F477150

General Info

Members Datasets Scaffolds Average Seq Length
718 264 1436 264

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10136765|Ga0075369_101367652
Length 306
Sequence MVAVGRAIAGVVPAARRWQLQSLRTGVVHLSPGDAAWPELWSMIVTRTPEAPPQWLLLNVPGTPQAGVALRQMFAQAWWSGLFEGTEWHALHEQGPVLVDLRTCPALADLCIVDGQRWPGLLMVSEASASSLLAHLRRMLTVTLGLHRALLSYYNPITASYFFDACDAAELSRWLGPINQLRWFGGTWADRATGSEGWQRLSNPGLAVSPLAVEESLSAGQQGTLQTCLLEQHAWRWSQTTGVDFFRLSAHVQEGVALGFSERPVLDGWIWLRLQYPDAVPVQPLPGRTQQERLDSLRRLWQNDPL

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
8 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
9 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
10 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
11 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
22 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
23 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
33 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
34 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
38 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
39 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
44 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
45 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
48 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
49 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
50 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
51 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
52 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
53 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
54 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
55 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
56 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
57 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
58 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
59 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
60 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
61 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
62 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
63 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
64 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
65 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
66 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
67 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
68 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
69 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
70 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
71 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
72 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
73 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
74 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
75 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
76 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
77 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
78 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
174 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
175 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 2511231004 Pseudomonas sp. GM102 Isolate Nodule
181 2511231007 Pseudomonas sp. GM18 Isolate Nodule
182 2511231008 Pseudomonas sp. GM21 Isolate Nodule
183 2511231012 Pseudomonas sp. GM33 Isolate Nodule
184 2511231014 Pseudomonas sp. GM48 Isolate Nodule
185 2511231015 Pseudomonas sp. GM49 Isolate Nodule
186 2511231016 Pseudomonas sp. GM50 Isolate Nodule
187 2511231017 Pseudomonas sp. GM55 Isolate Nodule
188 2511231018 Pseudomonas sp. GM60 Isolate Nodule
189 2511231019 Pseudomonas sp. GM67 Isolate Nodule
190 2511231020 Pseudomonas sp. GM74 Isolate Nodule
191 2511231021 Pseudomonas sp. GM78 Isolate Nodule
192 2511231022 Pseudomonas sp. GM79 Isolate Nodule
193 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
194 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
195 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
196 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
197 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
198 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
199 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
200 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
201 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
202 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
203 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
204 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
205 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
206 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
207 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
208 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
209 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
210 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
211 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
212 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
213 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
214 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
215 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
216 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
217 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
218 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
219 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
220 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
221 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
222 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
223 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
224 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
225 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
226 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
227 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
228 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
229 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
230 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
231 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
232 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
233 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
234 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
235 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
236 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
237 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
238 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
239 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
240 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
241 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
242 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
243 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
244 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
245 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
246 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
247 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
248 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
249 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
250 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
251 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
252 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
253 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
254 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
255 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
256 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
257 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
258 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
259 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
260 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
261 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
262 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
263 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
264 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.16
Metatranscriptomes 0
Isolates 11.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 2.09
Rhizoplane 5.01
Rhizosphere 84.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10136765 3300006186 Bacteria 1116
2 SwRhRL2b_contig_3194184 2162886007 Bacteria 3294
3 Ga0055530_10001838 3300003791 Bacteria 14619
4 Ga0055530_10026932 3300003791 Bacteria 1578
5 Ga0055540_1001362 3300003792 Bacteria 14648
6 Ga0065714_10002005 3300005288 Bacteria 5381
7 Ga0065714_10005368 3300005288 Bacteria 7216
8 Ga0065714_10007672 3300005288 Bacteria 2790
9 Ga0065714_10011034 3300005288 Bacteria 4171
10 Ga0065714_10011564 3300005288 Bacteria 2494
11 Ga0065714_10064979 3300005288 Bacteria 14510
12 Ga0065714_10079610 3300005288 Bacteria 2499
13 Ga0065704_10001021 3300005289 Bacteria 14735
14 Ga0075364_10167557 3300006051 Bacteria 1484
15 Ga0075364_10230886 3300006051 Bacteria 1256
16 Ga0075432_10001366 3300006058 Bacteria 7928
17 Ga0075432_10003694 3300006058 Bacteria 5211
18 Ga0075432_10010321 3300006058 Bacteria 3168
19 Ga0075432_10014915 3300006058 Bacteria 2648
20 Ga0075432_10015887 3300006058 Bacteria 2570
21 Ga0075432_10033532 3300006058 Bacteria 1781
22 Ga0075362_10058410 3300006177 Bacteria 1739
23 Ga0075362_10098996 3300006177 Bacteria 1361
24 Ga0075436_100232292 3300006914 Bacteria 1310
25 Ga0075436_100400957 3300006914 Bacteria 994
26 Ga0079104_1001511 3300006946 Bacteria 15449
27 Ga0105251_10002261 3300009011 Bacteria 15294
28 Ga0105251_10054248 3300009011 Bacteria 1904
29 Ga0105244_10006998 3300009036 Bacteria 7218
30 Ga0105244_10017572 3300009036 Bacteria 4038
31 Ga0105244_10032240 3300009036 Bacteria 2775
32 Ga0105250_10020766 3300009092 Bacteria 2652
33 Ga0105243_10078681 3300009148 Bacteria 2685
34 Ga0157373_10000305 3300013100 Bacteria 39678
35 Ga0157371_10013194 3300013102 Bacteria 6288
36 Ga0157370_10006519 3300013104 Bacteria 12851
37 Ga0157370_10103131 3300013104 Bacteria 2670
38 Ga0163162_10047369 3300013306 Bacteria 4308
39 Ga0182008_10002414 3300014497 Bacteria 11731
40 Ga0182008_10010237 3300014497 Bacteria 5026
41 Ga0182008_10011391 3300014497 Bacteria 4733
42 Ga0182008_10021669 3300014497 Bacteria 3299
43 Ga0182008_10031510 3300014497 Bacteria 2669
44 Ga0182006_1001458 3300015261 Bacteria 14249
45 Ga0182006_1009293 3300015261 Bacteria 4411
46 Ga0182006_1016725 3300015261 Bacteria 3126
47 Ga0182007_10001167 3300015262 Bacteria 14237
48 Ga0182007_10013030 3300015262 Bacteria 3185
49 Ga0182005_1004421 3300015265 Bacteria 4547
50 Ga0182005_1004721 3300015265 Bacteria 4352
51 Ga0163161_10035615 3300017792 Bacteria 3563
52 Ga0163161_10062171 3300017792 Bacteria 2719
53 Ga0209676_1006448 3300025292 Bacteria 5790
54 Ga0209050_1001481 3300025298 Bacteria 25025
55 Ga0209050_1001681 3300025298 Bacteria 22213
56 Ga0209051_1000206 3300025303 Bacteria 104064
57 Ga0209051_1015152 3300025303 Bacteria 3559
58 Ga0209257_1005409 3300025304 Bacteria 8983
59 Ga0207655_1002956 3300025728 Bacteria 13061
60 Ga0207655_1022910 3300025728 Bacteria 3113
61 Ga0207713_1006219 3300025735 Bacteria 7315
62 Ga0207713_1007610 3300025735 Bacteria 6346
63 Ga0207709_10016458 3300025935 Bacteria 4111
64 Ga0209281_1000159 3300027111 Bacteria 161872
65 Ga0207428_10026542 3300027907 Bacteria 4835
66 Ga0207428_10033443 3300027907 Bacteria 4223
67 Ga0207428_10034344 3300027907 Bacteria 4156
68 Ga0207428_10039559 3300027907 Bacteria 3829
69 Ga0207428_10106248 3300027907 Bacteria 2165
70 Ga0207428_10135130 3300027907 Bacteria 1886
71 Ga0316183_1102575 3300030742 Bacteria 1900
72 Ga0316183_1190590 3300030742 Bacteria 4790
73 Ga0307408_100022246 3300031548 Bacteria 4305
74 Ga0307408_100022901 3300031548 Bacteria 4250
75 Ga0307408_100053410 3300031548 Bacteria 2917
76 Ga0307408_100270622 3300031548 Bacteria 1410
77 Ga0307516_10380083 3300031730 Bacteria 1074
78 Ga0307405_10000313 3300031731 Bacteria 18014
79 Ga0307405_10001799 3300031731 Bacteria 9177
80 Ga0307413_10548169 3300031824 Bacteria 937
81 Ga0307406_10112998 3300031901 Bacteria 1873
82 Ga0307407_10157593 3300031903 Bacteria 1482
83 Ga0307412_10001254 3300031911 Bacteria 14314
84 Ga0307412_10002113 3300031911 Bacteria 11025
85 Ga0307412_10095059 3300031911 Bacteria 2094
86 Ga0307412_10131819 3300031911 Bacteria 1816
87 Ga0307411_10263356 3300032005 Bacteria 1362
88 Ga0439438_000803 3300041405 Bacteria 14033
89 Ga0439438_000848 3300041405 Bacteria 13663
90 Ga0439438_000939 3300041405 Bacteria 12989
91 Ga0439438_003074 3300041405 Bacteria 6861
92 Ga0439438_006057 3300041405 Bacteria 4339
93 Ga0439438_006423 3300041405 Bacteria 4144
94 Ga0439447_000296 3300041407 Bacteria 17686
95 Ga0439447_001226 3300041407 Bacteria 9353
96 Ga0439447_003793 3300041407 Bacteria 5305
97 Ga0439447_004211 3300041407 Bacteria 4989
98 Ga0439447_004519 3300041407 Bacteria 4767
99 Ga0439447_004783 3300041407 Bacteria 4607
100 Ga0439447_005320 3300041407 Bacteria 4290
101 Ga0439447_009080 3300041407 Bacteria 3034
102 Ga0439466_0006201 3300041411 Bacteria 4552
103 Ga0439466_0007405 3300041411 Bacteria 4156
104 Ga0439466_0007873 3300041411 Bacteria 4021
105 Ga0439466_0009075 3300041411 Bacteria 3731
106 Ga0439466_0010923 3300041411 Bacteria 3365
107 Ga0439466_0012001 3300041411 Bacteria 3200
108 Ga0439466_0012889 3300041411 Bacteria 3067
109 Ga0439466_0014436 3300041411 Bacteria 2875
110 Ga0439466_0025406 3300041411 Bacteria 2067
111 Ga0439466_0098070 3300041411 Bacteria 915
112 Ga0439465_0048395 3300041413 Bacteria 1387
113 Ga0439431_0002968 3300041997 Bacteria 3724
114 Ga0439445_0004749 3300042004 Bacteria 3078
115 Ga0439445_0016048 3300042004 Bacteria 1839
116 Ga0439432_001735 3300042006 Bacteria 8164
117 Ga0439432_002405 3300042006 Bacteria 7059
118 Ga0439432_005352 3300042006 Bacteria 4629
119 Ga0439432_013167 3300042006 Bacteria 2815
120 Ga0439432_014300 3300042006 Bacteria 2688
121 Ga0439432_032315 3300042006 Bacteria 1687
122 Ga0439451_003107 3300042009 Bacteria 3373
123 Ga0439451_003771 3300042009 Bacteria 3073
124 Ga0439451_003859 3300042009 Bacteria 3045
125 Ga0439451_004782 3300042009 Bacteria 2754
126 Ga0439451_007184 3300042009 Bacteria 2274
127 Ga0439451_007791 3300042009 Bacteria 2176
128 Ga0439451_011787 3300042009 Bacteria 1763
129 Ga0439451_018895 3300042009 Bacteria 1390
130 Ga0439452_000951 3300042010 Bacteria 13001
131 Ga0439452_003900 3300042010 Bacteria 5111
132 Ga0439452_004261 3300042010 Bacteria 4833
133 Ga0439452_005203 3300042010 Bacteria 4226
134 Ga0439452_005724 3300042010 Bacteria 3973
135 Ga0439452_006695 3300042010 Bacteria 3587
136 Ga0439452_007812 3300042010 Bacteria 3247
137 Ga0439452_010306 3300042010 Bacteria 2724
138 Ga0439452_014232 3300042010 Bacteria 2215
139 Ga0439452_027326 3300042010 Bacteria 1433
140 Ga0439452_029260 3300042010 Bacteria 1368
141 Ga0439456_001921 3300042013 Bacteria 4184
142 Ga0439456_004329 3300042013 Bacteria 2874
143 Ga0439456_006446 3300042013 Bacteria 2397
144 Ga0439456_007069 3300042013 Bacteria 2299
145 Ga0439456_012111 3300042013 Bacteria 1787
146 Ga0439456_022392 3300042013 Bacteria 1338
147 Ga0439456_023476 3300042013 Bacteria 1307
148 Ga0439456_029640 3300042013 Bacteria 1169
149 Ga0439463_006380 3300042016 Bacteria 2927
150 Ga0439463_007339 3300042016 Bacteria 2723
151 Ga0439463_008313 3300042016 Bacteria 2559
152 Ga0439463_010336 3300042016 Bacteria 2294
153 Ga0439463_014566 3300042016 Bacteria 1939
154 Ga0450911_002774 3300042115 Bacteria 3309
155 Ga0450911_002906 3300042115 Bacteria 3181
156 Ga0450911_003685 3300042115 Bacteria 2647
157 Ga0450919_000979 3300042121 Bacteria 3699
158 Ga0450919_002224 3300042121 Bacteria 2521
159 Ga0450920_001446 3300042122 Bacteria 3927
160 Ga0450922_000358 3300042124 Bacteria 4868
161 Ga0450922_000520 3300042124 Bacteria 4088
162 Ga0450922_000853 3300042124 Bacteria 3120
163 Ga0450923_001325 3300042125 Bacteria 3241
164 Ga0450890_000104 3300042127 Bacteria 14011
165 Ga0450891_001298 3300042129 Bacteria 2591
166 Ga0450892_001839 3300042130 Bacteria 1918
167 Ga0450902_000519 3300042137 Bacteria 4829
168 Ga0450902_001072 3300042137 Bacteria 3629
169 Ga0450902_001425 3300042137 Bacteria 3261
170 Ga0450902_001427 3300042137 Bacteria 3261
171 Ga0450902_004190 3300042137 Bacteria 2138
172 Ga0450902_009657 3300042137 Bacteria 1521
173 Ga0450902_014813 3300042137 Bacteria 1262
174 Ga0450903_000565 3300042138 Bacteria 7608
175 Ga0450903_001313 3300042138 Bacteria 4651
176 Ga0450903_021482 3300042138 Bacteria 997
177 Ga0450904_004202 3300042139 Bacteria 1505
178 Ga0450904_008364 3300042139 Bacteria 1022
179 Ga0450906_001613 3300042145 Bacteria 4944
180 Ga0450906_005979 3300042145 Bacteria 2477
181 Ga0450906_007434 3300042145 Bacteria 2164
182 Ga0450906_008669 3300042145 Bacteria 1959
183 Ga0450906_022785 3300042145 Bacteria 1116
184 Ga0450907_000578 3300042146 Bacteria 9859
185 Ga0450907_001527 3300042146 Bacteria 4943
186 Ga0450907_004240 3300042146 Bacteria 2481
187 Ga0450910_001328 3300042147 Bacteria 3097
188 Ga0450910_004222 3300042147 Bacteria 1936
189 Ga0439446_0007814 3300042156 Bacteria 2819
190 Ga0439446_0020818 3300042156 Bacteria 1850
191 Ga0450908_002105 3300042184 Bacteria 3898
192 Ga0450908_018533 3300042184 Bacteria 1230
193 Ga0450909_001852 3300042185 Bacteria 2975
194 Ga0450909_004190 3300042185 Bacteria 2055
195 Ga0450909_006126 3300042185 Bacteria 1735
196 Ga0439434_0022092 3300042435 Bacteria 1912
197 Ga0439464_0005810 3300042439 Bacteria 3199
198 Ga0439460_0000763 3300042461 Bacteria 7239
199 Ga0439460_0002799 3300042461 Bacteria 4200
200 Ga0439460_0004644 3300042461 Bacteria 3351
201 Ga0450918_004162 3300042531 Bacteria 2650
202 Ga0450918_019829 3300042531 Bacteria 1174
203 Ga0450893_0005219 3300042532 Bacteria 2080
204 Ga0450893_0011812 3300042532 Bacteria 1446
205 Ga0450893_0026729 3300042532 Bacteria 1015
206 Ga0450901_001105 3300042533 Bacteria 3127
207 Ga0439440_0004536 3300042993 Bacteria 2729
208 Ga0439440_0017587 3300042993 Bacteria 1575
209 Ga0495617_000430 3300046452 Bacteria 22663
210 Ga0495617_005440 3300046452 Bacteria 4513
211 Ga0495617_005641 3300046452 Bacteria 4425
212 Ga0495617_010603 3300046452 Bacteria 3156
213 Ga0495617_023622 3300046452 Bacteria 2077
214 Ga0495627_007660 3300046453 Bacteria 4121
215 Ga0495627_012270 3300046453 Bacteria 3047
216 Ga0495627_012564 3300046453 Bacteria 2999
217 Ga0495627_027677 3300046453 Bacteria 1817
218 Ga0495627_029908 3300046453 Bacteria 1729
219 Ga0495603_0031351 3300046455 Bacteria 3200
220 Ga0495603_0109540 3300046455 Bacteria 1611
221 Ga0495603_0240033 3300046455 Bacteria 1044
222 Ga0495590_0000854 3300046457 Bacteria 13735
223 Ga0495590_0005464 3300046457 Bacteria 5038
224 Ga0495590_0006441 3300046457 Bacteria 4581
225 Ga0495590_0009861 3300046457 Bacteria 3613
226 Ga0495590_0013768 3300046457 Bacteria 2967
227 Ga0495590_0016199 3300046457 Bacteria 2694
228 Ga0495590_0037428 3300046457 Bacteria 1692
229 Ga0495590_0072174 3300046457 Bacteria 1212
230 Ga0495591_000235 3300046458 Bacteria 53944
231 Ga0495591_007169 3300046458 Bacteria 4780
232 Ga0495591_010164 3300046458 Bacteria 3670
233 Ga0495591_013442 3300046458 Bacteria 2993
234 Ga0495591_013660 3300046458 Bacteria 2955
235 Ga0495591_014485 3300046458 Bacteria 2831
236 Ga0495591_031165 3300046458 Bacteria 1602
237 Ga0495629_0002904 3300046459 Bacteria 13071
238 Ga0495638_0000542 3300046460 Bacteria 43515
239 Ga0495638_0008163 3300046460 Bacteria 7443
240 Ga0495638_0020776 3300046460 Bacteria 4335
241 Ga0495638_0020909 3300046460 Bacteria 4320
242 Ga0495638_0029538 3300046460 Bacteria 3535
243 Ga0495638_0029786 3300046460 Bacteria 3519
244 Ga0495638_0032254 3300046460 Bacteria 3360
245 Ga0495638_0034218 3300046460 Bacteria 3244
246 Ga0495638_0036974 3300046460 Bacteria 3107
247 Ga0495638_0041533 3300046460 Bacteria 2909
248 Ga0495638_0046693 3300046460 Bacteria 2720
249 Ga0495638_0124048 3300046460 Bacteria 1523
250 Ga0495653_0057495 3300046463 Bacteria 2959
251 Ga0495653_0111056 3300046463 Bacteria 1969
252 Ga0495650_0005533 3300046471 Bacteria 8164
253 Ga0495650_0010480 3300046471 Bacteria 5166
254 Ga0495650_0013049 3300046471 Bacteria 4421
255 Ga0495650_0031921 3300046471 Bacteria 2362
256 Ga0495582_0007839 3300046473 Bacteria 5900
257 Ga0495605_0007968 3300046474 Bacteria 5996
258 Ga0495605_0010327 3300046474 Bacteria 5226
259 Ga0495605_0012330 3300046474 Bacteria 4744
260 Ga0495605_0013917 3300046474 Bacteria 4419
261 Ga0495605_0015900 3300046474 Bacteria 4084
262 Ga0495605_0041549 3300046474 Bacteria 2290
263 Ga0495605_0050283 3300046474 Bacteria 2034
264 Ga0495605_0065547 3300046474 Bacteria 1727
265 Ga0495605_0225574 3300046474 Bacteria 808
266 Ga0495639_0000045 3300046475 Bacteria 54350
267 Ga0495639_0015244 3300046475 Bacteria 3331
268 Ga0495639_0015692 3300046475 Bacteria 3285
269 Ga0495639_0100701 3300046475 Bacteria 1364
270 Ga0495584_0001817 3300046491 Bacteria 12388
271 Ga0495584_0005985 3300046491 Bacteria 6407
272 Ga0495584_0007628 3300046491 Bacteria 5640
273 Ga0495584_0009213 3300046491 Bacteria 5091
274 Ga0495584_0010871 3300046491 Bacteria 4671
275 Ga0495584_0012483 3300046491 Bacteria 4336
276 Ga0495584_0019667 3300046491 Bacteria 3430
277 Ga0495584_0027238 3300046491 Bacteria 2896
278 Ga0495584_0030502 3300046491 Bacteria 2730
279 Ga0495584_0094474 3300046491 Bacteria 1509
280 Ga0495584_0134969 3300046491 Bacteria 1252
281 Ga0495585_0007502 3300046492 Bacteria 6672
282 Ga0495585_0025783 3300046492 Bacteria 3362
283 Ga0495585_0028960 3300046492 Bacteria 3156
284 Ga0495585_0029622 3300046492 Bacteria 3115
285 Ga0495585_0033131 3300046492 Bacteria 2926
286 Ga0495585_0040359 3300046492 Bacteria 2621
287 Ga0495585_0055266 3300046492 Bacteria 2194
288 Ga0495594_0008649 3300046499 Bacteria 5246
289 Ga0495594_0015901 3300046499 Bacteria 3958
290 Ga0495596_0000585 3300046500 Bacteria 22744
291 Ga0495607_0000550 3300046501 Bacteria 36652
292 Ga0495607_0001968 3300046501 Bacteria 17330
293 Ga0495607_0002853 3300046501 Bacteria 13686
294 Ga0495607_0006561 3300046501 Bacteria 8179
295 Ga0495607_0017448 3300046501 Bacteria 4608
296 Ga0495607_0024443 3300046501 Bacteria 3767
297 Ga0495607_0037999 3300046501 Bacteria 2887
298 Ga0495607_0041230 3300046501 Bacteria 2743
299 Ga0495607_0052865 3300046501 Bacteria 2350
300 Ga0495607_0107331 3300046501 Bacteria 1485
301 Ga0495583_0002939 3300046506 Bacteria 13731
302 Ga0495583_0014209 3300046506 Bacteria 4403
303 Ga0495583_0024710 3300046506 Bacteria 3014
304 Ga0495583_0028040 3300046506 Bacteria 2773
305 Ga0495606_0013073 3300046507 Bacteria 6594
306 Ga0495606_0028014 3300046507 Bacteria 3981
307 Ga0495606_0028788 3300046507 Bacteria 3911
308 Ga0495606_0095560 3300046507 Bacteria 1819
309 Ga0495610_0001104 3300046512 Bacteria 24556
310 Ga0495610_0013660 3300046512 Bacteria 4815
311 Ga0495610_0017429 3300046512 Bacteria 4094
312 Ga0495610_0024062 3300046512 Bacteria 3293
313 Ga0495610_0025608 3300046512 Bacteria 3161
314 Ga0495610_0031221 3300046512 Bacteria 2781
315 Ga0495610_0100976 3300046512 Bacteria 1292
316 Ga0495616_0007653 3300046513 Bacteria 6461
317 Ga0495616_0010920 3300046513 Bacteria 5229
318 Ga0495616_0022425 3300046513 Bacteria 3410
319 Ga0495616_0026507 3300046513 Bacteria 3083
320 Ga0495616_0034442 3300046513 Bacteria 2630
321 Ga0495616_0054740 3300046513 Bacteria 1977
322 Ga0495616_0076324 3300046513 Bacteria 1611
323 Ga0495616_0111809 3300046513 Bacteria 1268
324 Ga0495616_0127290 3300046513 Bacteria 1170
325 Ga0495620_0000355 3300046515 Bacteria 31797
326 Ga0495620_0010052 3300046515 Bacteria 5002
327 Ga0495620_0011799 3300046515 Bacteria 4542
328 Ga0495620_0025470 3300046515 Bacteria 2797
329 Ga0495628_0187836 3300046516 Bacteria 1561
330 Ga0495630_0002068 3300046517 Bacteria 13950
331 Ga0495630_0016107 3300046517 Bacteria 5462
332 Ga0495630_0334461 3300046517 Bacteria 1158
333 Ga0495631_0001401 3300046518 Bacteria 14649
334 Ga0495631_0002497 3300046518 Bacteria 10351
335 Ga0495631_0018067 3300046518 Bacteria 3324
336 Ga0495631_0029229 3300046518 Bacteria 2508
337 Ga0495631_0043906 3300046518 Bacteria 1971
338 Ga0495632_0000408 3300046519 Bacteria 40601
339 Ga0495632_0000714 3300046519 Bacteria 30107
340 Ga0495632_0011678 3300046519 Bacteria 5114
341 Ga0495632_0013382 3300046519 Bacteria 4683
342 Ga0495632_0015435 3300046519 Bacteria 4281
343 Ga0495632_0028402 3300046519 Bacteria 2920
344 Ga0495632_0028503 3300046519 Bacteria 2913
345 Ga0495632_0045715 3300046519 Bacteria 2179
346 Ga0495632_0058233 3300046519 Bacteria 1884
347 Ga0495632_0075884 3300046519 Bacteria 1608
348 Ga0495637_0003145 3300046520 Bacteria 8809
349 Ga0495637_0005825 3300046520 Bacteria 6239
350 Ga0495637_0006488 3300046520 Bacteria 5867
351 Ga0495637_0006815 3300046520 Bacteria 5715
352 Ga0495637_0008682 3300046520 Bacteria 4984
353 Ga0495637_0013910 3300046520 Bacteria 3810
354 Ga0495637_0025420 3300046520 Bacteria 2668
355 Ga0495637_0067863 3300046520 Bacteria 1446
356 Ga0495643_0014949 3300046522 Bacteria 4602
357 Ga0495643_0016562 3300046522 Bacteria 4328
358 Ga0495643_0019000 3300046522 Bacteria 3979
359 Ga0495643_0031227 3300046522 Bacteria 2966
360 Ga0495643_0038393 3300046522 Bacteria 2623
361 Ga0495644_0002163 3300046523 Bacteria 7891
362 Ga0495644_0004922 3300046523 Bacteria 5242
363 Ga0495644_0006353 3300046523 Bacteria 4584
364 Ga0495644_0021624 3300046523 Bacteria 2453
365 Ga0495648_0000215 3300046524 Bacteria 66028
366 Ga0495648_0018018 3300046524 Bacteria 5022
367 Ga0495648_0021578 3300046524 Bacteria 4455
368 Ga0495648_0044933 3300046524 Bacteria 2752
369 Ga0495648_0046611 3300046524 Bacteria 2685
370 Ga0495648_0048822 3300046524 Bacteria 2601
371 Ga0495648_0059209 3300046524 Bacteria 2286
372 Ga0495648_0154744 3300046524 Bacteria 1192
373 Ga0495666_0004282 3300046526 Bacteria 7202
374 Ga0495642_0000120 3300046528 Bacteria 45031
375 Ga0495642_0006169 3300046528 Bacteria 4600
376 Ga0495652_0161368 3300046529 Bacteria 1740
377 Ga0495654_0000613 3300046530 Bacteria 28376
378 Ga0495654_0002395 3300046530 Bacteria 12099
379 Ga0495654_0010921 3300046530 Bacteria 4934
380 Ga0495654_0011977 3300046530 Bacteria 4676
381 Ga0495654_0012041 3300046530 Bacteria 4660
382 Ga0495654_0012669 3300046530 Bacteria 4526
383 Ga0495654_0017834 3300046530 Bacteria 3725
384 Ga0495654_0041007 3300046530 Bacteria 2304
385 Ga0495654_0051220 3300046530 Bacteria 2015
386 Ga0495654_0073486 3300046530 Bacteria 1617
387 Ga0495654_0075456 3300046530 Bacteria 1591
388 Ga0495654_0110253 3300046530 Bacteria 1256
389 Ga0495587_0011690 3300046536 Bacteria 5556
390 Ga0495587_0016824 3300046536 Bacteria 4547
391 Ga0495587_0064498 3300046536 Bacteria 2140
392 Ga0495609_0000505 3300046538 Bacteria 31398
393 Ga0495609_0030081 3300046538 Bacteria 2471
394 Ga0495609_0051423 3300046538 Bacteria 1834
395 Ga0495621_0149108 3300046539 Bacteria 919
396 Ga0495597_0008828 3300046542 Bacteria 5028
397 Ga0495597_0013885 3300046542 Bacteria 3850
398 Ga0495597_0015551 3300046542 Bacteria 3601
399 Ga0495597_0021231 3300046542 Bacteria 3020
400 Ga0495597_0025564 3300046542 Bacteria 2717
401 Ga0495597_0026539 3300046542 Bacteria 2660
402 Ga0495597_0059755 3300046542 Bacteria 1663
403 Ga0495622_0000876 3300046557 Bacteria 16456
404 Ga0495622_0005516 3300046557 Bacteria 5864
405 Ga0495622_0010183 3300046557 Bacteria 4346
406 Ga0495622_0031486 3300046557 Bacteria 2478
407 Ga0495622_0146262 3300046557 Bacteria 1071
408 Ga0495633_0012040 3300046558 Bacteria 4621
409 Ga0495633_0015483 3300046558 Bacteria 3956
410 Ga0495633_0015577 3300046558 Bacteria 3941
411 Ga0495656_0015776 3300046615 Bacteria 2857
412 Ga0495656_0112079 3300046615 Bacteria 1277
413 Ga0495668_0004367 3300046616 Bacteria 10085
414 Ga0495668_0009461 3300046616 Bacteria 5986
415 Ga0495668_0014472 3300046616 Bacteria 4625
416 Ga0495634_0000750 3300046642 Bacteria 31392
417 Ga0495611_0019939 3300046648 Bacteria 2883
418 Ga0495611_0023234 3300046648 Bacteria 2689
419 Ga0495625_0004955 3300046660 Bacteria 12375
420 Ga0495625_0005765 3300046660 Bacteria 11198
421 Ga0495625_0010920 3300046660 Bacteria 7461
422 Ga0495625_0020608 3300046660 Bacteria 5086
423 Ga0495625_0027791 3300046660 Bacteria 4251
424 Ga0495625_0045120 3300046660 Bacteria 3188
425 Ga0495625_0060975 3300046660 Bacteria 2670
426 Ga0495635_0000942 3300046663 Bacteria 19194
427 Ga0495659_0000458 3300046664 Bacteria 15217
428 Ga0495661_0012119 3300046665 Bacteria 5827
429 Ga0495661_0016434 3300046665 Bacteria 4905
430 Ga0495661_0019271 3300046665 Bacteria 4474
431 Ga0495661_0030194 3300046665 Bacteria 3453
432 Ga0495661_0048761 3300046665 Bacteria 2571
433 Ga0495661_0108433 3300046665 Bacteria 1551
434 Ga0495588_0007592 3300046674 Bacteria 4945
435 Ga0495588_0017359 3300046674 Bacteria 3493
436 Ga0495588_0019547 3300046674 Bacteria 3319
437 Ga0495588_0034870 3300046674 Bacteria 2547
438 Ga0495588_0265517 3300046674 Bacteria 904
439 Ga0495657_0175340 3300046675 Bacteria 1318
440 Ga0495599_0079708 3300046678 Bacteria 2045
441 Ga0495623_0001433 3300046679 Bacteria 16174
442 Ga0495623_0011510 3300046679 Bacteria 5725
443 Ga0495646_0018526 3300046680 Bacteria 4409
444 Ga0495669_0005347 3300046684 Bacteria 5350
445 Ga0495669_0017179 3300046684 Bacteria 3102
446 Ga0495613_0014277 3300046689 Bacteria 5894
447 Ga0495613_0190006 3300046689 Bacteria 1452
448 Ga0495670_0000480 3300046691 Bacteria 18930
449 Ga0495670_0005291 3300046691 Bacteria 6348
450 Ga0495670_0009743 3300046691 Bacteria 4721
451 Ga0495670_0025104 3300046691 Bacteria 2947
452 Ga0495670_0026074 3300046691 Bacteria 2893
453 Ga0495670_0027237 3300046691 Bacteria 2830
454 Ga0495670_0030898 3300046691 Bacteria 2661
455 Ga0495670_0040785 3300046691 Bacteria 2315
456 Ga0495670_0053138 3300046691 Bacteria 2029
457 Ga0495670_0066374 3300046691 Bacteria 1820
458 Ga0495670_0169187 3300046691 Bacteria 1150
459 Ga0495671_0003499 3300046692 Bacteria 9630
460 Ga0495671_0006847 3300046692 Bacteria 6550
461 Ga0495671_0010127 3300046692 Bacteria 5241
462 Ga0495671_0012495 3300046692 Bacteria 4634
463 Ga0495671_0013136 3300046692 Bacteria 4496
464 Ga0495671_0030514 3300046692 Bacteria 2761
465 Ga0495671_0030719 3300046692 Bacteria 2749
466 Ga0495671_0042153 3300046692 Bacteria 2295
467 Ga0495671_0085779 3300046692 Bacteria 1542
468 Ga0495649_0000280 3300046694 Bacteria 44939
469 Ga0495649_0007239 3300046694 Bacteria 6798
470 Ga0495649_0008364 3300046694 Bacteria 6226
471 Ga0495649_0012023 3300046694 Bacteria 5055
472 Ga0495649_0013126 3300046694 Bacteria 4788
473 Ga0495649_0016599 3300046694 Bacteria 4171
474 Ga0495649_0018964 3300046694 Bacteria 3864
475 Ga0495649_0021111 3300046694 Bacteria 3650
476 Ga0495649_0022002 3300046694 Bacteria 3570
477 Ga0495649_0029163 3300046694 Bacteria 3054
478 Ga0495649_0058510 3300046694 Bacteria 2076
479 Ga0495649_0113848 3300046694 Bacteria 1433
480 Ga0495649_0242845 3300046694 Bacteria 927
481 Ga0495589_0000425 3300046794 Bacteria 31317
482 Ga0495589_0001733 3300046794 Bacteria 12392
483 Ga0495589_0003427 3300046794 Bacteria 8582
484 Ga0495589_0008920 3300046794 Bacteria 5218
485 Ga0495589_0012166 3300046794 Bacteria 4461
486 Ga0495589_0013300 3300046794 Bacteria 4247
487 Ga0495589_0014349 3300046794 Bacteria 4081
488 Ga0495589_0022735 3300046794 Bacteria 3198
489 Ga0495600_0013936 3300046809 Bacteria 5066
490 Ga0495660_0015587 3300046810 Bacteria 4391
491 Ga0495660_0021851 3300046810 Bacteria 3659
492 Ga0495660_0022156 3300046810 Bacteria 3630
493 Ga0495660_0033083 3300046810 Bacteria 2901
494 Ga0495660_0035128 3300046810 Bacteria 2802
495 Ga0495660_0036978 3300046810 Bacteria 2721
496 Ga0495660_0037653 3300046810 Bacteria 2693
497 Ga0495660_0040787 3300046810 Bacteria 2572
498 Ga0495660_0064695 3300046810 Bacteria 1953
499 Ga0495581_0015228 3300047315 Bacteria 4464
500 Ga0495604_0035452 3300047317 Bacteria 3940
501 Ga0495604_0037501 3300047317 Bacteria 3816
502 Ga0495604_0113634 3300047317 Bacteria 1970
503 Ga0495636_0015264 3300047318 Bacteria 3061
504 Ga0495636_0034589 3300047318 Bacteria 2080
505 Ga0495674_0016688 3300047319 Bacteria 6851
506 Ga0495672_0001739 3300047320 Bacteria 21032
507 Ga0495672_0002678 3300047320 Bacteria 16033
508 Ga0495672_0006172 3300047320 Bacteria 9345
509 Ga0495672_0013191 3300047320 Bacteria 5712
510 Ga0495672_0017397 3300047320 Bacteria 4809
511 Ga0495672_0018306 3300047320 Bacteria 4655
512 Ga0495672_0018620 3300047320 Bacteria 4602
513 Ga0495672_0029635 3300047320 Bacteria 3443
514 Ga0495672_0041707 3300047320 Bacteria 2773
515 Ga0495672_0051916 3300047320 Bacteria 2412
516 Ga0495680_0000764 3300047322 Bacteria 36065
517 Ga0495680_0007264 3300047322 Bacteria 10194
518 Ga0495680_0019935 3300047322 Bacteria 5652
519 Ga0495680_0045066 3300047322 Bacteria 3484
520 Ga0495680_0053385 3300047322 Bacteria 3145
521 Ga0495683_0000452 3300047323 Bacteria 32302
522 Ga0495683_0010341 3300047323 Bacteria 4934
523 Ga0495683_0012611 3300047323 Bacteria 4438
524 Ga0495683_0014296 3300047323 Bacteria 4135
525 Ga0495683_0024888 3300047323 Bacteria 3070
526 Ga0495683_0026277 3300047323 Bacteria 2979
527 Ga0495683_0029404 3300047323 Bacteria 2808
528 Ga0495683_0032243 3300047323 Bacteria 2669
529 Ga0495683_0096811 3300047323 Bacteria 1423
530 Ga0495687_000721 3300047443 Bacteria 36612
531 Ga0495687_002191 3300047443 Bacteria 16254
532 Ga0495687_007933 3300047443 Bacteria 6167
533 Ga0495687_019375 3300047443 Bacteria 3342
534 Ga0495687_067062 3300047443 Bacteria 1454
535 Ga0495675_0020481 3300047444 Bacteria 4207
536 Ga0495675_0077808 3300047444 Bacteria 2089
537 Ga0495677_0002347 3300047445 Bacteria 7437
538 Ga0495679_012457 3300047446 Bacteria 3235
539 Ga0495679_021134 3300047446 Bacteria 2253
540 Ga0495673_0000759 3300047469 Bacteria 30614
541 Ga0495673_0001742 3300047469 Bacteria 16600
542 Ga0495673_0007448 3300047469 Bacteria 6291
543 Ga0495673_0010842 3300047469 Bacteria 4932
544 Ga0495673_0015204 3300047469 Bacteria 3973
545 Ga0495673_0015272 3300047469 Bacteria 3959
546 Ga0495673_0023022 3300047469 Bacteria 3040
547 Ga0495673_0035184 3300047469 Bacteria 2310
548 Ga0495673_0037984 3300047469 Bacteria 2194
549 Ga0495673_0087786 3300047469 Bacteria 1275
550 Ga0495681_0000171 3300047470 Bacteria 54448
551 Ga0495681_0000457 3300047470 Bacteria 31283
552 Ga0495681_0001277 3300047470 Bacteria 19065
553 Ga0495681_0005638 3300047470 Bacteria 8343
554 Ga0495681_0008626 3300047470 Bacteria 6364
555 Ga0495681_0012609 3300047470 Bacteria 4955
556 Ga0495681_0016125 3300047470 Bacteria 4203
557 Ga0495681_0017070 3300047470 Bacteria 4044
558 Ga0495681_0020034 3300047470 Bacteria 3636
559 Ga0495684_0009073 3300047471 Bacteria 7681
560 Ga0495686_0024191 3300047472 Bacteria 3994
561 Ga0495686_0037421 3300047472 Bacteria 3108
562 Ga0495686_0056497 3300047472 Bacteria 2452
563 Ga0495593_0018468 3300047673 Bacteria 3917
564 Ga0495593_0027420 3300047673 Bacteria 3136
565 Ga0495593_0032461 3300047673 Bacteria 2846
566 Ga0495593_0037719 3300047673 Bacteria 2612
567 Ga0495593_0054670 3300047673 Bacteria 2103
568 Ga0495593_0157362 3300047673 Bacteria 1148
569 Ga0495602_0141205 3300048088 Bacteria 1906
570 Ga0495626_0000710 3300048091 Bacteria 31405
571 Ga0495626_0000732 3300048091 Bacteria 30608
572 Ga0495626_0000908 3300048091 Bacteria 26124
573 Ga0495626_0001975 3300048091 Bacteria 15179
574 Ga0495626_0012466 3300048091 Bacteria 4455
575 Ga0495626_0013066 3300048091 Bacteria 4327
576 Ga0495626_0020296 3300048091 Bacteria 3313
577 Ga0495626_0036608 3300048091 Bacteria 2337
578 Ga0496102_0000419 3300048905 Bacteria 48952
579 Ga0496103_0011055 3300048906 Bacteria 5344
580 Ga0496105_0074287 3300048908 Bacteria 2808
581 Ga0496106_0045216 3300048909 Bacteria 3307
582 Ga0496110_0084781 3300048913 Bacteria 2828
583 Ga0496116_0022939 3300048919 Bacteria 4659
584 Ga0496116_0034472 3300048919 Bacteria 3570
585 Ga0496117_0008362 3300048920 Bacteria 9842
586 Ga0496117_0034509 3300048920 Bacteria 3810
587 Ga0496117_0068247 3300048920 Bacteria 2401
588 Ga0496117_0192005 3300048920 Bacteria 1162
589 Ga0496118_0004826 3300048921 Bacteria 15721
590 Ga0496118_0039029 3300048921 Bacteria 3796
591 Ga0496118_0055522 3300048921 Bacteria 2988
592 Ga0496119_0107691 3300048922 Bacteria 1553
593 Ga0496121_0012192 3300048924 Bacteria 9423
594 Ga0496121_0052807 3300048924 Bacteria 3409
595 Ga0496121_0061801 3300048924 Bacteria 3071
596 Ga0496121_0137333 3300048924 Bacteria 1819
597 Ga0496122_0006201 3300048925 Bacteria 13867
598 Ga0496123_0039358 3300048926 Bacteria 3308
599 Ga0496124_0016866 3300048927 Bacteria 6921
600 Ga0496124_0018162 3300048927 Bacteria 6599
601 Ga0496124_0060843 3300048927 Bacteria 3167
602 Ga0496124_0061722 3300048927 Bacteria 3140
603 Ga0496125_0019672 3300048928 Bacteria 6357
604 Ga0496125_0081789 3300048928 Bacteria 2466
605 Ga0495678_007764 3300049459 Bacteria 5525
606 Ga0495678_008135 3300049459 Bacteria 5339
607 Ga0495678_008865 3300049459 Bacteria 5030
608 Ga0495678_010313 3300049459 Bacteria 4549
609 Ga0495678_018378 3300049459 Bacteria 3145
610 Ga0495678_037516 3300049459 Bacteria 1968
611 Ga0495678_044130 3300049459 Bacteria 1765
612 Ga0495682_0005583 3300049460 Bacteria 5205
613 Ga0495682_0006522 3300049460 Bacteria 4714
614 Ga0495682_0010333 3300049460 Bacteria 3619
615 Ga0495682_0041253 3300049460 Bacteria 1692
616 Ga0495682_0044704 3300049460 Bacteria 1620
617 Ga0495682_0048604 3300049460 Bacteria 1546
618 Ga0495682_0066356 3300049460 Bacteria 1301
619 Ga0495682_0131662 3300049460 Bacteria 894
620 Ga0501222_001080 3300049662 Bacteria 3869
621 Ga0501227_003528 3300049665 Bacteria 3391
622 Ga0501226_001182 3300049853 Bacteria 3385
623 nmdc:mga03683_50648_c1 3300050489 Bacteria 1731
624 nmdc:mga03683_94429_c1 3300050489 Bacteria 1308
625 nmdc:mga00v17_220589_c1 3300050491 Bacteria 1228
626 nmdc:mga00v17_225477_c1 3300050491 Bacteria 1214
627 nmdc:mga00v17_30743_c1 3300050491 Bacteria 3161
628 nmdc:mga00v17_38832_c1 3300050491 Bacteria 2849
629 nmdc:mga00v17_65374_c1 3300050491 Bacteria 2244
630 nmdc:mga08x19_106709_c1 3300050514 Bacteria 1864
631 nmdc:mga08x19_59465_c1 3300050514 Bacteria 2474
632 nmdc:mga08x19_92985_c1 3300050514 Bacteria 1993
633 nmdc:mga0sz30_87875_c1 3300050516 Bacteria 1350
634 2511258257 2511231004 Bacteria 6669789
635 2511271342 2511231007 Bacteria 6306603
636 2511279442 2511231008 Bacteria 6624100
637 2511299880 2511231012 Bacteria 6738011
638 2511316252 2511231014 Bacteria 6462302
639 2511317894 2511231015 Bacteria 6598026
640 2511327290 2511231016 Bacteria 6704427
641 2511330800 2511231017 Bacteria 6503007
642 2511339533 2511231018 Bacteria 6436256
643 2511343632 2511231019 Bacteria 6520662
644 2511353138 2511231020 Bacteria 6115223
645 2511356302 2511231021 Bacteria 7302637
646 2511361578 2511231022 Bacteria 6719296
647 2511822653 2511231156 Bacteria 6845832
648 2599499913 2599185188 Bacteria 6164180
649 2599616421 2599185212 Bacteria 6765997
650 2599769619 2599185248 Bacteria 6696816
651 2599887038 2599185289 Bacteria 6778765
652 2599898367 2599185291 Bacteria 6775623
653 2599931098 2599185300 Bacteria 6062622
654 2599944522 2599185302 Bacteria 5954930
655 2599956135 2599185304 Bacteria 5951361
656 2599961139 2599185305 Bacteria 6748700
657 2599964756 2599185306 Bacteria 6637356
658 2599977313 2599185308 Bacteria 6621546
659 2599983099 2599185309 Bacteria 5969593
660 2599991032 2599185310 Bacteria 6014457
661 2599996803 2599185311 Bacteria 6354990
662 2600001096 2599185312 Bacteria 5912071
663 2600006976 2599185313 Bacteria 6658188
664 2600011481 2599185314 Bacteria 6621749
665 2600019285 2599185315 Bacteria 6771107
666 2600025081 2599185316 Bacteria 6320029
667 2600031392 2599185317 Bacteria 6435722
668 2600036911 2599185318 Bacteria 6961590
669 2600043193 2599185319 Bacteria 6637840
670 2600048102 2599185320 Bacteria 5963263
671 2600054370 2599185321 Bacteria 6764560
672 2600062560 2599185322 Bacteria 6763055
673 2600066622 2599185323 Bacteria 6688755
674 2600073972 2599185324 Bacteria 6590677
675 2600078346 2599185325 Bacteria 6324919
676 2600361110 2600254930 Bacteria 6431253
677 2624489975 2623620446 Bacteria 6500345
678 2643954697 2643221589 Bacteria 6250934
679 2644024337 2643221602 Bacteria 6249926
680 2644190030 2643221633 Bacteria 6733554
681 2644281475 2643221650 Bacteria 7029547
682 2671090593 2667528170 Bacteria 6786960
683 2671129138 2667528176 Bacteria 6724917
684 2678261202 2675903515 Bacteria 6580491
685 2739202177 2738543004 Bacteria 6381073
686 2739259854 2738543015 Bacteria 6750701
687 2745006513 2744054620 Bacteria 6551379
688 2794594231 2791355520 Bacteria 5948615
689 2808858315 2808606361 Bacteria 6136259
690 2808922539 2808606376 Bacteria 6248667
691 2808933049 2808606377 Bacteria 6646337
692 2808938418 2808606378 Bacteria 6177535
693 2808944226 2808606380 Bacteria 6248705
694 2808955212 2808606381 Bacteria 6646461
695 2808956078 2808606382 Bacteria 6841132
696 2808966800 2808606383 Bacteria 6138645
697 2809001600 2808606389 Bacteria 6138126
698 2825654063 2825651385 Bacteria 6715909
699 2842859753 2842854478 Bacteria 6143501
700 2860343431 2860339153 Bacteria 6846989
701 2904554010 2904550169 Bacteria 6221258
702 2913037486 2913036834 Bacteria 6704877
703 2919460196 2919456309 Bacteria 6586567
704 2919486626 2919481497 Bacteria 6907839
705 2919698744 2919697872 Bacteria 6553725
706 2923591720 2923586266 Bacteria 6565975
707 2929145023 2929144301 Bacteria 6622272
708 2931371645 2931369376 Bacteria 6847892
709 2931399050 2931396565 Bacteria 7251677
710 2939641316 2939636861 Bacteria 6297853
711 2988732409 2988728565 Bacteria 6124362
712 3007518128 3007511990 Bacteria 6481491
713 3007620044 3007619802 Bacteria 6411688
714 3007867237 3007866637 Bacteria 5899198
715 8019777552 8019775933 Bacteria 6858656
716 8056126678 8056125926 Bacteria 6228218
717 8056143951 8056143049 Bacteria 6307666
718 8056158720 8056155041 Bacteria 6486948
719 Ga0075369_10136765
720 SwRhRL2b_contig_3194184
721 Ga0055530_10001838
722 Ga0055530_10026932
723 Ga0055540_1001362
724 Ga0065714_10002005
725 Ga0065714_10005368
726 Ga0065714_10007672
727 Ga0065714_10011034
728 Ga0065714_10011564
729 Ga0065714_10064979
730 Ga0065714_10079610
731 Ga0065704_10001021
732 Ga0075364_10167557
733 Ga0075364_10230886
734 Ga0075432_10001366
735 Ga0075432_10003694
736 Ga0075432_10010321
737 Ga0075432_10014915
738 Ga0075432_10015887
739 Ga0075432_10033532
740 Ga0075362_10058410
741 Ga0075362_10098996
742 Ga0075436_100232292
743 Ga0075436_100400957
744 Ga0079104_1001511
745 Ga0105251_10002261
746 Ga0105251_10054248
747 Ga0105244_10006998
748 Ga0105244_10017572
749 Ga0105244_10032240
750 Ga0105250_10020766
751 Ga0105243_10078681
752 Ga0157373_10000305
753 Ga0157371_10013194
754 Ga0157370_10006519
755 Ga0157370_10103131
756 Ga0163162_10047369
757 Ga0182008_10002414
758 Ga0182008_10010237
759 Ga0182008_10011391
760 Ga0182008_10021669
761 Ga0182008_10031510
762 Ga0182006_1001458
763 Ga0182006_1009293
764 Ga0182006_1016725
765 Ga0182007_10001167
766 Ga0182007_10013030
767 Ga0182005_1004421
768 Ga0182005_1004721
769 Ga0163161_10035615
770 Ga0163161_10062171
771 Ga0209676_1006448
772 Ga0209050_1001481
773 Ga0209050_1001681
774 Ga0209051_1000206
775 Ga0209051_1015152
776 Ga0209257_1005409
777 Ga0207655_1002956
778 Ga0207655_1022910
779 Ga0207713_1006219
780 Ga0207713_1007610
781 Ga0207709_10016458
782 Ga0209281_1000159
783 Ga0207428_10026542
784 Ga0207428_10033443
785 Ga0207428_10034344
786 Ga0207428_10039559
787 Ga0207428_10106248
788 Ga0207428_10135130
789 Ga0316183_1102575
790 Ga0316183_1190590
791 Ga0307408_100022246
792 Ga0307408_100022901
793 Ga0307408_100053410
794 Ga0307408_100270622
795 Ga0307516_10380083
796 Ga0307405_10000313
797 Ga0307405_10001799
798 Ga0307413_10548169
799 Ga0307406_10112998
800 Ga0307407_10157593
801 Ga0307412_10001254
802 Ga0307412_10002113
803 Ga0307412_10095059
804 Ga0307412_10131819
805 Ga0307411_10263356
806 Ga0439438_000803
807 Ga0439438_000848
808 Ga0439438_000939
809 Ga0439438_003074
810 Ga0439438_006057
811 Ga0439438_006423
812 Ga0439447_000296
813 Ga0439447_001226
814 Ga0439447_003793
815 Ga0439447_004211
816 Ga0439447_004519
817 Ga0439447_004783
818 Ga0439447_005320
819 Ga0439447_009080
820 Ga0439466_0006201
821 Ga0439466_0007405
822 Ga0439466_0007873
823 Ga0439466_0009075
824 Ga0439466_0010923
825 Ga0439466_0012001
826 Ga0439466_0012889
827 Ga0439466_0014436
828 Ga0439466_0025406
829 Ga0439466_0098070
830 Ga0439465_0048395
831 Ga0439431_0002968
832 Ga0439445_0004749
833 Ga0439445_0016048
834 Ga0439432_001735
835 Ga0439432_002405
836 Ga0439432_005352
837 Ga0439432_013167
838 Ga0439432_014300
839 Ga0439432_032315
840 Ga0439451_003107
841 Ga0439451_003771
842 Ga0439451_003859
843 Ga0439451_004782
844 Ga0439451_007184
845 Ga0439451_007791
846 Ga0439451_011787
847 Ga0439451_018895
848 Ga0439452_000951
849 Ga0439452_003900
850 Ga0439452_004261
851 Ga0439452_005203
852 Ga0439452_005724
853 Ga0439452_006695
854 Ga0439452_007812
855 Ga0439452_010306
856 Ga0439452_014232
857 Ga0439452_027326
858 Ga0439452_029260
859 Ga0439456_001921
860 Ga0439456_004329
861 Ga0439456_006446
862 Ga0439456_007069
863 Ga0439456_012111
864 Ga0439456_022392
865 Ga0439456_023476
866 Ga0439456_029640
867 Ga0439463_006380
868 Ga0439463_007339
869 Ga0439463_008313
870 Ga0439463_010336
871 Ga0439463_014566
872 Ga0450911_002774
873 Ga0450911_002906
874 Ga0450911_003685
875 Ga0450919_000979
876 Ga0450919_002224
877 Ga0450920_001446
878 Ga0450922_000358
879 Ga0450922_000520
880 Ga0450922_000853
881 Ga0450923_001325
882 Ga0450890_000104
883 Ga0450891_001298
884 Ga0450892_001839
885 Ga0450902_000519
886 Ga0450902_001072
887 Ga0450902_001425
888 Ga0450902_001427
889 Ga0450902_004190
890 Ga0450902_009657
891 Ga0450902_014813
892 Ga0450903_000565
893 Ga0450903_001313
894 Ga0450903_021482
895 Ga0450904_004202
896 Ga0450904_008364
897 Ga0450906_001613
898 Ga0450906_005979
899 Ga0450906_007434
900 Ga0450906_008669
901 Ga0450906_022785
902 Ga0450907_000578
903 Ga0450907_001527
904 Ga0450907_004240
905 Ga0450910_001328
906 Ga0450910_004222
907 Ga0439446_0007814
908 Ga0439446_0020818
909 Ga0450908_002105
910 Ga0450908_018533
911 Ga0450909_001852
912 Ga0450909_004190
913 Ga0450909_006126
914 Ga0439434_0022092
915 Ga0439464_0005810
916 Ga0439460_0000763
917 Ga0439460_0002799
918 Ga0439460_0004644
919 Ga0450918_004162
920 Ga0450918_019829
921 Ga0450893_0005219
922 Ga0450893_0011812
923 Ga0450893_0026729
924 Ga0450901_001105
925 Ga0439440_0004536
926 Ga0439440_0017587
927 Ga0495617_000430
928 Ga0495617_005440
929 Ga0495617_005641
930 Ga0495617_010603
931 Ga0495617_023622
932 Ga0495627_007660
933 Ga0495627_012270
934 Ga0495627_012564
935 Ga0495627_027677
936 Ga0495627_029908
937 Ga0495603_0031351
938 Ga0495603_0109540
939 Ga0495603_0240033
940 Ga0495590_0000854
941 Ga0495590_0005464
942 Ga0495590_0006441
943 Ga0495590_0009861
944 Ga0495590_0013768
945 Ga0495590_0016199
946 Ga0495590_0037428
947 Ga0495590_0072174
948 Ga0495591_000235
949 Ga0495591_007169
950 Ga0495591_010164
951 Ga0495591_013442
952 Ga0495591_013660
953 Ga0495591_014485
954 Ga0495591_031165
955 Ga0495629_0002904
956 Ga0495638_0000542
957 Ga0495638_0008163
958 Ga0495638_0020776
959 Ga0495638_0020909
960 Ga0495638_0029538
961 Ga0495638_0029786
962 Ga0495638_0032254
963 Ga0495638_0034218
964 Ga0495638_0036974
965 Ga0495638_0041533
966 Ga0495638_0046693
967 Ga0495638_0124048
968 Ga0495653_0057495
969 Ga0495653_0111056
970 Ga0495650_0005533
971 Ga0495650_0010480
972 Ga0495650_0013049
973 Ga0495650_0031921
974 Ga0495582_0007839
975 Ga0495605_0007968
976 Ga0495605_0010327
977 Ga0495605_0012330
978 Ga0495605_0013917
979 Ga0495605_0015900
980 Ga0495605_0041549
981 Ga0495605_0050283
982 Ga0495605_0065547
983 Ga0495605_0225574
984 Ga0495639_0000045
985 Ga0495639_0015244
986 Ga0495639_0015692
987 Ga0495639_0100701
988 Ga0495584_0001817
989 Ga0495584_0005985
990 Ga0495584_0007628
991 Ga0495584_0009213
992 Ga0495584_0010871
993 Ga0495584_0012483
994 Ga0495584_0019667
995 Ga0495584_0027238
996 Ga0495584_0030502
997 Ga0495584_0094474
998 Ga0495584_0134969
999 Ga0495585_0007502
1000 Ga0495585_0025783
1001 Ga0495585_0028960
1002 Ga0495585_0029622
1003 Ga0495585_0033131
1004 Ga0495585_0040359
1005 Ga0495585_0055266
1006 Ga0495594_0008649
1007 Ga0495594_0015901
1008 Ga0495596_0000585
1009 Ga0495607_0000550
1010 Ga0495607_0001968
1011 Ga0495607_0002853
1012 Ga0495607_0006561
1013 Ga0495607_0017448
1014 Ga0495607_0024443
1015 Ga0495607_0037999
1016 Ga0495607_0041230
1017 Ga0495607_0052865
1018 Ga0495607_0107331
1019 Ga0495583_0002939
1020 Ga0495583_0014209
1021 Ga0495583_0024710
1022 Ga0495583_0028040
1023 Ga0495606_0013073
1024 Ga0495606_0028014
1025 Ga0495606_0028788
1026 Ga0495606_0095560
1027 Ga0495610_0001104
1028 Ga0495610_0013660
1029 Ga0495610_0017429
1030 Ga0495610_0024062
1031 Ga0495610_0025608
1032 Ga0495610_0031221
1033 Ga0495610_0100976
1034 Ga0495616_0007653
1035 Ga0495616_0010920
1036 Ga0495616_0022425
1037 Ga0495616_0026507
1038 Ga0495616_0034442
1039 Ga0495616_0054740
1040 Ga0495616_0076324
1041 Ga0495616_0111809
1042 Ga0495616_0127290
1043 Ga0495620_0000355
1044 Ga0495620_0010052
1045 Ga0495620_0011799
1046 Ga0495620_0025470
1047 Ga0495628_0187836
1048 Ga0495630_0002068
1049 Ga0495630_0016107
1050 Ga0495630_0334461
1051 Ga0495631_0001401
1052 Ga0495631_0002497
1053 Ga0495631_0018067
1054 Ga0495631_0029229
1055 Ga0495631_0043906
1056 Ga0495632_0000408
1057 Ga0495632_0000714
1058 Ga0495632_0011678
1059 Ga0495632_0013382
1060 Ga0495632_0015435
1061 Ga0495632_0028402
1062 Ga0495632_0028503
1063 Ga0495632_0045715
1064 Ga0495632_0058233
1065 Ga0495632_0075884
1066 Ga0495637_0003145
1067 Ga0495637_0005825
1068 Ga0495637_0006488
1069 Ga0495637_0006815
1070 Ga0495637_0008682
1071 Ga0495637_0013910
1072 Ga0495637_0025420
1073 Ga0495637_0067863
1074 Ga0495643_0014949
1075 Ga0495643_0016562
1076 Ga0495643_0019000
1077 Ga0495643_0031227
1078 Ga0495643_0038393
1079 Ga0495644_0002163
1080 Ga0495644_0004922
1081 Ga0495644_0006353
1082 Ga0495644_0021624
1083 Ga0495648_0000215
1084 Ga0495648_0018018
1085 Ga0495648_0021578
1086 Ga0495648_0044933
1087 Ga0495648_0046611
1088 Ga0495648_0048822
1089 Ga0495648_0059209
1090 Ga0495648_0154744
1091 Ga0495666_0004282
1092 Ga0495642_0000120
1093 Ga0495642_0006169
1094 Ga0495652_0161368
1095 Ga0495654_0000613
1096 Ga0495654_0002395
1097 Ga0495654_0010921
1098 Ga0495654_0011977
1099 Ga0495654_0012041
1100 Ga0495654_0012669
1101 Ga0495654_0017834
1102 Ga0495654_0041007
1103 Ga0495654_0051220
1104 Ga0495654_0073486
1105 Ga0495654_0075456
1106 Ga0495654_0110253
1107 Ga0495587_0011690
1108 Ga0495587_0016824
1109 Ga0495587_0064498
1110 Ga0495609_0000505
1111 Ga0495609_0030081
1112 Ga0495609_0051423
1113 Ga0495621_0149108
1114 Ga0495597_0008828
1115 Ga0495597_0013885
1116 Ga0495597_0015551
1117 Ga0495597_0021231
1118 Ga0495597_0025564
1119 Ga0495597_0026539
1120 Ga0495597_0059755
1121 Ga0495622_0000876
1122 Ga0495622_0005516
1123 Ga0495622_0010183
1124 Ga0495622_0031486
1125 Ga0495622_0146262
1126 Ga0495633_0012040
1127 Ga0495633_0015483
1128 Ga0495633_0015577
1129 Ga0495656_0015776
1130 Ga0495656_0112079
1131 Ga0495668_0004367
1132 Ga0495668_0009461
1133 Ga0495668_0014472
1134 Ga0495634_0000750
1135 Ga0495611_0019939
1136 Ga0495611_0023234
1137 Ga0495625_0004955
1138 Ga0495625_0005765
1139 Ga0495625_0010920
1140 Ga0495625_0020608
1141 Ga0495625_0027791
1142 Ga0495625_0045120
1143 Ga0495625_0060975
1144 Ga0495635_0000942
1145 Ga0495659_0000458
1146 Ga0495661_0012119
1147 Ga0495661_0016434
1148 Ga0495661_0019271
1149 Ga0495661_0030194
1150 Ga0495661_0048761
1151 Ga0495661_0108433
1152 Ga0495588_0007592
1153 Ga0495588_0017359
1154 Ga0495588_0019547
1155 Ga0495588_0034870
1156 Ga0495588_0265517
1157 Ga0495657_0175340
1158 Ga0495599_0079708
1159 Ga0495623_0001433
1160 Ga0495623_0011510
1161 Ga0495646_0018526
1162 Ga0495669_0005347
1163 Ga0495669_0017179
1164 Ga0495613_0014277
1165 Ga0495613_0190006
1166 Ga0495670_0000480
1167 Ga0495670_0005291
1168 Ga0495670_0009743
1169 Ga0495670_0025104
1170 Ga0495670_0026074
1171 Ga0495670_0027237
1172 Ga0495670_0030898
1173 Ga0495670_0040785
1174 Ga0495670_0053138
1175 Ga0495670_0066374
1176 Ga0495670_0169187
1177 Ga0495671_0003499
1178 Ga0495671_0006847
1179 Ga0495671_0010127
1180 Ga0495671_0012495
1181 Ga0495671_0013136
1182 Ga0495671_0030514
1183 Ga0495671_0030719
1184 Ga0495671_0042153
1185 Ga0495671_0085779
1186 Ga0495649_0000280
1187 Ga0495649_0007239
1188 Ga0495649_0008364
1189 Ga0495649_0012023
1190 Ga0495649_0013126
1191 Ga0495649_0016599
1192 Ga0495649_0018964
1193 Ga0495649_0021111
1194 Ga0495649_0022002
1195 Ga0495649_0029163
1196 Ga0495649_0058510
1197 Ga0495649_0113848
1198 Ga0495649_0242845
1199 Ga0495589_0000425
1200 Ga0495589_0001733
1201 Ga0495589_0003427
1202 Ga0495589_0008920
1203 Ga0495589_0012166
1204 Ga0495589_0013300
1205 Ga0495589_0014349
1206 Ga0495589_0022735
1207 Ga0495600_0013936
1208 Ga0495660_0015587
1209 Ga0495660_0021851
1210 Ga0495660_0022156
1211 Ga0495660_0033083
1212 Ga0495660_0035128
1213 Ga0495660_0036978
1214 Ga0495660_0037653
1215 Ga0495660_0040787
1216 Ga0495660_0064695
1217 Ga0495581_0015228
1218 Ga0495604_0035452
1219 Ga0495604_0037501
1220 Ga0495604_0113634
1221 Ga0495636_0015264
1222 Ga0495636_0034589
1223 Ga0495674_0016688
1224 Ga0495672_0001739
1225 Ga0495672_0002678
1226 Ga0495672_0006172
1227 Ga0495672_0013191
1228 Ga0495672_0017397
1229 Ga0495672_0018306
1230 Ga0495672_0018620
1231 Ga0495672_0029635
1232 Ga0495672_0041707
1233 Ga0495672_0051916
1234 Ga0495680_0000764
1235 Ga0495680_0007264
1236 Ga0495680_0019935
1237 Ga0495680_0045066
1238 Ga0495680_0053385
1239 Ga0495683_0000452
1240 Ga0495683_0010341
1241 Ga0495683_0012611
1242 Ga0495683_0014296
1243 Ga0495683_0024888
1244 Ga0495683_0026277
1245 Ga0495683_0029404
1246 Ga0495683_0032243
1247 Ga0495683_0096811
1248 Ga0495687_000721
1249 Ga0495687_002191
1250 Ga0495687_007933
1251 Ga0495687_019375
1252 Ga0495687_067062
1253 Ga0495675_0020481
1254 Ga0495675_0077808
1255 Ga0495677_0002347
1256 Ga0495679_012457
1257 Ga0495679_021134
1258 Ga0495673_0000759
1259 Ga0495673_0001742
1260 Ga0495673_0007448
1261 Ga0495673_0010842
1262 Ga0495673_0015204
1263 Ga0495673_0015272
1264 Ga0495673_0023022
1265 Ga0495673_0035184
1266 Ga0495673_0037984
1267 Ga0495673_0087786
1268 Ga0495681_0000171
1269 Ga0495681_0000457
1270 Ga0495681_0001277
1271 Ga0495681_0005638
1272 Ga0495681_0008626
1273 Ga0495681_0012609
1274 Ga0495681_0016125
1275 Ga0495681_0017070
1276 Ga0495681_0020034
1277 Ga0495684_0009073
1278 Ga0495686_0024191
1279 Ga0495686_0037421
1280 Ga0495686_0056497
1281 Ga0495593_0018468
1282 Ga0495593_0027420
1283 Ga0495593_0032461
1284 Ga0495593_0037719
1285 Ga0495593_0054670
1286 Ga0495593_0157362
1287 Ga0495602_0141205
1288 Ga0495626_0000710
1289 Ga0495626_0000732
1290 Ga0495626_0000908
1291 Ga0495626_0001975
1292 Ga0495626_0012466
1293 Ga0495626_0013066
1294 Ga0495626_0020296
1295 Ga0495626_0036608
1296 Ga0496102_0000419
1297 Ga0496103_0011055
1298 Ga0496105_0074287
1299 Ga0496106_0045216
1300 Ga0496110_0084781
1301 Ga0496116_0022939
1302 Ga0496116_0034472
1303 Ga0496117_0008362
1304 Ga0496117_0034509
1305 Ga0496117_0068247
1306 Ga0496117_0192005
1307 Ga0496118_0004826
1308 Ga0496118_0039029
1309 Ga0496118_0055522
1310 Ga0496119_0107691
1311 Ga0496121_0012192
1312 Ga0496121_0052807
1313 Ga0496121_0061801
1314 Ga0496121_0137333
1315 Ga0496122_0006201
1316 Ga0496123_0039358
1317 Ga0496124_0016866
1318 Ga0496124_0018162
1319 Ga0496124_0060843
1320 Ga0496124_0061722
1321 Ga0496125_0019672
1322 Ga0496125_0081789
1323 Ga0495678_007764
1324 Ga0495678_008135
1325 Ga0495678_008865
1326 Ga0495678_010313
1327 Ga0495678_018378
1328 Ga0495678_037516
1329 Ga0495678_044130
1330 Ga0495682_0005583
1331 Ga0495682_0006522
1332 Ga0495682_0010333
1333 Ga0495682_0041253
1334 Ga0495682_0044704
1335 Ga0495682_0048604
1336 Ga0495682_0066356
1337 Ga0495682_0131662
1338 Ga0501222_001080
1339 Ga0501227_003528
1340 Ga0501226_001182
1341 nmdc:mga03683_50648_c1
1342 nmdc:mga03683_94429_c1
1343 nmdc:mga00v17_220589_c1
1344 nmdc:mga00v17_225477_c1
1345 nmdc:mga00v17_30743_c1
1346 nmdc:mga00v17_38832_c1
1347 nmdc:mga00v17_65374_c1
1348 nmdc:mga08x19_106709_c1
1349 nmdc:mga08x19_59465_c1
1350 nmdc:mga08x19_92985_c1
1351 nmdc:mga0sz30_87875_c1
1352 2511258257
1353 2511271342
1354 2511279442
1355 2511299880
1356 2511316252
1357 2511317894
1358 2511327290
1359 2511330800
1360 2511339533
1361 2511343632
1362 2511353138
1363 2511356302
1364 2511361578
1365 2511822653
1366 2599499913
1367 2599616421
1368 2599769619
1369 2599887038
1370 2599898367
1371 2599931098
1372 2599944522
1373 2599956135
1374 2599961139
1375 2599964756
1376 2599977313
1377 2599983099
1378 2599991032
1379 2599996803
1380 2600001096
1381 2600006976
1382 2600011481
1383 2600019285
1384 2600025081
1385 2600031392
1386 2600036911
1387 2600043193
1388 2600048102
1389 2600054370
1390 2600062560
1391 2600066622
1392 2600073972
1393 2600078346
1394 2600361110
1395 2624489975
1396 2643954697
1397 2644024337
1398 2644190030
1399 2644281475
1400 2671090593
1401 2671129138
1402 2678261202
1403 2739202177
1404 2739259854
1405 2745006513
1406 2794594231
1407 2808858315
1408 2808922539
1409 2808933049
1410 2808938418
1411 2808944226
1412 2808955212
1413 2808956078
1414 2808966800
1415 2809001600
1416 2825654063
1417 2842859753
1418 2860343431
1419 2904554010
1420 2913037486
1421 2919460196
1422 2919486626
1423 2919698744
1424 2923591720
1425 2929145023
1426 2931371645
1427 2931399050
1428 2939641316
1429 2988732409
1430 3007518128
1431 3007620044
1432 3007867237
1433 8019777552
1434 8056126678
1435 8056143951
1436 8056158720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13503

DUF4123

Domain of unknown function (DUF4123)

54

173

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hfv-assembly1.cif.gz_A solution nmr structure of protein rpa1041 from pseudomonas aeruginosa. northeast structural genomics consortium target pat90. 0.4173 1 72
8ia0-assembly1.cif.gz_LR cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 0.3571 148 263
2hfv-assembly1.cif.gz_A solution nmr structure of protein rpa1041 from pseudomonas aeruginosa. northeast structural genomics consortium target pat90. 0.3384 1 72
3aaw-assembly1.cif.gz_C crystal structure of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.327 12 106
2lxi-assembly1.cif.gz_A nmr structure of the n-terminal rna binding domain 1 (rrm1) of the protein rbm10 from homo sapiens 0.3066 9 82
ID Description Score Start End Superfamily
af_Q5U901_37_126_3.30.70.340 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Metallocarboxypeptidase-like 0.5363 8 76 3.30.70.340
af_E7F2H8_40_129_3.30.70.340 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Metallocarboxypeptidase-like 0.4846 8 76 3.30.70.340
af_F1R4K9_54_161_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4632 176 260 1.10.472.10
af_O14332_174_270_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4551 186 265 1.10.472.10
af_A0A0R0KPM5_156_258_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.448 183 255 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A481QQE1-F1-model_v4 DUF4123 domain-containing protein 0.9743 11 262
AF-A0A2R7R2V2-F1-model_v4 deleted 0.9616 69 265
AF-A0A2R7R2V2-F1-model_v4 deleted 0.9569 69 265
AF-A0A481QQE1-F1-model_v4 DUF4123 domain-containing protein 0.952 11 262
AF-A2VRP1-F1-model_v4 deleted 0.918 79 141

Map