310 |
| 657 | 3300026041 | Ga0207639_10000005 | Ga0207639_10000005134 | 310 |
| 658 | 3300026075 | Ga0207708_10000024 | Ga0207708_10000024123 | 310 |
| 659 | 3300026088 | Ga0207641_10047752 | Ga0207641_100477522 | 310 |
| 660 | 3300026095 | Ga0207676_10000002 | Ga0207676_10000002444 | 310 |
| 661 | 3300026116 | Ga0207674_10017826 | Ga0207674_100178261 | 310 |
| 662 | 3300026121 | Ga0207683_10099462 | Ga0207683_100994623 | 310 |
| 663 | 3300028380 | Ga0268265_10011994 | Ga0268265_100119944 | 310 |
| 664 | 3300032002 | Ga0307416_100123614 | Ga0307416_1001236142 | 310 |
| 665 | 3300037068 | Ga0373925_0243120 | Ga0373925_0243120_393_1415 | 310 |
| 666 | 3300039437 | Ga0436365_0235218 | Ga0436365_0235218_3501_4508 | 310 |
| 667 | 3300039437 | Ga0436365_1172964 | Ga0436365_1172964_862_1851 | 310 |
| 668 | 3300042876 | Ga0451577_0033406 | Ga0451577_0033406_1967_2950 | 310 |
| 669 | 3300044673 | Ga0453683_0028024 | Ga0453683_0028024_777_1760 | 310 |
| 670 | 3300046455 | Ga0495603_0001224 | Ga0495603_0001224_2988_4010 | 310 |
| 671 | 3300046459 | Ga0495629_0140932 | Ga0495629_0140932_121_1143 | 310 |
| 672 | 3300046461 | Ga0495641_0018646 | Ga0495641_0018646_2171_3193 | 310 |
| 673 | 3300046472 | Ga0495580_0039037 | Ga0495580_0039037_458_1480 | 310 |
| 674 | 3300046473 | Ga0495582_0061327 | Ga0495582_0061327_710_1732 | 310 |
| 675 | 3300046475 | Ga0495639_0001243 | Ga0495639_0001243_5893_6915 | 310 |
| 676 | 3300046476 | Ga0495662_0031837 | Ga0495662_0031837_133_1155 | 310 |
| 677 | 3300046526 | Ga0495666_0021800 | Ga0495666_0021800_263_1285 | 310 |
| 678 | 3300046531 | Ga0495665_0029902 | Ga0495665_0029902_1272_2294 | 310 |
| 679 | 3300046533 | Ga0495640_0017251 | Ga0495640_0017251_2653_3675 | 310 |
| 680 | 3300046535 | Ga0495586_0003873 | Ga0495586_0003873_3779_4801 | 310 |
| 681 | 3300046663 | Ga0495635_0117040 | Ga0495635_0117040_14_1036 | 310 |
| 682 | 3300046681 | Ga0495647_0003725 | Ga0495647_0003725_2976_3998 | 310 |
| 683 | 3300047315 | Ga0495581_0038031 | Ga0495581_0038031_226_1248 | 310 |
| 684 | 3300047319 | Ga0495674_0036725 | Ga0495674_0036725_1740_2762 | 310 |
| 685 | 3300047321 | Ga0495676_0001777 | Ga0495676_0001777_2716_3738 | 310 |
| 686 | 3300047471 | Ga0495684_0011951 | Ga0495684_0011951_1084_2106 | 310 |
| 687 | 3300048904 | Ga0496101_0081230 | Ga0496101_0081230_437_1459 | 310 |
| 688 | 3300049589 | Ga0501073_0012134 | Ga0501073_0012134_1493_2458 | 310 |
| 689 | 3300049742 | Ga0501080_0001025 | Ga0501080_0001025_2039_3004 | 310 |
| 690 | 3300050513 | nmdc:mga0rr50_10588_c1 | nmdc:mga0rr50_10588_c1_4274_5233 | 310 |
| 691 | 3300003203 | JGI25406J46586_10019228 | JGI25406J46586_100192282 | 311 |
| 692 | 3300005347 | Ga0070668_100168194 | Ga0070668_1001681941 | 311 |
| 693 | 3300005353 | Ga0070669_100004094 | Ga0070669_1000040946 | 311 |
| 694 | 3300005468 | Ga0070707_100003066 | Ga0070707_10000306611 | 311 |
| 695 | 3300005518 | Ga0070699_100099871 | Ga0070699_1000998713 | 311 |
| 696 | 3300005937 | Ga0081455_10007293 | Ga0081455_100072934 | 311 |
| 697 | 3300005937 | Ga0081455_10065623 | Ga0081455_100656232 | 311 |
| 698 | 3300005985 | Ga0081539_10018248 | Ga0081539_100182483 | 311 |
| 699 | 3300006847 | Ga0075431_100136569 | Ga0075431_1001365692 | 311 |
| 700 | 3300006847 | Ga0075431_100402784 | Ga0075431_1004027841 | 311 |
| 701 | 3300006847 | Ga0075431_100430035 | Ga0075431_1004300351 | 311 |
| 702 | 3300006852 | Ga0075433_10280229 | Ga0075433_102802292 | 311 |
| 703 | 3300006880 | Ga0075429_100263342 | Ga0075429_1002633422 | 311 |
| 704 | 3300009147 | Ga0114129_10157396 | Ga0114129_101573962 | 311 |
| 705 | 3300014326 | Ga0157380_10362470 | Ga0157380_103624701 | 311 |
| 706 | 3300025922 | Ga0207646_10014722 | Ga0207646_100147224 | 311 |
| 707 | 3300025923 | Ga0207681_10045028 | Ga0207681_100450282 | 311 |
| 708 | 3300027907 | Ga0207428_10138319 | Ga0207428_101383192 | 311 |
| 709 | 3300048912 | Ga0496109_0000410 | Ga0496109_0000410_35956_36891 | 311 |
| 710 | 3300049743 | Ga0501081_0147021 | Ga0501081_0147021_223_1161 | 311 |
| 711 | 3300050507 | nmdc:mga05p37_22163_c1 | nmdc:mga05p37_22163_c1_63_998 | 311 |
| 712 | 3300050510 | nmdc:mga06r32_217866_c1 | nmdc:mga06r32_217866_c1_402_1337 | 311 |
| 713 | 3300050510 | nmdc:mga06r32_299693_c1 | nmdc:mga06r32_299693_c1_528_1472 | 311 |
| 714 | 3300050510 | nmdc:mga06r32_367438_c1 | nmdc:mga06r32_367438_c1_170_1105 | 311 |
| 715 | 3300050511 | nmdc:mga08y16_35772_c1 | nmdc:mga08y16_35772_c1_854_1789 | 311 |
| 716 | 3300050515 | nmdc:mga0a205_46298_c1 | nmdc:mga0a205_46298_c1_3078_4013 | 311 |
| 717 | 3300054114 | Ga0501084_0018572 | Ga0501084_0018572_2560_3498 | 311 |
| 718 | 3300060353 | Ga0501082_0131148 | Ga0501082_0131148_658_1596 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9546 | 3 | 222 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9442 | 1 | 216 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.933 | 1 | 222 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9326 | 1 | 216 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.929 | 4 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9U1_1_234_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.966 | 4 | 224 | 3.40.50.300 |
| af_P37624_268_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9636 | 2 | 220 | 3.40.50.300 |
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9595 | 2 | 221 | 3.40.50.300 |
| af_P0A9U1_321_563_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9552 | 1 | 221 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9547 | 4 | 221 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2QAU4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9789 | 3 | 153 |
GO:0005524
GO:0016887 |
| AF-A0A358GWI5-F1-model_v4 | deleted | 0.9727 | 2 | 224 |
|
| AF-A0A7Y8LYW3-F1-model_v4 | ABC transporter ATP-binding protein | 0.9715 | 2 | 181 |
GO:0005524
GO:0016887 |
| AF-Q8VR06-F1-model_v4 | Putative ABC transporter protein | 0.971 | 81 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A511X0H7-F1-model_v4 | ABC transporter domain-containing protein | 0.9684 | 1 | 183 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar