F476959
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 235 | 714 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0083038|Ga0466966_0083038_1027_1629 |
| Length | 200 |
| Sequence | MLPECQVIRLNLFCFLEEEPPMKVTFLCLVLVVSTVSFAQQQDQSHKPAPTLKSILLEQLHSTHDKAEWFVPANTAIEGLTAEQASWTDGKNHSVGQLVNHLVYWDRRALEKFKGEPQDKYSGNNDDTFKFDPKQWNDSVKQLDAVMTEWEKAVESADEAKLKDWYSTIAHIGTHNAYHIGEIVMVRKEQGSWNPDKGVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 179 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 235 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 3.5 |
| Rhizosphere | 95.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10007720 | 3300002077 | Bacteria | 2223 |
| 2 | Ga0065717_1010914 | 3300005276 | Bacteria | 608 |
| 3 | Ga0065712_10077580 | 3300005290 | Bacteria | 3473 |
| 4 | Ga0065712_10082421 | 3300005290 | Bacteria | 2917 |
| 5 | Ga0065715_10101713 | 3300005293 | Bacteria | 3178 |
| 6 | Ga0065715_10390192 | 3300005293 | Bacteria | 875 |
| 7 | Ga0070676_10003926 | 3300005328 | Bacteria | 7802 |
| 8 | Ga0070676_10903459 | 3300005328 | Bacteria | 658 |
| 9 | Ga0070683_100000439 | 3300005329 | Bacteria | 28892 |
| 10 | Ga0070683_100001669 | 3300005329 | Bacteria | 17224 |
| 11 | Ga0070683_100405725 | 3300005329 | Bacteria | 1300 |
| 12 | Ga0070690_100016990 | 3300005330 | Bacteria | 4368 |
| 13 | Ga0070690_100118697 | 3300005330 | Bacteria | 1773 |
| 14 | Ga0070670_100072103 | 3300005331 | Unclassified | 2966 |
| 15 | Ga0070670_100093434 | 3300005331 | Bacteria | 2587 |
| 16 | Ga0070670_100130310 | 3300005331 | Unclassified | 2171 |
| 17 | Ga0068869_100002672 | 3300005334 | Bacteria | 10776 |
| 18 | Ga0068869_100006472 | 3300005334 | Bacteria | 7433 |
| 19 | Ga0068869_100006858 | 3300005334 | Bacteria | 7245 |
| 20 | Ga0068869_100044611 | 3300005334 | Bacteria | 3188 |
| 21 | Ga0068869_100461574 | 3300005334 | Bacteria | 1054 |
| 22 | Ga0070666_10081321 | 3300005335 | Bacteria | 2215 |
| 23 | Ga0070666_10135622 | 3300005335 | Bacteria | 1712 |
| 24 | Ga0070666_10406230 | 3300005335 | Bacteria | 980 |
| 25 | Ga0070666_10544469 | 3300005335 | Bacteria | 844 |
| 26 | Ga0070680_100265908 | 3300005336 | Unclassified | 1451 |
| 27 | Ga0070682_100060753 | 3300005337 | Bacteria | 2390 |
| 28 | Ga0070682_100280608 | 3300005337 | Unclassified | 1214 |
| 29 | Ga0070682_100614700 | 3300005337 | Bacteria | 860 |
| 30 | Ga0068868_100000658 | 3300005338 | Bacteria | 23281 |
| 31 | Ga0068868_100007650 | 3300005338 | Bacteria | 7706 |
| 32 | Ga0068868_100009529 | 3300005338 | Bacteria | 6996 |
| 33 | Ga0068868_100033454 | 3300005338 | Bacteria | 3963 |
| 34 | Ga0068868_100057200 | 3300005338 | Unclassified | 3080 |
| 35 | Ga0068868_100353698 | 3300005338 | Bacteria | 1259 |
| 36 | Ga0068868_100566989 | 3300005338 | Bacteria | 1002 |
| 37 | Ga0070660_100491283 | 3300005339 | Bacteria | 1021 |
| 38 | Ga0070660_100584770 | 3300005339 | Bacteria | 933 |
| 39 | Ga0070689_100141020 | 3300005340 | Bacteria | 1938 |
| 40 | Ga0070689_100468845 | 3300005340 | Bacteria | 1074 |
| 41 | Ga0070691_10038523 | 3300005341 | Bacteria | 2257 |
| 42 | Ga0070661_100001766 | 3300005344 | Bacteria | 14999 |
| 43 | Ga0070661_100017243 | 3300005344 | Bacteria | 5120 |
| 44 | Ga0070661_100082543 | 3300005344 | Bacteria | 2373 |
| 45 | Ga0070661_100092139 | 3300005344 | Unclassified | 2245 |
| 46 | Ga0070661_100092968 | 3300005344 | Bacteria | 2235 |
| 47 | Ga0070661_100236532 | 3300005344 | Bacteria | 1405 |
| 48 | Ga0070692_10625789 | 3300005345 | Unclassified | 715 |
| 49 | Ga0070668_100044661 | 3300005347 | Bacteria | 3399 |
| 50 | Ga0070668_100101299 | 3300005347 | Bacteria | 2282 |
| 51 | Ga0070668_100124256 | 3300005347 | Bacteria | 2066 |
| 52 | Ga0070669_100594973 | 3300005353 | Unclassified | 926 |
| 53 | Ga0070675_100022209 | 3300005354 | Bacteria | 5068 |
| 54 | Ga0070675_100022283 | 3300005354 | Bacteria | 5060 |
| 55 | Ga0070675_100065479 | 3300005354 | Bacteria | 3005 |
| 56 | Ga0070671_100295330 | 3300005355 | Bacteria | 1379 |
| 57 | Ga0070671_100814932 | 3300005355 | Bacteria | 813 |
| 58 | Ga0070674_100028133 | 3300005356 | Bacteria | 3690 |
| 59 | Ga0070674_100031914 | 3300005356 | Bacteria | 3495 |
| 60 | Ga0070674_100064152 | 3300005356 | Bacteria | 2573 |
| 61 | Ga0070673_100004642 | 3300005364 | Bacteria | 8714 |
| 62 | Ga0070673_100023639 | 3300005364 | Bacteria | 4493 |
| 63 | Ga0070673_100137488 | 3300005364 | Bacteria | 2058 |
| 64 | Ga0070673_100189398 | 3300005364 | Bacteria | 1766 |
| 65 | Ga0070673_100474440 | 3300005364 | Bacteria | 1128 |
| 66 | Ga0070688_100091432 | 3300005365 | Bacteria | 1989 |
| 67 | Ga0070688_100299138 | 3300005365 | Bacteria | 1163 |
| 68 | Ga0070659_100009116 | 3300005366 | Bacteria | 7277 |
| 69 | Ga0070659_100100450 | 3300005366 | Unclassified | 2328 |
| 70 | Ga0070659_100743739 | 3300005366 | Bacteria | 850 |
| 71 | Ga0070667_100084351 | 3300005367 | Bacteria | 2723 |
| 72 | Ga0070667_100123158 | 3300005367 | Bacteria | 2257 |
| 73 | Ga0070667_100437789 | 3300005367 | Bacteria | 1193 |
| 74 | Ga0070709_10018590 | 3300005434 | Bacteria | 4005 |
| 75 | Ga0070709_10162196 | 3300005434 | Bacteria | 1555 |
| 76 | Ga0070714_100072039 | 3300005435 | Unclassified | 2990 |
| 77 | Ga0070714_100289136 | 3300005435 | Bacteria | 1525 |
| 78 | Ga0070714_101284846 | 3300005435 | Bacteria | 714 |
| 79 | Ga0070713_100031800 | 3300005436 | Bacteria | 4207 |
| 80 | Ga0070713_100065686 | 3300005436 | Bacteria | 3049 |
| 81 | Ga0070713_100277971 | 3300005436 | Bacteria | 1535 |
| 82 | Ga0070713_100561279 | 3300005436 | Bacteria | 1082 |
| 83 | Ga0070713_100952531 | 3300005436 | Bacteria | 827 |
| 84 | Ga0070711_100186715 | 3300005439 | Bacteria | 1590 |
| 85 | Ga0070711_100186915 | 3300005439 | Bacteria | 1589 |
| 86 | Ga0070705_100053017 | 3300005440 | Unclassified | 2372 |
| 87 | Ga0070694_100543052 | 3300005444 | Bacteria | 930 |
| 88 | Ga0070708_101000257 | 3300005445 | Unclassified | 784 |
| 89 | Ga0070663_100263278 | 3300005455 | Bacteria | 1368 |
| 90 | Ga0070663_100306396 | 3300005455 | Unclassified | 1273 |
| 91 | Ga0070663_100565122 | 3300005455 | Bacteria | 952 |
| 92 | Ga0070678_100001043 | 3300005456 | Bacteria | 14485 |
| 93 | Ga0070678_100083670 | 3300005456 | Unclassified | 2426 |
| 94 | Ga0070678_100173837 | 3300005456 | Bacteria | 1757 |
| 95 | Ga0070678_100515140 | 3300005456 | Unclassified | 1057 |
| 96 | Ga0070662_100031224 | 3300005457 | Unclassified | 3737 |
| 97 | Ga0070662_100043320 | 3300005457 | Bacteria | 3220 |
| 98 | Ga0070662_100063217 | 3300005457 | Unclassified | 2707 |
| 99 | Ga0070662_100074027 | 3300005457 | Bacteria | 2518 |
| 100 | Ga0070662_100120781 | 3300005457 | Bacteria | 2008 |
| 101 | Ga0070662_100177982 | 3300005457 | Bacteria | 1675 |
| 102 | Ga0070662_100343101 | 3300005457 | Bacteria | 1222 |
| 103 | Ga0070681_10000026 | 3300005458 | Bacteria | 107615 |
| 104 | Ga0070681_10003878 | 3300005458 | Bacteria | 14076 |
| 105 | Ga0070681_10054805 | 3300005458 | Unclassified | 3973 |
| 106 | Ga0070681_10176517 | 3300005458 | Unclassified | 2058 |
| 107 | Ga0070681_10706160 | 3300005458 | Unclassified | 924 |
| 108 | Ga0068867_100014983 | 3300005459 | Bacteria | 5496 |
| 109 | Ga0068867_100016165 | 3300005459 | Bacteria | 5300 |
| 110 | Ga0068867_100021678 | 3300005459 | Unclassified | 4584 |
| 111 | Ga0068867_100061602 | 3300005459 | Bacteria | 2786 |
| 112 | Ga0068867_100087321 | 3300005459 | Bacteria | 2361 |
| 113 | Ga0068867_100406178 | 3300005459 | Bacteria | 1150 |
| 114 | Ga0068867_100870697 | 3300005459 | Bacteria | 808 |
| 115 | Ga0070685_10017481 | 3300005466 | Unclassified | 3839 |
| 116 | Ga0070685_10080072 | 3300005466 | Bacteria | 1956 |
| 117 | Ga0070685_10308959 | 3300005466 | Bacteria | 1068 |
| 118 | Ga0070685_11096212 | 3300005466 | Unclassified | 601 |
| 119 | Ga0070699_101066320 | 3300005518 | Bacteria | 741 |
| 120 | Ga0070679_100028098 | 3300005530 | Bacteria | 5543 |
| 121 | Ga0070679_100051762 | 3300005530 | Unclassified | 4090 |
| 122 | Ga0070679_100060685 | 3300005530 | Unclassified | 3768 |
| 123 | Ga0070679_100112824 | 3300005530 | Unclassified | 2704 |
| 124 | Ga0070679_100386572 | 3300005530 | Bacteria | 1346 |
| 125 | Ga0070679_100681135 | 3300005530 | Unclassified | 971 |
| 126 | Ga0070684_100000465 | 3300005535 | Bacteria | 27738 |
| 127 | Ga0070684_100003698 | 3300005535 | Bacteria | 11540 |
| 128 | Ga0070684_100040832 | 3300005535 | Bacteria | 3997 |
| 129 | Ga0070684_100121704 | 3300005535 | Unclassified | 2348 |
| 130 | Ga0070684_100340166 | 3300005535 | Bacteria | 1379 |
| 131 | Ga0070684_100587368 | 3300005535 | Unclassified | 1035 |
| 132 | Ga0070684_101213773 | 3300005535 | Unclassified | 709 |
| 133 | Ga0068853_100006912 | 3300005539 | Bacteria | 9059 |
| 134 | Ga0068853_100010347 | 3300005539 | Bacteria | 7546 |
| 135 | Ga0068853_100118535 | 3300005539 | Bacteria | 2359 |
| 136 | Ga0068853_100123827 | 3300005539 | Bacteria | 2308 |
| 137 | Ga0068853_100723423 | 3300005539 | Unclassified | 950 |
| 138 | Ga0070672_100008231 | 3300005543 | Bacteria | 7125 |
| 139 | Ga0070672_100198115 | 3300005543 | Bacteria | 1679 |
| 140 | Ga0070672_100265370 | 3300005543 | Bacteria | 1449 |
| 141 | Ga0070686_100010119 | 3300005544 | Bacteria | 5307 |
| 142 | Ga0070686_100333134 | 3300005544 | Bacteria | 1135 |
| 143 | Ga0070695_100143711 | 3300005545 | Bacteria | 1657 |
| 144 | Ga0070695_100784392 | 3300005545 | Unclassified | 762 |
| 145 | Ga0070696_100188444 | 3300005546 | Bacteria | 1534 |
| 146 | Ga0070696_100341319 | 3300005546 | Bacteria | 1157 |
| 147 | Ga0070693_100013377 | 3300005547 | Bacteria | 4178 |
| 148 | Ga0070693_100072316 | 3300005547 | Bacteria | 2034 |
| 149 | Ga0070665_100014552 | 3300005548 | Bacteria | 7894 |
| 150 | Ga0070665_100022144 | 3300005548 | Bacteria | 6392 |
| 151 | Ga0070665_100043681 | 3300005548 | Bacteria | 4502 |
| 152 | Ga0070665_100047875 | 3300005548 | Bacteria | 4291 |
| 153 | Ga0070665_100433939 | 3300005548 | Bacteria | 1323 |
| 154 | Ga0070704_100387655 | 3300005549 | Bacteria | 1189 |
| 155 | Ga0068855_100000295 | 3300005563 | Bacteria | 61909 |
| 156 | Ga0068855_100054917 | 3300005563 | Unclassified | 4680 |
| 157 | Ga0068855_100118543 | 3300005563 | Bacteria | 3031 |
| 158 | Ga0068855_100130686 | 3300005563 | Bacteria | 2868 |
| 159 | Ga0068855_100160629 | 3300005563 | Bacteria | 2551 |
| 160 | Ga0068855_100269775 | 3300005563 | Bacteria | 1892 |
| 161 | Ga0068855_100391523 | 3300005563 | Unclassified | 1524 |
| 162 | Ga0068855_100961597 | 3300005563 | Bacteria | 899 |
| 163 | Ga0070664_100000687 | 3300005564 | Bacteria | 25824 |
| 164 | Ga0070664_100001035 | 3300005564 | Bacteria | 21877 |
| 165 | Ga0070664_100004076 | 3300005564 | Bacteria | 11741 |
| 166 | Ga0070664_100054439 | 3300005564 | Bacteria | 3394 |
| 167 | Ga0070664_100211038 | 3300005564 | Bacteria | 1735 |
| 168 | Ga0070664_100223656 | 3300005564 | Bacteria | 1685 |
| 169 | Ga0070664_100331997 | 3300005564 | Bacteria | 1380 |
| 170 | Ga0070664_100357807 | 3300005564 | Unclassified | 1329 |
| 171 | Ga0070664_100749655 | 3300005564 | Unclassified | 911 |
| 172 | Ga0068857_100001872 | 3300005577 | Bacteria | 16933 |
| 173 | Ga0068857_100010663 | 3300005577 | Bacteria | 7994 |
| 174 | Ga0068857_100112800 | 3300005577 | Bacteria | 2444 |
| 175 | Ga0068857_100326756 | 3300005577 | Unclassified | 1417 |
| 176 | Ga0068854_100023329 | 3300005578 | Unclassified | 4225 |
| 177 | Ga0068854_100028511 | 3300005578 | Bacteria | 3858 |
| 178 | Ga0068854_100029319 | 3300005578 | Bacteria | 3809 |
| 179 | Ga0068854_100044525 | 3300005578 | Bacteria | 3151 |
| 180 | Ga0068854_100147897 | 3300005578 | Unclassified | 1809 |
| 181 | Ga0068854_100166195 | 3300005578 | Bacteria | 1713 |
| 182 | Ga0068854_100369980 | 3300005578 | Unclassified | 1178 |
| 183 | Ga0068854_100871739 | 3300005578 | Unclassified | 789 |
| 184 | Ga0068856_100000407 | 3300005614 | Bacteria | 47326 |
| 185 | Ga0068856_100001013 | 3300005614 | Bacteria | 29894 |
| 186 | Ga0068856_100002064 | 3300005614 | Bacteria | 20820 |
| 187 | Ga0068856_100006032 | 3300005614 | Bacteria | 11919 |
| 188 | Ga0068856_100183456 | 3300005614 | Bacteria | 2106 |
| 189 | Ga0068856_100344577 | 3300005614 | Bacteria | 1508 |
| 190 | Ga0068856_100543346 | 3300005614 | Bacteria | 1183 |
| 191 | Ga0068856_100579749 | 3300005614 | Bacteria | 1143 |
| 192 | Ga0068856_101385317 | 3300005614 | Unclassified | 718 |
| 193 | Ga0070702_100254863 | 3300005615 | Unclassified | 1191 |
| 194 | Ga0068852_100007347 | 3300005616 | Bacteria | 8039 |
| 195 | Ga0068852_100007670 | 3300005616 | Bacteria | 7894 |
| 196 | Ga0068852_100044428 | 3300005616 | Bacteria | 3773 |
| 197 | Ga0068852_100049918 | 3300005616 | Bacteria | 3582 |
| 198 | Ga0068852_100189892 | 3300005616 | Bacteria | 1938 |
| 199 | Ga0068859_100007556 | 3300005617 | Bacteria | 11039 |
| 200 | Ga0068859_100039953 | 3300005617 | Unclassified | 4709 |
| 201 | Ga0068859_100045630 | 3300005617 | Bacteria | 4402 |
| 202 | Ga0068859_100071863 | 3300005617 | Bacteria | 3495 |
| 203 | Ga0068859_100109212 | 3300005617 | Bacteria | 2827 |
| 204 | Ga0068859_100148912 | 3300005617 | Bacteria | 2416 |
| 205 | Ga0068859_100313329 | 3300005617 | Unclassified | 1663 |
| 206 | Ga0068864_100000684 | 3300005618 | Bacteria | 28437 |
| 207 | Ga0068864_100049730 | 3300005618 | Bacteria | 3607 |
| 208 | Ga0068864_100079208 | 3300005618 | Unclassified | 2876 |
| 209 | Ga0068864_100079900 | 3300005618 | Unclassified | 2864 |
| 210 | Ga0068864_100429102 | 3300005618 | Unclassified | 1261 |
| 211 | Ga0068864_100568977 | 3300005618 | Bacteria | 1097 |
| 212 | Ga0068866_10011392 | 3300005718 | Bacteria | 3846 |
| 213 | Ga0068866_10021659 | 3300005718 | Bacteria | 2964 |
| 214 | Ga0068866_10480212 | 3300005718 | Unclassified | 818 |
| 215 | Ga0068861_100021088 | 3300005719 | Bacteria | 4681 |
| 216 | Ga0068861_100102778 | 3300005719 | Unclassified | 2276 |
| 217 | Ga0068861_100414988 | 3300005719 | Bacteria | 1198 |
| 218 | Ga0068861_101442499 | 3300005719 | Bacteria | 674 |
| 219 | Ga0068851_10042410 | 3300005834 | Bacteria | 2290 |
| 220 | Ga0068851_10245406 | 3300005834 | Bacteria | 1014 |
| 221 | Ga0068851_10365552 | 3300005834 | Unclassified | 842 |
| 222 | Ga0068870_10029178 | 3300005840 | Bacteria | 2776 |
| 223 | Ga0068870_10181939 | 3300005840 | Bacteria | 1262 |
| 224 | Ga0068863_100012509 | 3300005841 | Bacteria | 8191 |
| 225 | Ga0068863_100140708 | 3300005841 | Unclassified | 2306 |
| 226 | Ga0068863_100194888 | 3300005841 | Bacteria | 1948 |
| 227 | Ga0068863_100654988 | 3300005841 | Bacteria | 1042 |
| 228 | Ga0068863_100854381 | 3300005841 | Bacteria | 909 |
| 229 | Ga0068858_100003346 | 3300005842 | Bacteria | 15959 |
| 230 | Ga0068858_100072193 | 3300005842 | Bacteria | 3202 |
| 231 | Ga0068858_100324207 | 3300005842 | Unclassified | 1472 |
| 232 | Ga0068858_100481620 | 3300005842 | Bacteria | 1198 |
| 233 | Ga0068860_100035179 | 3300005843 | Unclassified | 4806 |
| 234 | Ga0068860_100056788 | 3300005843 | Bacteria | 3720 |
| 235 | Ga0068860_100227616 | 3300005843 | Bacteria | 1812 |
| 236 | Ga0068862_100021645 | 3300005844 | Bacteria | 5375 |
| 237 | Ga0068862_100195439 | 3300005844 | Bacteria | 1822 |
| 238 | Ga0068862_100272876 | 3300005844 | Bacteria | 1547 |
| 239 | Ga0068862_100330105 | 3300005844 | Bacteria | 1410 |
| 240 | Ga0068862_100581094 | 3300005844 | Bacteria | 1073 |
| 241 | Ga0070717_10010731 | 3300006028 | Bacteria | 6933 |
| 242 | Ga0070717_10333161 | 3300006028 | Bacteria | 1354 |
| 243 | Ga0070715_10056958 | 3300006163 | Bacteria | 1701 |
| 244 | Ga0070716_100009551 | 3300006173 | Unclassified | 4836 |
| 245 | Ga0070716_100635101 | 3300006173 | Bacteria | 808 |
| 246 | Ga0070712_100005964 | 3300006175 | Bacteria | 7532 |
| 247 | Ga0070712_100071582 | 3300006175 | Bacteria | 2481 |
| 248 | Ga0070712_100211001 | 3300006175 | Bacteria | 1531 |
| 249 | Ga0070712_100317898 | 3300006175 | Unclassified | 1265 |
| 250 | Ga0097621_100000237 | 3300006237 | Bacteria | 37036 |
| 251 | Ga0097621_100009029 | 3300006237 | Bacteria | 7219 |
| 252 | Ga0097621_100064654 | 3300006237 | Unclassified | 3009 |
| 253 | Ga0097621_100103936 | 3300006237 | Unclassified | 2393 |
| 254 | Ga0097621_100278011 | 3300006237 | Unclassified | 1473 |
| 255 | Ga0068871_100003099 | 3300006358 | Bacteria | 11410 |
| 256 | Ga0068871_100006408 | 3300006358 | Bacteria | 8325 |
| 257 | Ga0068871_100016523 | 3300006358 | Bacteria | 5562 |
| 258 | Ga0068871_100165928 | 3300006358 | Bacteria | 1890 |
| 259 | Ga0068871_100187497 | 3300006358 | Bacteria | 1780 |
| 260 | Ga0068871_100331251 | 3300006358 | Bacteria | 1343 |
| 261 | Ga0068871_100444894 | 3300006358 | Unclassified | 1160 |
| 262 | Ga0068871_100457076 | 3300006358 | Unclassified | 1145 |
| 263 | Ga0075433_10057134 | 3300006852 | Bacteria | 3410 |
| 264 | Ga0075434_100001350 | 3300006871 | Bacteria | 20603 |
| 265 | Ga0075434_100226311 | 3300006871 | Bacteria | 1890 |
| 266 | Ga0068865_100024968 | 3300006881 | Unclassified | 3926 |
| 267 | Ga0068865_100032844 | 3300006881 | Bacteria | 3471 |
| 268 | Ga0068865_100105664 | 3300006881 | Unclassified | 2069 |
| 269 | Ga0075436_100002468 | 3300006914 | Bacteria | 12728 |
| 270 | Ga0075436_100130440 | 3300006914 | Bacteria | 1762 |
| 271 | Ga0097620_100007556 | 3300006931 | Bacteria | 11039 |
| 272 | Ga0097620_100039953 | 3300006931 | Unclassified | 4709 |
| 273 | Ga0097620_100045632 | 3300006931 | Bacteria | 4402 |
| 274 | Ga0097620_100071864 | 3300006931 | Bacteria | 3495 |
| 275 | Ga0097620_100109207 | 3300006931 | Bacteria | 2827 |
| 276 | Ga0097620_100148901 | 3300006931 | Bacteria | 2416 |
| 277 | Ga0097620_100313354 | 3300006931 | Unclassified | 1663 |
| 278 | Ga0075435_100011776 | 3300007076 | Bacteria | 6453 |
| 279 | Ga0075435_100015353 | 3300007076 | Bacteria | 5755 |
| 280 | Ga0075435_100052825 | 3300007076 | Bacteria | 3275 |
| 281 | Ga0105240_10007038 | 3300009093 | Bacteria | 16411 |
| 282 | Ga0105240_10055164 | 3300009093 | Bacteria | 4976 |
| 283 | Ga0105240_10063883 | 3300009093 | Unclassified | 4577 |
| 284 | Ga0105240_10129224 | 3300009093 | Bacteria | 3032 |
| 285 | Ga0105240_11008696 | 3300009093 | Bacteria | 890 |
| 286 | Ga0105245_10055245 | 3300009098 | Bacteria | 3566 |
| 287 | Ga0105245_10238347 | 3300009098 | Unclassified | 1762 |
| 288 | Ga0105247_10094861 | 3300009101 | Bacteria | 1899 |
| 289 | Ga0105243_10091371 | 3300009148 | Bacteria | 2507 |
| 290 | Ga0105241_10000910 | 3300009174 | Bacteria | 22369 |
| 291 | Ga0105241_10019884 | 3300009174 | Bacteria | 4956 |
| 292 | Ga0105241_10281093 | 3300009174 | Unclassified | 1421 |
| 293 | Ga0105241_10344394 | 3300009174 | Bacteria | 1292 |
| 294 | Ga0105241_10347552 | 3300009174 | Unclassified | 1287 |
| 295 | Ga0105241_10450500 | 3300009174 | Bacteria | 1138 |
| 296 | Ga0105241_10658902 | 3300009174 | Bacteria | 952 |
| 297 | Ga0105241_10844327 | 3300009174 | Unclassified | 847 |
| 298 | Ga0105241_11471527 | 3300009174 | Bacteria | 654 |
| 299 | Ga0105241_11623752 | 3300009174 | Bacteria | 626 |
| 300 | Ga0105242_10003970 | 3300009176 | Bacteria | 11497 |
| 301 | Ga0105242_10097287 | 3300009176 | Bacteria | 2488 |
| 302 | Ga0105242_10210822 | 3300009176 | Bacteria | 1731 |
| 303 | Ga0105248_10013380 | 3300009177 | Bacteria | 9031 |
| 304 | Ga0105248_10596332 | 3300009177 | Bacteria | 1246 |
| 305 | Ga0105248_10750218 | 3300009177 | Unclassified | 1101 |
| 306 | Ga0105248_11505879 | 3300009177 | Unclassified | 762 |
| 307 | Ga0105237_10054633 | 3300009545 | Bacteria | 4002 |
| 308 | Ga0105237_10087839 | 3300009545 | Unclassified | 3098 |
| 309 | Ga0105237_10108580 | 3300009545 | Bacteria | 2766 |
| 310 | Ga0105237_10224019 | 3300009545 | Bacteria | 1881 |
| 311 | Ga0105238_10000848 | 3300009551 | Bacteria | 31448 |
| 312 | Ga0105238_10388083 | 3300009551 | Bacteria | 1388 |
| 313 | Ga0105238_10492092 | 3300009551 | Bacteria | 1226 |
| 314 | Ga0105238_10559004 | 3300009551 | Bacteria | 1149 |
| 315 | Ga0105238_11008434 | 3300009551 | Unclassified | 853 |
| 316 | Ga0105238_11038324 | 3300009551 | Unclassified | 841 |
| 317 | Ga0105249_10012196 | 3300009553 | Bacteria | 7570 |
| 318 | Ga0105249_10191684 | 3300009553 | Bacteria | 1995 |
| 319 | Ga0105249_10613708 | 3300009553 | Bacteria | 1143 |
| 320 | Ga0105249_11111614 | 3300009553 | Bacteria | 860 |
| 321 | Ga0105239_10059067 | 3300010375 | Bacteria | 4209 |
| 322 | Ga0105239_10127297 | 3300010375 | Unclassified | 2832 |
| 323 | Ga0105239_10130997 | 3300010375 | Bacteria | 2790 |
| 324 | Ga0105239_10359565 | 3300010375 | Bacteria | 1644 |
| 325 | Ga0105239_10526076 | 3300010375 | Bacteria | 1346 |
| 326 | Ga0105239_10536837 | 3300010375 | Bacteria | 1331 |
| 327 | Ga0105239_10731082 | 3300010375 | Bacteria | 1132 |
| 328 | Ga0105239_11464716 | 3300010375 | Unclassified | 789 |
| 329 | Ga0105246_10006095 | 3300011119 | Bacteria | 7357 |
| 330 | Ga0105246_10208251 | 3300011119 | Bacteria | 1525 |
| 331 | Ga0105246_10346833 | 3300011119 | Bacteria | 1215 |
| 332 | Ga0157373_10001291 | 3300013100 | Bacteria | 19116 |
| 333 | Ga0157373_10040106 | 3300013100 | Unclassified | 3351 |
| 334 | Ga0157373_10339926 | 3300013100 | Bacteria | 1070 |
| 335 | Ga0157371_10046079 | 3300013102 | Bacteria | 3102 |
| 336 | Ga0157371_10056746 | 3300013102 | Bacteria | 2778 |
| 337 | Ga0157371_10082079 | 3300013102 | Unclassified | 2282 |
| 338 | Ga0157371_10122219 | 3300013102 | Bacteria | 1851 |
| 339 | Ga0157371_10316645 | 3300013102 | Bacteria | 1132 |
| 340 | Ga0157370_10161224 | 3300013104 | Unclassified | 2086 |
| 341 | Ga0157370_10479605 | 3300013104 | Bacteria | 1143 |
| 342 | Ga0157369_10000124 | 3300013105 | Bacteria | 110693 |
| 343 | Ga0157369_10015527 | 3300013105 | Bacteria | 8582 |
| 344 | Ga0157369_10026095 | 3300013105 | Bacteria | 6482 |
| 345 | Ga0157369_10071837 | 3300013105 | Bacteria | 3714 |
| 346 | Ga0157369_10115306 | 3300013105 | Unclassified | 2853 |
| 347 | Ga0157369_10177446 | 3300013105 | Bacteria | 2242 |
| 348 | Ga0157374_10000162 | 3300013296 | Bacteria | 61913 |
| 349 | Ga0157374_10000260 | 3300013296 | Bacteria | 48732 |
| 350 | Ga0157374_10000667 | 3300013296 | Bacteria | 30210 |
| 351 | Ga0157374_10061972 | 3300013296 | Bacteria | 3504 |
| 352 | Ga0157374_10062877 | 3300013296 | Bacteria | 3480 |
| 353 | Ga0157374_10113041 | 3300013296 | Bacteria | 2614 |
| 354 | Ga0157374_10176221 | 3300013296 | Bacteria | 2087 |
| 355 | Ga0157374_10217011 | 3300013296 | Bacteria | 1876 |
| 356 | Ga0157378_10000020 | 3300013297 | Bacteria | 131245 |
| 357 | Ga0157378_10000320 | 3300013297 | Bacteria | 47177 |
| 358 | Ga0157378_10003732 | 3300013297 | Bacteria | 13503 |
| 359 | Ga0157378_10020404 | 3300013297 | Bacteria | 5828 |
| 360 | Ga0157378_10030936 | 3300013297 | Unclassified | 4726 |
| 361 | Ga0157378_10163701 | 3300013297 | Bacteria | 2082 |
| 362 | Ga0157378_10377901 | 3300013297 | Bacteria | 1391 |
| 363 | Ga0157378_12297806 | 3300013297 | Unclassified | 591 |
| 364 | Ga0163162_10001370 | 3300013306 | Bacteria | 22646 |
| 365 | Ga0163162_10071305 | 3300013306 | Bacteria | 3527 |
| 366 | Ga0163162_10136942 | 3300013306 | Bacteria | 2560 |
| 367 | Ga0163162_10259597 | 3300013306 | Bacteria | 1869 |
| 368 | Ga0163162_10364810 | 3300013306 | Bacteria | 1577 |
| 369 | Ga0157372_10000084 | 3300013307 | Bacteria | 98431 |
| 370 | Ga0157372_10001112 | 3300013307 | Bacteria | 29221 |
| 371 | Ga0157372_10005137 | 3300013307 | Bacteria | 13912 |
| 372 | Ga0157372_10019034 | 3300013307 | Bacteria | 7391 |
| 373 | Ga0157372_10064661 | 3300013307 | Bacteria | 4104 |
| 374 | Ga0157372_10431044 | 3300013307 | Unclassified | 1537 |
| 375 | Ga0157372_10438620 | 3300013307 | Bacteria | 1522 |
| 376 | Ga0157372_10441710 | 3300013307 | Bacteria | 1516 |
| 377 | Ga0157375_10030579 | 3300013308 | Bacteria | 5080 |
| 378 | Ga0157375_10055033 | 3300013308 | Bacteria | 3921 |
| 379 | Ga0157375_10057225 | 3300013308 | Bacteria | 3853 |
| 380 | Ga0157375_10222957 | 3300013308 | Bacteria | 2044 |
| 381 | Ga0157375_10277315 | 3300013308 | Bacteria | 1839 |
| 382 | Ga0157375_10375116 | 3300013308 | Bacteria | 1589 |
| 383 | Ga0157375_10499476 | 3300013308 | Bacteria | 1381 |
| 384 | Ga0163163_10000279 | 3300014325 | Bacteria | 50882 |
| 385 | Ga0163163_10025732 | 3300014325 | Bacteria | 5613 |
| 386 | Ga0163163_10039831 | 3300014325 | Bacteria | 4587 |
| 387 | Ga0163163_10054767 | 3300014325 | Bacteria | 3941 |
| 388 | Ga0163163_10315674 | 3300014325 | Unclassified | 1616 |
| 389 | Ga0163163_10514264 | 3300014325 | Bacteria | 1259 |
| 390 | Ga0157380_10618263 | 3300014326 | Bacteria | 1075 |
| 391 | Ga0157380_10768288 | 3300014326 | Bacteria | 977 |
| 392 | Ga0157377_10086377 | 3300014745 | Bacteria | 1844 |
| 393 | Ga0157377_10267143 | 3300014745 | Unclassified | 1115 |
| 394 | Ga0157379_10009420 | 3300014968 | Bacteria | 8508 |
| 395 | Ga0157379_10222569 | 3300014968 | Bacteria | 1710 |
| 396 | Ga0157376_10001784 | 3300014969 | Bacteria | 14330 |
| 397 | Ga0157376_10052979 | 3300014969 | Bacteria | 3376 |
| 398 | Ga0157376_10105521 | 3300014969 | Bacteria | 2471 |
| 399 | Ga0157376_10114169 | 3300014969 | Bacteria | 2383 |
| 400 | Ga0157376_10118215 | 3300014969 | Bacteria | 2345 |
| 401 | Ga0157376_10741383 | 3300014969 | Bacteria | 991 |
| 402 | Ga0163161_10063746 | 3300017792 | Bacteria | 2687 |
| 403 | Ga0206356_10848496 | 3300020070 | Unclassified | 1325 |
| 404 | Ga0206352_10003278 | 3300020078 | Unclassified | 1321 |
| 405 | Ga0206350_11157382 | 3300020080 | Bacteria | 2636 |
| 406 | Ga0228598_1020574 | 3300024227 | Bacteria | 1299 |
| 407 | Ga0207697_10077753 | 3300025315 | Bacteria | 1395 |
| 408 | Ga0207656_10024326 | 3300025321 | Bacteria | 2448 |
| 409 | Ga0207656_10297995 | 3300025321 | Unclassified | 798 |
| 410 | Ga0207692_10111478 | 3300025898 | Bacteria | 1518 |
| 411 | Ga0207642_10016359 | 3300025899 | Bacteria | 2792 |
| 412 | Ga0207642_10262309 | 3300025899 | Unclassified | 985 |
| 413 | Ga0207710_10043619 | 3300025900 | Unclassified | 1995 |
| 414 | Ga0207710_10048241 | 3300025900 | Bacteria | 1905 |
| 415 | Ga0207688_10249624 | 3300025901 | Bacteria | 1075 |
| 416 | Ga0207680_10108006 | 3300025903 | Unclassified | 1799 |
| 417 | Ga0207680_10388349 | 3300025903 | Bacteria | 985 |
| 418 | Ga0207647_10000811 | 3300025904 | Bacteria | 24230 |
| 419 | Ga0207647_10031767 | 3300025904 | Unclassified | 3396 |
| 420 | Ga0207647_10050804 | 3300025904 | Bacteria | 2565 |
| 421 | Ga0207685_10190684 | 3300025905 | Bacteria | 957 |
| 422 | Ga0207699_10015704 | 3300025906 | Bacteria | 3940 |
| 423 | Ga0207699_10111277 | 3300025906 | Unclassified | 1755 |
| 424 | Ga0207645_10000352 | 3300025907 | Bacteria | 38310 |
| 425 | Ga0207645_10006699 | 3300025907 | Bacteria | 8232 |
| 426 | Ga0207645_10903948 | 3300025907 | Bacteria | 600 |
| 427 | Ga0207643_10020036 | 3300025908 | Bacteria | 3669 |
| 428 | Ga0207643_10182181 | 3300025908 | Bacteria | 1272 |
| 429 | Ga0207643_10310993 | 3300025908 | Unclassified | 982 |
| 430 | Ga0207654_10005785 | 3300025911 | Bacteria | 6243 |
| 431 | Ga0207654_10014299 | 3300025911 | Unclassified | 4100 |
| 432 | Ga0207654_10060351 | 3300025911 | Unclassified | 2215 |
| 433 | Ga0207654_10838761 | 3300025911 | Unclassified | 665 |
| 434 | Ga0207654_11035792 | 3300025911 | Bacteria | 597 |
| 435 | Ga0207707_10000800 | 3300025912 | Bacteria | 30836 |
| 436 | Ga0207707_10008961 | 3300025912 | Bacteria | 8693 |
| 437 | Ga0207707_10217052 | 3300025912 | Unclassified | 1665 |
| 438 | Ga0207695_10018259 | 3300025913 | Bacteria | 8116 |
| 439 | Ga0207695_10028234 | 3300025913 | Bacteria | 6227 |
| 440 | Ga0207695_10049830 | 3300025913 | Bacteria | 4410 |
| 441 | Ga0207695_10251683 | 3300025913 | Bacteria | 1666 |
| 442 | Ga0207695_10331371 | 3300025913 | Bacteria | 1411 |
| 443 | Ga0207671_10124175 | 3300025914 | Bacteria | 1976 |
| 444 | Ga0207671_10206640 | 3300025914 | Bacteria | 1535 |
| 445 | Ga0207671_10266800 | 3300025914 | Unclassified | 1348 |
| 446 | Ga0207671_10341064 | 3300025914 | Bacteria | 1187 |
| 447 | Ga0207671_10467076 | 3300025914 | Unclassified | 1005 |
| 448 | Ga0207693_10008124 | 3300025915 | Bacteria | 8602 |
| 449 | Ga0207693_10047290 | 3300025915 | Bacteria | 3380 |
| 450 | Ga0207663_10009352 | 3300025916 | Bacteria | 5173 |
| 451 | Ga0207663_10550427 | 3300025916 | Bacteria | 902 |
| 452 | Ga0207663_10608187 | 3300025916 | Bacteria | 859 |
| 453 | Ga0207660_10019266 | 3300025917 | Bacteria | 4559 |
| 454 | Ga0207660_10170724 | 3300025917 | Bacteria | 1683 |
| 455 | Ga0207657_10000511 | 3300025919 | Bacteria | 41041 |
| 456 | Ga0207657_10139632 | 3300025919 | Bacteria | 1980 |
| 457 | Ga0207657_10639821 | 3300025919 | Bacteria | 828 |
| 458 | Ga0207649_10011512 | 3300025920 | Bacteria | 4879 |
| 459 | Ga0207649_10052726 | 3300025920 | Bacteria | 2524 |
| 460 | Ga0207649_10064174 | 3300025920 | Bacteria | 2321 |
| 461 | Ga0207649_10186401 | 3300025920 | Bacteria | 1456 |
| 462 | Ga0207649_10246771 | 3300025920 | Bacteria | 1284 |
| 463 | Ga0207652_10052324 | 3300025921 | Bacteria | 3504 |
| 464 | Ga0207652_10116544 | 3300025921 | Unclassified | 2373 |
| 465 | Ga0207652_10269909 | 3300025921 | Bacteria | 1534 |
| 466 | Ga0207652_10408063 | 3300025921 | Bacteria | 1226 |
| 467 | Ga0207681_10105969 | 3300025923 | Bacteria | 2036 |
| 468 | Ga0207694_10000434 | 3300025924 | Bacteria | 38832 |
| 469 | Ga0207694_10110025 | 3300025924 | Unclassified | 2191 |
| 470 | Ga0207694_10145009 | 3300025924 | Bacteria | 1911 |
| 471 | Ga0207694_10264756 | 3300025924 | Bacteria | 1409 |
| 472 | Ga0207650_10054510 | 3300025925 | Unclassified | 2966 |
| 473 | Ga0207650_10156952 | 3300025925 | Bacteria | 1800 |
| 474 | Ga0207659_10010229 | 3300025926 | Bacteria | 5884 |
| 475 | Ga0207659_10724358 | 3300025926 | Bacteria | 852 |
| 476 | Ga0207687_10049346 | 3300025927 | Bacteria | 2927 |
| 477 | Ga0207687_10155612 | 3300025927 | Bacteria | 1748 |
| 478 | Ga0207700_10009126 | 3300025928 | Bacteria | 6176 |
| 479 | Ga0207700_10049542 | 3300025928 | Bacteria | 3125 |
| 480 | Ga0207700_10606809 | 3300025928 | Bacteria | 974 |
| 481 | Ga0207700_10780386 | 3300025928 | Unclassified | 854 |
| 482 | Ga0207664_10352790 | 3300025929 | Bacteria | 1302 |
| 483 | Ga0207664_10663015 | 3300025929 | Bacteria | 938 |
| 484 | Ga0207644_10128256 | 3300025931 | Bacteria | 1939 |
| 485 | Ga0207644_10268855 | 3300025931 | Bacteria | 1365 |
| 486 | Ga0207690_10075694 | 3300025932 | Unclassified | 2335 |
| 487 | Ga0207690_10137393 | 3300025932 | Bacteria | 1796 |
| 488 | Ga0207706_10000130 | 3300025933 | Bacteria | 81196 |
| 489 | Ga0207706_10027916 | 3300025933 | Bacteria | 5045 |
| 490 | Ga0207706_10048352 | 3300025933 | Bacteria | 3762 |
| 491 | Ga0207706_10416760 | 3300025933 | Bacteria | 1163 |
| 492 | Ga0207686_10014173 | 3300025934 | Bacteria | 4432 |
| 493 | Ga0207686_10092146 | 3300025934 | Bacteria | 2003 |
| 494 | Ga0207686_10731288 | 3300025934 | Bacteria | 789 |
| 495 | Ga0207709_10281936 | 3300025935 | Bacteria | 1228 |
| 496 | Ga0207670_10003459 | 3300025936 | Bacteria | 8372 |
| 497 | Ga0207670_10374429 | 3300025936 | Bacteria | 1133 |
| 498 | Ga0207670_10816103 | 3300025936 | Unclassified | 778 |
| 499 | Ga0207669_10047774 | 3300025937 | Bacteria | 2538 |
| 500 | Ga0207669_10152218 | 3300025937 | Bacteria | 1622 |
| 501 | Ga0207669_10418956 | 3300025937 | Bacteria | 1053 |
| 502 | Ga0207704_10008470 | 3300025938 | Bacteria | 4922 |
| 503 | Ga0207704_10095104 | 3300025938 | Unclassified | 1969 |
| 504 | Ga0207704_10344365 | 3300025938 | Bacteria | 1158 |
| 505 | Ga0207704_10584758 | 3300025938 | Bacteria | 912 |
| 506 | Ga0207665_10030987 | 3300025939 | Bacteria | 3538 |
| 507 | Ga0207665_10083131 | 3300025939 | Unclassified | 2208 |
| 508 | Ga0207665_10864263 | 3300025939 | Bacteria | 716 |
| 509 | Ga0207691_10005179 | 3300025940 | Bacteria | 12588 |
| 510 | Ga0207691_10017119 | 3300025940 | Bacteria | 6876 |
| 511 | Ga0207711_10000861 | 3300025941 | Bacteria | 29357 |
| 512 | Ga0207711_10004283 | 3300025941 | Bacteria | 12191 |
| 513 | Ga0207711_10152720 | 3300025941 | Bacteria | 2085 |
| 514 | Ga0207711_11421965 | 3300025941 | Bacteria | 636 |
| 515 | Ga0207689_10000359 | 3300025942 | Bacteria | 42877 |
| 516 | Ga0207689_10003205 | 3300025942 | Bacteria | 14988 |
| 517 | Ga0207689_10005656 | 3300025942 | Bacteria | 11124 |
| 518 | Ga0207689_10008141 | 3300025942 | Bacteria | 9142 |
| 519 | Ga0207689_10009652 | 3300025942 | Bacteria | 8319 |
| 520 | Ga0207689_10011318 | 3300025942 | Bacteria | 7653 |
| 521 | Ga0207661_10024017 | 3300025944 | Bacteria | 4613 |
| 522 | Ga0207661_10699493 | 3300025944 | Bacteria | 932 |
| 523 | Ga0207679_10004667 | 3300025945 | Bacteria | 8536 |
| 524 | Ga0207679_10008676 | 3300025945 | Bacteria | 6482 |
| 525 | Ga0207679_10293350 | 3300025945 | Unclassified | 1399 |
| 526 | Ga0207679_10483427 | 3300025945 | Bacteria | 1103 |
| 527 | Ga0207667_10000213 | 3300025949 | Bacteria | 81973 |
| 528 | Ga0207667_10003075 | 3300025949 | Bacteria | 20688 |
| 529 | Ga0207667_10010912 | 3300025949 | Bacteria | 10588 |
| 530 | Ga0207667_10049664 | 3300025949 | Bacteria | 4430 |
| 531 | Ga0207667_10147138 | 3300025949 | Unclassified | 2425 |
| 532 | Ga0207667_10447248 | 3300025949 | Bacteria | 1313 |
| 533 | Ga0207667_11065785 | 3300025949 | Bacteria | 793 |
| 534 | Ga0207667_11540263 | 3300025949 | Bacteria | 635 |
| 535 | Ga0207651_10067945 | 3300025960 | Unclassified | 2510 |
| 536 | Ga0207651_10159386 | 3300025960 | Bacteria | 1767 |
| 537 | Ga0207651_10284412 | 3300025960 | Bacteria | 1368 |
| 538 | Ga0207651_10523003 | 3300025960 | Bacteria | 1028 |
| 539 | Ga0207712_10128852 | 3300025961 | Bacteria | 1925 |
| 540 | Ga0207712_10486123 | 3300025961 | Bacteria | 1053 |
| 541 | Ga0207712_10501308 | 3300025961 | Bacteria | 1038 |
| 542 | Ga0207668_10034689 | 3300025972 | Bacteria | 3352 |
| 543 | Ga0207668_10553129 | 3300025972 | Bacteria | 997 |
| 544 | Ga0207668_11167262 | 3300025972 | Unclassified | 691 |
| 545 | Ga0207640_10003456 | 3300025981 | Bacteria | 8506 |
| 546 | Ga0207640_10016573 | 3300025981 | Unclassified | 4290 |
| 547 | Ga0207640_10032474 | 3300025981 | Bacteria | 3237 |
| 548 | Ga0207640_10063766 | 3300025981 | Bacteria | 2450 |
| 549 | Ga0207640_10437907 | 3300025981 | Unclassified | 1074 |
| 550 | Ga0207640_10481123 | 3300025981 | Unclassified | 1030 |
| 551 | Ga0207658_10072424 | 3300025986 | Bacteria | 2612 |
| 552 | Ga0207677_10010698 | 3300026023 | Bacteria | 5200 |
| 553 | Ga0207677_10040352 | 3300026023 | Bacteria | 3076 |
| 554 | Ga0207677_10054814 | 3300026023 | Unclassified | 2723 |
| 555 | Ga0207677_10064273 | 3300026023 | Bacteria | 2555 |
| 556 | Ga0207677_10088538 | 3300026023 | Bacteria | 2245 |
| 557 | Ga0207677_10090022 | 3300026023 | Unclassified | 2229 |
| 558 | Ga0207677_10112481 | 3300026023 | Bacteria | 2030 |
| 559 | Ga0207677_10184758 | 3300026023 | Unclassified | 1643 |
| 560 | Ga0207703_10028509 | 3300026035 | Bacteria | 4401 |
| 561 | Ga0207703_10135891 | 3300026035 | Unclassified | 2128 |
| 562 | Ga0207703_10179676 | 3300026035 | Unclassified | 1867 |
| 563 | Ga0207703_10421016 | 3300026035 | Bacteria | 1243 |
| 564 | Ga0207639_10001622 | 3300026041 | Bacteria | 15128 |
| 565 | Ga0207639_10037672 | 3300026041 | Bacteria | 3593 |
| 566 | Ga0207639_10104297 | 3300026041 | Bacteria | 2299 |
| 567 | Ga0207639_10477092 | 3300026041 | Bacteria | 1136 |
| 568 | Ga0207639_10680959 | 3300026041 | Unclassified | 953 |
| 569 | Ga0207639_10962130 | 3300026041 | Bacteria | 799 |
| 570 | Ga0207639_10975205 | 3300026041 | Bacteria | 793 |
| 571 | Ga0207678_10000169 | 3300026067 | Bacteria | 54815 |
| 572 | Ga0207678_10215040 | 3300026067 | Bacteria | 1645 |
| 573 | Ga0207678_10331695 | 3300026067 | Unclassified | 1310 |
| 574 | Ga0207678_10950858 | 3300026067 | Unclassified | 760 |
| 575 | Ga0207678_11068388 | 3300026067 | Unclassified | 715 |
| 576 | Ga0207702_10000114 | 3300026078 | Bacteria | 93951 |
| 577 | Ga0207702_10001495 | 3300026078 | Bacteria | 23103 |
| 578 | Ga0207702_10007437 | 3300026078 | Bacteria | 9347 |
| 579 | Ga0207702_10090167 | 3300026078 | Bacteria | 2682 |
| 580 | Ga0207702_10151691 | 3300026078 | Unclassified | 2108 |
| 581 | Ga0207702_10184342 | 3300026078 | Bacteria | 1924 |
| 582 | Ga0207702_10520069 | 3300026078 | Bacteria | 1162 |
| 583 | Ga0207641_10210909 | 3300026088 | Unclassified | 1796 |
| 584 | Ga0207648_10000215 | 3300026089 | Bacteria | 62218 |
| 585 | Ga0207648_10016987 | 3300026089 | Bacteria | 6632 |
| 586 | Ga0207648_10026158 | 3300026089 | Bacteria | 5188 |
| 587 | Ga0207648_10037810 | 3300026089 | Unclassified | 4250 |
| 588 | Ga0207648_10040178 | 3300026089 | Unclassified | 4111 |
| 589 | Ga0207648_10160347 | 3300026089 | Unclassified | 1986 |
| 590 | Ga0207676_10002123 | 3300026095 | Bacteria | 14348 |
| 591 | Ga0207676_10011474 | 3300026095 | Bacteria | 6335 |
| 592 | Ga0207676_10036414 | 3300026095 | Unclassified | 3743 |
| 593 | Ga0207676_10072642 | 3300026095 | Unclassified | 2766 |
| 594 | Ga0207676_10147703 | 3300026095 | Bacteria | 2021 |
| 595 | Ga0207676_10622601 | 3300026095 | Bacteria | 1039 |
| 596 | Ga0207674_10000860 | 3300026116 | Bacteria | 39670 |
| 597 | Ga0207674_10001389 | 3300026116 | Bacteria | 31181 |
| 598 | Ga0207674_10005344 | 3300026116 | Bacteria | 15272 |
| 599 | Ga0207674_10007882 | 3300026116 | Bacteria | 12374 |
| 600 | Ga0207674_10231091 | 3300026116 | Bacteria | 1797 |
| 601 | Ga0207675_100009538 | 3300026118 | Bacteria | 9078 |
| 602 | Ga0207675_100010295 | 3300026118 | Bacteria | 8762 |
| 603 | Ga0207675_100014105 | 3300026118 | Bacteria | 7451 |
| 604 | Ga0207675_100871895 | 3300026118 | Unclassified | 916 |
| 605 | Ga0207675_101245471 | 3300026118 | Bacteria | 764 |
| 606 | Ga0207683_10001515 | 3300026121 | Bacteria | 20921 |
| 607 | Ga0207683_10054140 | 3300026121 | Bacteria | 3518 |
| 608 | Ga0207698_10007054 | 3300026142 | Bacteria | 7036 |
| 609 | Ga0207698_10070942 | 3300026142 | Unclassified | 2762 |
| 610 | Ga0207698_10115980 | 3300026142 | Bacteria | 2256 |
| 611 | Ga0207698_10570894 | 3300026142 | Bacteria | 1111 |
| 612 | Ga0268266_10009490 | 3300028379 | Bacteria | 8561 |
| 613 | Ga0268266_10049630 | 3300028379 | Bacteria | 3599 |
| 614 | Ga0268266_10656520 | 3300028379 | Bacteria | 1009 |
| 615 | Ga0268265_10463515 | 3300028380 | Bacteria | 1186 |
| 616 | Ga0268265_11013948 | 3300028380 | Unclassified | 820 |
| 617 | Ga0268264_10054667 | 3300028381 | Unclassified | 3334 |
| 618 | Ga0268264_10099321 | 3300028381 | Bacteria | 2525 |
| 619 | Ga0268264_10155474 | 3300028381 | Bacteria | 2055 |
| 620 | Ga0265314_10019719 | 3300031711 | Bacteria | 5216 |
| 621 | Ga0373930_0010220 | 3300034816 | Bacteria | 1674 |
| 622 | Ga0373930_0061177 | 3300034816 | Unclassified | 840 |
| 623 | Ga0373948_0023368 | 3300034817 | Bacteria | 1199 |
| 624 | Ga0373950_0029163 | 3300034818 | Bacteria | 1014 |
| 625 | Ga0373929_0072675 | 3300035085 | Unclassified | 825 |
| 626 | Ga0373949_0057033 | 3300035090 | Unclassified | 997 |
| 627 | Ga0373951_0137356 | 3300035091 | Unclassified | 676 |
| 628 | Ga0373936_0071568 | 3300035113 | Bacteria | 1430 |
| 629 | Ga0373939_0048312 | 3300035114 | Bacteria | 1311 |
| 630 | Ga0373939_0191839 | 3300035114 | Bacteria | 768 |
| 631 | Ga0373941_0306336 | 3300035115 | Unclassified | 635 |
| 632 | Ga0373960_0009147 | 3300035121 | Bacteria | 2393 |
| 633 | Ga0373943_0020134 | 3300035170 | Unclassified | 3074 |
| 634 | Ga0373943_0082225 | 3300035170 | Bacteria | 1653 |
| 635 | Ga0373961_0078557 | 3300035241 | Unclassified | 1034 |
| 636 | Ga0373962_0117228 | 3300035242 | Unclassified | 846 |
| 637 | Ga0373931_0051116 | 3300035691 | Unclassified | 2200 |
| 638 | Ga0373931_0195897 | 3300035691 | Bacteria | 1204 |
| 639 | Ga0373935_0407815 | 3300035692 | Bacteria | 977 |
| 640 | Ga0373935_0436448 | 3300035692 | Bacteria | 944 |
| 641 | Ga0373927_0066421 | 3300035695 | Bacteria | 2333 |
| 642 | Ga0373927_0103828 | 3300035695 | Bacteria | 1850 |
| 643 | Ga0373927_0109300 | 3300035695 | Unclassified | 1801 |
| 644 | Ga0373927_0233802 | 3300035695 | Unclassified | 1208 |
| 645 | Ga0373947_0004931 | 3300035725 | Bacteria | 7805 |
| 646 | Ga0373937_0019513 | 3300036401 | Bacteria | 6066 |
| 647 | Ga0373937_0064885 | 3300036401 | Unclassified | 3360 |
| 648 | Ga0373925_0002528 | 3300037068 | Bacteria | 14568 |
| 649 | Ga0373925_0003931 | 3300037068 | Bacteria | 11347 |
| 650 | Ga0242420_032641 | 3300038996 | Unclassified | 971 |
| 651 | Ga0436363_0138485 | 3300039450 | Unclassified | 658 |
| 652 | Ga0436363_0452538 | 3300039450 | Bacteria | 4156 |
| 653 | Ga0436363_0678730 | 3300039450 | Bacteria | 3317 |
| 654 | Ga0451577_0865583 | 3300042876 | Unclassified | 815 |
| 655 | Ga0466966_0083038 | 3300044684 | Bacteria | 1994 |
| 656 | Ga0466964_0394109 | 3300044706 | Unclassified | 722 |
| 657 | Ga0451576_0417481 | 3300045051 | Bacteria | 1408 |
| 658 | Ga0451576_0448547 | 3300045051 | Bacteria | 1354 |
| 659 | Ga0466967_0440923 | 3300045976 | Bacteria | 1272 |
| 660 | Ga0495650_0017412 | 3300046471 | Bacteria | 3604 |
| 661 | Ga0495580_0000068 | 3300046472 | Bacteria | 63122 |
| 662 | Ga0495580_0016338 | 3300046472 | Bacteria | 5572 |
| 663 | Ga0495580_0765153 | 3300046472 | Unclassified | 628 |
| 664 | Ga0495582_0000291 | 3300046473 | Bacteria | 27648 |
| 665 | Ga0495648_0161115 | 3300046524 | Bacteria | 1160 |
| 666 | Ga0495666_0081374 | 3300046526 | Unclassified | 1532 |
| 667 | Ga0495661_0018438 | 3300046665 | Bacteria | 4591 |
| 668 | Ga0495588_0085859 | 3300046674 | Unclassified | 1646 |
| 669 | Ga0495581_0144563 | 3300047315 | Bacteria | 1388 |
| 670 | Ga0495604_0347772 | 3300047317 | Unclassified | 986 |
| 671 | Ga0495604_0641971 | 3300047317 | Unclassified | 678 |
| 672 | Ga0495674_0103640 | 3300047319 | Bacteria | 2419 |
| 673 | Ga0495672_0014759 | 3300047320 | Bacteria | 5330 |
| 674 | Ga0495675_0424266 | 3300047444 | Unclassified | 772 |
| 675 | Ga0495673_0027796 | 3300047469 | Bacteria | 2687 |
| 676 | Ga0495602_0090848 | 3300048088 | Unclassified | 2535 |
| 677 | Ga0496100_0013016 | 3300048903 | Bacteria | 4787 |
| 678 | Ga0496102_0055044 | 3300048905 | Bacteria | 3628 |
| 679 | Ga0496102_0082857 | 3300048905 | Bacteria | 2958 |
| 680 | Ga0496104_0175175 | 3300048907 | Bacteria | 2055 |
| 681 | Ga0496104_0310504 | 3300048907 | Unclassified | 1490 |
| 682 | Ga0496104_0387683 | 3300048907 | Bacteria | 1309 |
| 683 | Ga0496105_0123282 | 3300048908 | Bacteria | 2136 |
| 684 | Ga0496105_0686701 | 3300048908 | Bacteria | 787 |
| 685 | Ga0496105_0757091 | 3300048908 | Unclassified | 741 |
| 686 | Ga0496106_0171922 | 3300048909 | Bacteria | 1718 |
| 687 | Ga0496106_0324021 | 3300048909 | Bacteria | 1237 |
| 688 | Ga0496107_0445557 | 3300048910 | Unclassified | 962 |
| 689 | Ga0496109_1044853 | 3300048912 | Unclassified | 754 |
| 690 | Ga0496110_0013298 | 3300048913 | Bacteria | 6799 |
| 691 | Ga0496110_0059899 | 3300048913 | Bacteria | 3357 |
| 692 | Ga0496111_0721866 | 3300048914 | Bacteria | 724 |
| 693 | Ga0496112_0010933 | 3300048915 | Bacteria | 8264 |
| 694 | Ga0496112_0011133 | 3300048915 | Bacteria | 8201 |
| 695 | Ga0496112_0093619 | 3300048915 | Bacteria | 2975 |
| 696 | Ga0496112_0333281 | 3300048915 | Bacteria | 1461 |
| 697 | Ga0496112_0348878 | 3300048915 | Unclassified | 1422 |
| 698 | Ga0496112_0795584 | 3300048915 | Unclassified | 871 |
| 699 | Ga0496115_0144082 | 3300048918 | Bacteria | 1966 |
| 700 | Ga0496115_0170915 | 3300048918 | Bacteria | 1798 |
| 701 | Ga0496115_0216962 | 3300048918 | Unclassified | 1579 |
| 702 | Ga0501083_0063924 | 3300049744 | Unclassified | 2454 |
| 703 | nmdc:mga0n895_123205_c1 | 3300050512 | Bacteria | 2614 |
| 704 | nmdc:mga0n895_17489_c1 | 3300050512 | Bacteria | 6608 |
| 705 | nmdc:mga0rr50_124073_c2 | 3300050513 | Bacteria | 1588 |
| 706 | nmdc:mga0rr50_18132_c1 | 3300050513 | Bacteria | 4720 |
| 707 | nmdc:mga0rr50_32577_c1 | 3300050513 | Bacteria | 3714 |
| 708 | nmdc:mga0rr50_4897_c1 | 3300050513 | Bacteria | 7919 |
| 709 | nmdc:mga08x19_859_c1 | 3300050514 | Bacteria | 19283 |
| 710 | nmdc:mga08x19_9722_c1 | 3300050514 | Bacteria | 5759 |
| 711 | nmdc:mga0a205_54288_c1 | 3300050515 | Bacteria | 3409 |
| 712 | Ga0495601_0264188 | 3300053077 | Bacteria | 1123 |
| 713 | Ga0500651_0000007 | 3300053093 | Bacteria | 295019 |
| 714 | Ga0500661_000345 | 3300055283 | Bacteria | 8445 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025923 | Ga0207681_10105969 | Ga0207681_101059692 | 164 |
| 2 | 3300026067 | Ga0207678_11068388 | Ga0207678_110683881 | 166 |
| 3 | 3300005338 | Ga0068868_100566989 | Ga0068868_1005669892 | 169 |
| 4 | 3300031711 | Ga0265314_10019719 | Ga0265314_100197194 | 169 |
| 5 | 3300009177 | Ga0105248_11505879 | Ga0105248_115058791 | 170 |
| 6 | 3300014325 | Ga0163163_10039831 | Ga0163163_100398311 | 170 |
| 7 | 3300025941 | Ga0207711_11421965 | Ga0207711_114219651 | 170 |
| 8 | 3300006358 | Ga0068871_100187497 | Ga0068871_1001874973 | 172 |
| 9 | 3300009174 | Ga0105241_10281093 | Ga0105241_102810932 | 172 |
| 10 | 3300009545 | Ga0105237_10054633 | Ga0105237_100546334 | 172 |
| 11 | 3300025914 | Ga0207671_10206640 | Ga0207671_102066403 | 172 |
| 12 | 3300005293 | Ga0065715_10390192 | Ga0065715_103901921 | 173 |
| 13 | 3300005546 | Ga0070696_100188444 | Ga0070696_1001884441 | 173 |
| 14 | 3300047320 | Ga0495672_0014759 | Ga0495672_0014759_1141_1662 | 173 |
| 15 | 3300049744 | Ga0501083_0063924 | Ga0501083_0063924_628_1179 | 173 |
| 16 | 3300044684 | Ga0466966_0083038 | Ga0466966_0083038_1027_1629 | 174 |
| 17 | 3300044706 | Ga0466964_0394109 | Ga0466964_0394109_61_591 | 174 |
| 18 | 3300005455 | Ga0070663_100306396 | Ga0070663_1003063961 | 175 |
| 19 | 3300006852 | Ga0075433_10057134 | Ga0075433_100571342 | 175 |
| 20 | 3300006871 | Ga0075434_100001350 | Ga0075434_1000013502 | 175 |
| 21 | 3300007076 | Ga0075435_100011776 | Ga0075435_1000117764 | 175 |
| 22 | 3300024227 | Ga0228598_1020574 | Ga0228598_10205742 | 175 |
| 23 | 3300026067 | Ga0207678_10331695 | Ga0207678_103316952 | 175 |
| 24 | 3300039450 | Ga0436363_0678730 | Ga0436363_0678730_2658_3197 | 175 |
| 25 | 3300045051 | Ga0451576_0417481 | Ga0451576_0417481_167_697 | 175 |
| 26 | 3300050512 | nmdc:mga0n895_17489_c1 | nmdc:mga0n895_17489_c1_1881_2414 | 175 |
| 27 | 3300050513 | nmdc:mga0rr50_18132_c1 | nmdc:mga0rr50_18132_c1_1522_2055 | 175 |
| 28 | 3300050515 | nmdc:mga0a205_54288_c1 | nmdc:mga0a205_54288_c1_1064_1597 | 175 |
| 29 | 3300055283 | Ga0500661_000345 | Ga0500661_000345_4255_4806 | 175 |
| 30 | 3300002077 | JGI24744J21845_10007720 | JGI24744J21845_100077202 | 176 |
| 31 | 3300005276 | Ga0065717_1010914 | Ga0065717_10109141 | 176 |
| 32 | 3300005290 | Ga0065712_10077580 | Ga0065712_100775802 | 176 |
| 33 | 3300005290 | Ga0065712_10082421 | Ga0065712_100824214 | 176 |
| 34 | 3300005293 | Ga0065715_10101713 | Ga0065715_101017131 | 176 |
| 35 | 3300005328 | Ga0070676_10003926 | Ga0070676_100039264 | 176 |
| 36 | 3300005328 | Ga0070676_10903459 | Ga0070676_109034591 | 176 |
| 37 | 3300005329 | Ga0070683_100000439 | Ga0070683_1000004395 | 176 |
| 38 | 3300005329 | Ga0070683_100001669 | Ga0070683_10000166910 | 176 |
| 39 | 3300005329 | Ga0070683_100405725 | Ga0070683_1004057252 | 176 |
| 40 | 3300005330 | Ga0070690_100016990 | Ga0070690_1000169904 | 176 |
| 41 | 3300005330 | Ga0070690_100118697 | Ga0070690_1001186972 | 176 |
| 42 | 3300005331 | Ga0070670_100072103 | Ga0070670_1000721032 | 176 |
| 43 | 3300005331 | Ga0070670_100093434 | Ga0070670_1000934342 | 176 |
| 44 | 3300005331 | Ga0070670_100130310 | Ga0070670_1001303102 | 176 |
| 45 | 3300005334 | Ga0068869_100002672 | Ga0068869_1000026729 | 176 |
| 46 | 3300005334 | Ga0068869_100006472 | Ga0068869_1000064726 | 176 |
| 47 | 3300005334 | Ga0068869_100006858 | Ga0068869_1000068587 | 176 |
| 48 | 3300005334 | Ga0068869_100044611 | Ga0068869_1000446111 | 176 |
| 49 | 3300005334 | Ga0068869_100461574 | Ga0068869_1004615742 | 176 |
| 50 | 3300005335 | Ga0070666_10081321 | Ga0070666_100813212 | 176 |
| 51 | 3300005335 | Ga0070666_10135622 | Ga0070666_101356221 | 176 |
| 52 | 3300005335 | Ga0070666_10406230 | Ga0070666_104062302 | 176 |
| 53 | 3300005335 | Ga0070666_10544469 | Ga0070666_105444692 | 176 |
| 54 | 3300005336 | Ga0070680_100265908 | Ga0070680_1002659081 | 176 |
| 55 | 3300005337 | Ga0070682_100060753 | Ga0070682_1000607531 | 176 |
| 56 | 3300005337 | Ga0070682_100280608 | Ga0070682_1002806082 | 176 |
| 57 | 3300005337 | Ga0070682_100614700 | Ga0070682_1006147001 | 176 |
| 58 | 3300005338 | Ga0068868_100000658 | Ga0068868_1000006589 | 176 |
| 59 | 3300005338 | Ga0068868_100007650 | Ga0068868_1000076506 | 176 |
| 60 | 3300005338 | Ga0068868_100009529 | Ga0068868_1000095298 | 176 |
| 61 | 3300005338 | Ga0068868_100033454 | Ga0068868_1000334543 | 176 |
| 62 | 3300005338 | Ga0068868_100057200 | Ga0068868_1000572004 | 176 |
| 63 | 3300005338 | Ga0068868_100353698 | Ga0068868_1003536982 | 176 |
| 64 | 3300005339 | Ga0070660_100491283 | Ga0070660_1004912832 | 176 |
| 65 | 3300005339 | Ga0070660_100584770 | Ga0070660_1005847701 | 176 |
| 66 | 3300005340 | Ga0070689_100141020 | Ga0070689_1001410202 | 176 |
| 67 | 3300005340 | Ga0070689_100468845 | Ga0070689_1004688451 | 176 |
| 68 | 3300005341 | Ga0070691_10038523 | Ga0070691_100385232 | 176 |
| 69 | 3300005344 | Ga0070661_100001766 | Ga0070661_1000017669 | 176 |
| 70 | 3300005344 | Ga0070661_100017243 | Ga0070661_1000172434 | 176 |
| 71 | 3300005344 | Ga0070661_100082543 | Ga0070661_1000825432 | 176 |
| 72 | 3300005344 | Ga0070661_100092139 | Ga0070661_1000921393 | 176 |
| 73 | 3300005344 | Ga0070661_100092968 | Ga0070661_1000929682 | 176 |
| 74 | 3300005344 | Ga0070661_100236532 | Ga0070661_1002365322 | 176 |
| 75 | 3300005345 | Ga0070692_10625789 | Ga0070692_106257891 | 176 |
| 76 | 3300005347 | Ga0070668_100044661 | Ga0070668_1000446613 | 176 |
| 77 | 3300005347 | Ga0070668_100101299 | Ga0070668_1001012991 | 176 |
| 78 | 3300005347 | Ga0070668_100124256 | Ga0070668_1001242562 | 176 |
| 79 | 3300005353 | Ga0070669_100594973 | Ga0070669_1005949732 | 176 |
| 80 | 3300005354 | Ga0070675_100022209 | Ga0070675_1000222093 | 176 |
| 81 | 3300005354 | Ga0070675_100022283 | Ga0070675_1000222835 | 176 |
| 82 | 3300005354 | Ga0070675_100065479 | Ga0070675_1000654791 | 176 |
| 83 | 3300005355 | Ga0070671_100295330 | Ga0070671_1002953301 | 176 |
| 84 | 3300005355 | Ga0070671_100814932 | Ga0070671_1008149321 | 176 |
| 85 | 3300005356 | Ga0070674_100028133 | Ga0070674_1000281332 | 176 |
| 86 | 3300005356 | Ga0070674_100031914 | Ga0070674_1000319144 | 176 |
| 87 | 3300005356 | Ga0070674_100064152 | Ga0070674_1000641522 | 176 |
| 88 | 3300005364 | Ga0070673_100004642 | Ga0070673_1000046423 | 176 |
| 89 | 3300005364 | Ga0070673_100023639 | Ga0070673_1000236394 | 176 |
| 90 | 3300005364 | Ga0070673_100137488 | Ga0070673_1001374882 | 176 |
| 91 | 3300005364 | Ga0070673_100189398 | Ga0070673_1001893981 | 176 |
| 92 | 3300005364 | Ga0070673_100474440 | Ga0070673_1004744402 | 176 |
| 93 | 3300005365 | Ga0070688_100091432 | Ga0070688_1000914323 | 176 |
| 94 | 3300005365 | Ga0070688_100299138 | Ga0070688_1002991382 | 176 |
| 95 | 3300005366 | Ga0070659_100009116 | Ga0070659_1000091161 | 176 |
| 96 | 3300005366 | Ga0070659_100100450 | Ga0070659_1001004504 | 176 |
| 97 | 3300005366 | Ga0070659_100743739 | Ga0070659_1007437391 | 176 |
| 98 | 3300005367 | Ga0070667_100084351 | Ga0070667_1000843513 | 176 |
| 99 | 3300005367 | Ga0070667_100123158 | Ga0070667_1001231583 | 176 |
| 100 | 3300005367 | Ga0070667_100437789 | Ga0070667_1004377893 | 176 |
| 101 | 3300005434 | Ga0070709_10018590 | Ga0070709_100185904 | 176 |
| 102 | 3300005434 | Ga0070709_10162196 | Ga0070709_101621962 | 176 |
| 103 | 3300005435 | Ga0070714_100072039 | Ga0070714_1000720393 | 176 |
| 104 | 3300005435 | Ga0070714_100289136 | Ga0070714_1002891362 | 176 |
| 105 | 3300005435 | Ga0070714_101284846 | Ga0070714_1012848461 | 176 |
| 106 | 3300005436 | Ga0070713_100031800 | Ga0070713_1000318006 | 176 |
| 107 | 3300005436 | Ga0070713_100065686 | Ga0070713_1000656862 | 176 |
| 108 | 3300005436 | Ga0070713_100277971 | Ga0070713_1002779712 | 176 |
| 109 | 3300005436 | Ga0070713_100561279 | Ga0070713_1005612792 | 176 |
| 110 | 3300005436 | Ga0070713_100952531 | Ga0070713_1009525312 | 176 |
| 111 | 3300005439 | Ga0070711_100186715 | Ga0070711_1001867152 | 176 |
| 112 | 3300005439 | Ga0070711_100186915 | Ga0070711_1001869153 | 176 |
| 113 | 3300005440 | Ga0070705_100053017 | Ga0070705_1000530172 | 176 |
| 114 | 3300005444 | Ga0070694_100543052 | Ga0070694_1005430522 | 176 |
| 115 | 3300005445 | Ga0070708_101000257 | Ga0070708_1010002571 | 176 |
| 116 | 3300005455 | Ga0070663_100263278 | Ga0070663_1002632782 | 176 |
| 117 | 3300005455 | Ga0070663_100565122 | Ga0070663_1005651222 | 176 |
| 118 | 3300005456 | Ga0070678_100001043 | Ga0070678_1000010434 | 176 |
| 119 | 3300005456 | Ga0070678_100083670 | Ga0070678_1000836702 | 176 |
| 120 | 3300005456 | Ga0070678_100173837 | Ga0070678_1001738372 | 176 |
| 121 | 3300005456 | Ga0070678_100515140 | Ga0070678_1005151402 | 176 |
| 122 | 3300005457 | Ga0070662_100031224 | Ga0070662_1000312241 | 176 |
| 123 | 3300005457 | Ga0070662_100043320 | Ga0070662_1000433202 | 176 |
| 124 | 3300005457 | Ga0070662_100063217 | Ga0070662_1000632174 | 176 |
| 125 | 3300005457 | Ga0070662_100074027 | Ga0070662_1000740272 | 176 |
| 126 | 3300005457 | Ga0070662_100120781 | Ga0070662_1001207813 | 176 |
| 127 | 3300005457 | Ga0070662_100177982 | Ga0070662_1001779822 | 176 |
| 128 | 3300005457 | Ga0070662_100343101 | Ga0070662_1003431011 | 176 |
| 129 | 3300005458 | Ga0070681_10000026 | Ga0070681_1000002672 | 176 |
| 130 | 3300005458 | Ga0070681_10003878 | Ga0070681_100038786 | 176 |
| 131 | 3300005458 | Ga0070681_10054805 | Ga0070681_100548052 | 176 |
| 132 | 3300005458 | Ga0070681_10176517 | Ga0070681_101765172 | 176 |
| 133 | 3300005458 | Ga0070681_10706160 | Ga0070681_107061602 | 176 |
| 134 | 3300005459 | Ga0068867_100014983 | Ga0068867_1000149836 | 176 |
| 135 | 3300005459 | Ga0068867_100016165 | Ga0068867_1000161653 | 176 |
| 136 | 3300005459 | Ga0068867_100021678 | Ga0068867_1000216783 | 176 |
| 137 | 3300005459 | Ga0068867_100061602 | Ga0068867_1000616023 | 176 |
| 138 | 3300005459 | Ga0068867_100087321 | Ga0068867_1000873212 | 176 |
| 139 | 3300005459 | Ga0068867_100406178 | Ga0068867_1004061782 | 176 |
| 140 | 3300005459 | Ga0068867_100870697 | Ga0068867_1008706971 | 176 |
| 141 | 3300005466 | Ga0070685_10017481 | Ga0070685_100174813 | 176 |
| 142 | 3300005466 | Ga0070685_10080072 | Ga0070685_100800722 | 176 |
| 143 | 3300005466 | Ga0070685_10308959 | Ga0070685_103089592 | 176 |
| 144 | 3300005466 | Ga0070685_11096212 | Ga0070685_110962121 | 176 |
| 145 | 3300005518 | Ga0070699_101066320 | Ga0070699_1010663201 | 176 |
| 146 | 3300005530 | Ga0070679_100028098 | Ga0070679_1000280982 | 176 |
| 147 | 3300005530 | Ga0070679_100051762 | Ga0070679_1000517624 | 176 |
| 148 | 3300005530 | Ga0070679_100060685 | Ga0070679_1000606851 | 176 |
| 149 | 3300005530 | Ga0070679_100112824 | Ga0070679_1001128243 | 176 |
| 150 | 3300005530 | Ga0070679_100386572 | Ga0070679_1003865722 | 176 |
| 151 | 3300005530 | Ga0070679_100681135 | Ga0070679_1006811352 | 176 |
| 152 | 3300005535 | Ga0070684_100000465 | Ga0070684_10000046515 | 176 |
| 153 | 3300005535 | Ga0070684_100003698 | Ga0070684_1000036986 | 176 |
| 154 | 3300005535 | Ga0070684_100040832 | Ga0070684_1000408322 | 176 |
| 155 | 3300005535 | Ga0070684_100121704 | Ga0070684_1001217041 | 176 |
| 156 | 3300005535 | Ga0070684_100340166 | Ga0070684_1003401662 | 176 |
| 157 | 3300005535 | Ga0070684_100587368 | Ga0070684_1005873681 | 176 |
| 158 | 3300005535 | Ga0070684_101213773 | Ga0070684_1012137731 | 176 |
| 159 | 3300005539 | Ga0068853_100006912 | Ga0068853_1000069128 | 176 |
| 160 | 3300005539 | Ga0068853_100010347 | Ga0068853_1000103471 | 176 |
| 161 | 3300005539 | Ga0068853_100118535 | Ga0068853_1001185351 | 176 |
| 162 | 3300005539 | Ga0068853_100123827 | Ga0068853_1001238272 | 176 |
| 163 | 3300005539 | Ga0068853_100723423 | Ga0068853_1007234232 | 176 |
| 164 | 3300005543 | Ga0070672_100008231 | Ga0070672_1000082314 | 176 |
| 165 | 3300005543 | Ga0070672_100198115 | Ga0070672_1001981152 | 176 |
| 166 | 3300005543 | Ga0070672_100265370 | Ga0070672_1002653702 | 176 |
| 167 | 3300005544 | Ga0070686_100010119 | Ga0070686_1000101193 | 176 |
| 168 | 3300005544 | Ga0070686_100333134 | Ga0070686_1003331342 | 176 |
| 169 | 3300005545 | Ga0070695_100143711 | Ga0070695_1001437111 | 176 |
| 170 | 3300005545 | Ga0070695_100784392 | Ga0070695_1007843921 | 176 |
| 171 | 3300005546 | Ga0070696_100341319 | Ga0070696_1003413192 | 176 |
| 172 | 3300005547 | Ga0070693_100013377 | Ga0070693_1000133773 | 176 |
| 173 | 3300005547 | Ga0070693_100072316 | Ga0070693_1000723161 | 176 |
| 174 | 3300005548 | Ga0070665_100014552 | Ga0070665_1000145524 | 176 |
| 175 | 3300005548 | Ga0070665_100022144 | Ga0070665_1000221444 | 176 |
| 176 | 3300005548 | Ga0070665_100043681 | Ga0070665_1000436815 | 176 |
| 177 | 3300005548 | Ga0070665_100047875 | Ga0070665_1000478754 | 176 |
| 178 | 3300005548 | Ga0070665_100433939 | Ga0070665_1004339392 | 176 |
| 179 | 3300005549 | Ga0070704_100387655 | Ga0070704_1003876551 | 176 |
| 180 | 3300005563 | Ga0068855_100000295 | Ga0068855_10000029523 | 176 |
| 181 | 3300005563 | Ga0068855_100054917 | Ga0068855_1000549175 | 176 |
| 182 | 3300005563 | Ga0068855_100118543 | Ga0068855_1001185432 | 176 |
| 183 | 3300005563 | Ga0068855_100130686 | Ga0068855_1001306862 | 176 |
| 184 | 3300005563 | Ga0068855_100160629 | Ga0068855_1001606293 | 176 |
| 185 | 3300005563 | Ga0068855_100269775 | Ga0068855_1002697752 | 176 |
| 186 | 3300005563 | Ga0068855_100391523 | Ga0068855_1003915232 | 176 |
| 187 | 3300005563 | Ga0068855_100961597 | Ga0068855_1009615972 | 176 |
| 188 | 3300005564 | Ga0070664_100000687 | Ga0070664_10000068722 | 176 |
| 189 | 3300005564 | Ga0070664_100001035 | Ga0070664_10000103513 | 176 |
| 190 | 3300005564 | Ga0070664_100004076 | Ga0070664_1000040764 | 176 |
| 191 | 3300005564 | Ga0070664_100054439 | Ga0070664_1000544392 | 176 |
| 192 | 3300005564 | Ga0070664_100211038 | Ga0070664_1002110382 | 176 |
| 193 | 3300005564 | Ga0070664_100223656 | Ga0070664_1002236562 | 176 |
| 194 | 3300005564 | Ga0070664_100331997 | Ga0070664_1003319972 | 176 |
| 195 | 3300005564 | Ga0070664_100357807 | Ga0070664_1003578073 | 176 |
| 196 | 3300005564 | Ga0070664_100749655 | Ga0070664_1007496552 | 176 |
| 197 | 3300005577 | Ga0068857_100001872 | Ga0068857_10000187216 | 176 |
| 198 | 3300005577 | Ga0068857_100010663 | Ga0068857_1000106635 | 176 |
| 199 | 3300005577 | Ga0068857_100112800 | Ga0068857_1001128003 | 176 |
| 200 | 3300005577 | Ga0068857_100326756 | Ga0068857_1003267562 | 176 |
| 201 | 3300005578 | Ga0068854_100023329 | Ga0068854_1000233292 | 176 |
| 202 | 3300005578 | Ga0068854_100028511 | Ga0068854_1000285114 | 176 |
| 203 | 3300005578 | Ga0068854_100029319 | Ga0068854_1000293192 | 176 |
| 204 | 3300005578 | Ga0068854_100044525 | Ga0068854_1000445252 | 176 |
| 205 | 3300005578 | Ga0068854_100147897 | Ga0068854_1001478972 | 176 |
| 206 | 3300005578 | Ga0068854_100166195 | Ga0068854_1001661952 | 176 |
| 207 | 3300005578 | Ga0068854_100369980 | Ga0068854_1003699802 | 176 |
| 208 | 3300005578 | Ga0068854_100871739 | Ga0068854_1008717391 | 176 |
| 209 | 3300005614 | Ga0068856_100000407 | Ga0068856_10000040718 | 176 |
| 210 | 3300005614 | Ga0068856_100001013 | Ga0068856_1000010132 | 176 |
| 211 | 3300005614 | Ga0068856_100002064 | Ga0068856_1000020646 | 176 |
| 212 | 3300005614 | Ga0068856_100006032 | Ga0068856_1000060326 | 176 |
| 213 | 3300005614 | Ga0068856_100183456 | Ga0068856_1001834562 | 176 |
| 214 | 3300005614 | Ga0068856_100344577 | Ga0068856_1003445772 | 176 |
| 215 | 3300005614 | Ga0068856_100543346 | Ga0068856_1005433462 | 176 |
| 216 | 3300005614 | Ga0068856_100579749 | Ga0068856_1005797492 | 176 |
| 217 | 3300005614 | Ga0068856_101385317 | Ga0068856_1013853171 | 176 |
| 218 | 3300005615 | Ga0070702_100254863 | Ga0070702_1002548632 | 176 |
| 219 | 3300005616 | Ga0068852_100007347 | Ga0068852_1000073472 | 176 |
| 220 | 3300005616 | Ga0068852_100007670 | Ga0068852_1000076704 | 176 |
| 221 | 3300005616 | Ga0068852_100044428 | Ga0068852_1000444284 | 176 |
| 222 | 3300005616 | Ga0068852_100049918 | Ga0068852_1000499182 | 176 |
| 223 | 3300005616 | Ga0068852_100189892 | Ga0068852_1001898922 | 176 |
| 224 | 3300005617 | Ga0068859_100007556 | Ga0068859_10000755611 | 176 |
| 225 | 3300005617 | Ga0068859_100039953 | Ga0068859_1000399536 | 176 |
| 226 | 3300005617 | Ga0068859_100045630 | Ga0068859_1000456305 | 176 |
| 227 | 3300005617 | Ga0068859_100071863 | Ga0068859_1000718633 | 176 |
| 228 | 3300005617 | Ga0068859_100109212 | Ga0068859_1001092122 | 176 |
| 229 | 3300005617 | Ga0068859_100148912 | Ga0068859_1001489122 | 176 |
| 230 | 3300005617 | Ga0068859_100313329 | Ga0068859_1003133291 | 176 |
| 231 | 3300005618 | Ga0068864_100000684 | Ga0068864_10000068424 | 176 |
| 232 | 3300005618 | Ga0068864_100049730 | Ga0068864_1000497305 | 176 |
| 233 | 3300005618 | Ga0068864_100079208 | Ga0068864_1000792083 | 176 |
| 234 | 3300005618 | Ga0068864_100079900 | Ga0068864_1000799004 | 176 |
| 235 | 3300005618 | Ga0068864_100429102 | Ga0068864_1004291021 | 176 |
| 236 | 3300005618 | Ga0068864_100568977 | Ga0068864_1005689772 | 176 |
| 237 | 3300005718 | Ga0068866_10011392 | Ga0068866_100113922 | 176 |
| 238 | 3300005718 | Ga0068866_10021659 | Ga0068866_100216591 | 176 |
| 239 | 3300005718 | Ga0068866_10480212 | Ga0068866_104802121 | 176 |
| 240 | 3300005719 | Ga0068861_100021088 | Ga0068861_1000210884 | 176 |
| 241 | 3300005719 | Ga0068861_100102778 | Ga0068861_1001027783 | 176 |
| 242 | 3300005719 | Ga0068861_100414988 | Ga0068861_1004149883 | 176 |
| 243 | 3300005719 | Ga0068861_101442499 | Ga0068861_1014424991 | 176 |
| 244 | 3300005834 | Ga0068851_10042410 | Ga0068851_100424101 | 176 |
| 245 | 3300005834 | Ga0068851_10245406 | Ga0068851_102454062 | 176 |
| 246 | 3300005834 | Ga0068851_10365552 | Ga0068851_103655522 | 176 |
| 247 | 3300005840 | Ga0068870_10029178 | Ga0068870_100291782 | 176 |
| 248 | 3300005840 | Ga0068870_10181939 | Ga0068870_101819391 | 176 |
| 249 | 3300005841 | Ga0068863_100012509 | Ga0068863_1000125096 | 176 |
| 250 | 3300005841 | Ga0068863_100140708 | Ga0068863_1001407082 | 176 |
| 251 | 3300005841 | Ga0068863_100194888 | Ga0068863_1001948881 | 176 |
| 252 | 3300005841 | Ga0068863_100654988 | Ga0068863_1006549882 | 176 |
| 253 | 3300005841 | Ga0068863_100854381 | Ga0068863_1008543812 | 176 |
| 254 | 3300005842 | Ga0068858_100003346 | Ga0068858_1000033468 | 176 |
| 255 | 3300005842 | Ga0068858_100072193 | Ga0068858_1000721934 | 176 |
| 256 | 3300005842 | Ga0068858_100324207 | Ga0068858_1003242071 | 176 |
| 257 | 3300005842 | Ga0068858_100481620 | Ga0068858_1004816201 | 176 |
| 258 | 3300005843 | Ga0068860_100035179 | Ga0068860_1000351795 | 176 |
| 259 | 3300005843 | Ga0068860_100056788 | Ga0068860_1000567882 | 176 |
| 260 | 3300005843 | Ga0068860_100227616 | Ga0068860_1002276164 | 176 |
| 261 | 3300005844 | Ga0068862_100021645 | Ga0068862_1000216454 | 176 |
| 262 | 3300005844 | Ga0068862_100195439 | Ga0068862_1001954392 | 176 |
| 263 | 3300005844 | Ga0068862_100272876 | Ga0068862_1002728762 | 176 |
| 264 | 3300005844 | Ga0068862_100330105 | Ga0068862_1003301052 | 176 |
| 265 | 3300005844 | Ga0068862_100581094 | Ga0068862_1005810942 | 176 |
| 266 | 3300006028 | Ga0070717_10010731 | Ga0070717_100107317 | 176 |
| 267 | 3300006028 | Ga0070717_10333161 | Ga0070717_103331612 | 176 |
| 268 | 3300006163 | Ga0070715_10056958 | Ga0070715_100569583 | 176 |
| 269 | 3300006173 | Ga0070716_100009551 | Ga0070716_1000095514 | 176 |
| 270 | 3300006173 | Ga0070716_100635101 | Ga0070716_1006351011 | 176 |
| 271 | 3300006175 | Ga0070712_100005964 | Ga0070712_1000059642 | 176 |
| 272 | 3300006175 | Ga0070712_100071582 | Ga0070712_1000715824 | 176 |
| 273 | 3300006175 | Ga0070712_100211001 | Ga0070712_1002110012 | 176 |
| 274 | 3300006175 | Ga0070712_100317898 | Ga0070712_1003178982 | 176 |
| 275 | 3300006237 | Ga0097621_100000237 | Ga0097621_10000023719 | 176 |
| 276 | 3300006237 | Ga0097621_100009029 | Ga0097621_1000090294 | 176 |
| 277 | 3300006237 | Ga0097621_100064654 | Ga0097621_1000646544 | 176 |
| 278 | 3300006237 | Ga0097621_100103936 | Ga0097621_1001039364 | 176 |
| 279 | 3300006237 | Ga0097621_100278011 | Ga0097621_1002780111 | 176 |
| 280 | 3300006358 | Ga0068871_100003099 | Ga0068871_1000030993 | 176 |
| 281 | 3300006358 | Ga0068871_100006408 | Ga0068871_1000064087 | 176 |
| 282 | 3300006358 | Ga0068871_100016523 | Ga0068871_1000165233 | 176 |
| 283 | 3300006358 | Ga0068871_100165928 | Ga0068871_1001659283 | 176 |
| 284 | 3300006358 | Ga0068871_100331251 | Ga0068871_1003312512 | 176 |
| 285 | 3300006358 | Ga0068871_100444894 | Ga0068871_1004448942 | 176 |
| 286 | 3300006358 | Ga0068871_100457076 | Ga0068871_1004570762 | 176 |
| 287 | 3300006871 | Ga0075434_100226311 | Ga0075434_1002263112 | 176 |
| 288 | 3300006881 | Ga0068865_100024968 | Ga0068865_1000249682 | 176 |
| 289 | 3300006881 | Ga0068865_100032844 | Ga0068865_1000328443 | 176 |
| 290 | 3300006881 | Ga0068865_100105664 | Ga0068865_1001056643 | 176 |
| 291 | 3300006914 | Ga0075436_100002468 | Ga0075436_1000024686 | 176 |
| 292 | 3300006914 | Ga0075436_100130440 | Ga0075436_1001304402 | 176 |
| 293 | 3300006931 | Ga0097620_100007556 | Ga0097620_10000755611 | 176 |
| 294 | 3300006931 | Ga0097620_100039953 | Ga0097620_1000399531 | 176 |
| 295 | 3300006931 | Ga0097620_100045632 | Ga0097620_1000456325 | 176 |
| 296 | 3300006931 | Ga0097620_100071864 | Ga0097620_1000718643 | 176 |
| 297 | 3300006931 | Ga0097620_100109207 | Ga0097620_1001092073 | 176 |
| 298 | 3300006931 | Ga0097620_100148901 | Ga0097620_1001489012 | 176 |
| 299 | 3300006931 | Ga0097620_100313354 | Ga0097620_1003133541 | 176 |
| 300 | 3300007076 | Ga0075435_100015353 | Ga0075435_1000153537 | 176 |
| 301 | 3300007076 | Ga0075435_100052825 | Ga0075435_1000528255 | 176 |
| 302 | 3300009093 | Ga0105240_10007038 | Ga0105240_100070383 | 176 |
| 303 | 3300009093 | Ga0105240_10055164 | Ga0105240_100551645 | 176 |
| 304 | 3300009093 | Ga0105240_10063883 | Ga0105240_100638834 | 176 |
| 305 | 3300009093 | Ga0105240_10129224 | Ga0105240_101292244 | 176 |
| 306 | 3300009093 | Ga0105240_11008696 | Ga0105240_110086961 | 176 |
| 307 | 3300009098 | Ga0105245_10055245 | Ga0105245_100552452 | 176 |
| 308 | 3300009098 | Ga0105245_10238347 | Ga0105245_102383472 | 176 |
| 309 | 3300009101 | Ga0105247_10094861 | Ga0105247_100948612 | 176 |
| 310 | 3300009148 | Ga0105243_10091371 | Ga0105243_100913712 | 176 |
| 311 | 3300009174 | Ga0105241_10000910 | Ga0105241_1000091014 | 176 |
| 312 | 3300009174 | Ga0105241_10019884 | Ga0105241_100198842 | 176 |
| 313 | 3300009174 | Ga0105241_10344394 | Ga0105241_103443941 | 176 |
| 314 | 3300009174 | Ga0105241_10347552 | Ga0105241_103475522 | 176 |
| 315 | 3300009174 | Ga0105241_10450500 | Ga0105241_104505002 | 176 |
| 316 | 3300009174 | Ga0105241_10658902 | Ga0105241_106589022 | 176 |
| 317 | 3300009174 | Ga0105241_10844327 | Ga0105241_108443271 | 176 |
| 318 | 3300009174 | Ga0105241_11471527 | Ga0105241_114715271 | 176 |
| 319 | 3300009174 | Ga0105241_11623752 | Ga0105241_116237521 | 176 |
| 320 | 3300009176 | Ga0105242_10003970 | Ga0105242_100039702 | 176 |
| 321 | 3300009176 | Ga0105242_10097287 | Ga0105242_100972872 | 176 |
| 322 | 3300009176 | Ga0105242_10210822 | Ga0105242_102108222 | 176 |
| 323 | 3300009177 | Ga0105248_10013380 | Ga0105248_100133808 | 176 |
| 324 | 3300009177 | Ga0105248_10596332 | Ga0105248_105963322 | 176 |
| 325 | 3300009177 | Ga0105248_10750218 | Ga0105248_107502181 | 176 |
| 326 | 3300009545 | Ga0105237_10087839 | Ga0105237_100878394 | 176 |
| 327 | 3300009545 | Ga0105237_10108580 | Ga0105237_101085804 | 176 |
| 328 | 3300009545 | Ga0105237_10224019 | Ga0105237_102240192 | 176 |
| 329 | 3300009551 | Ga0105238_10000848 | Ga0105238_1000084833 | 176 |
| 330 | 3300009551 | Ga0105238_10388083 | Ga0105238_103880832 | 176 |
| 331 | 3300009551 | Ga0105238_10492092 | Ga0105238_104920922 | 176 |
| 332 | 3300009551 | Ga0105238_10559004 | Ga0105238_105590042 | 176 |
| 333 | 3300009551 | Ga0105238_11008434 | Ga0105238_110084342 | 176 |
| 334 | 3300009551 | Ga0105238_11038324 | Ga0105238_110383241 | 176 |
| 335 | 3300009553 | Ga0105249_10012196 | Ga0105249_100121962 | 176 |
| 336 | 3300009553 | Ga0105249_10191684 | Ga0105249_101916842 | 176 |
| 337 | 3300009553 | Ga0105249_10613708 | Ga0105249_106137082 | 176 |
| 338 | 3300009553 | Ga0105249_11111614 | Ga0105249_111116141 | 176 |
| 339 | 3300010375 | Ga0105239_10059067 | Ga0105239_100590674 | 176 |
| 340 | 3300010375 | Ga0105239_10127297 | Ga0105239_101272974 | 176 |
| 341 | 3300010375 | Ga0105239_10130997 | Ga0105239_101309972 | 176 |
| 342 | 3300010375 | Ga0105239_10359565 | Ga0105239_103595652 | 176 |
| 343 | 3300010375 | Ga0105239_10526076 | Ga0105239_105260762 | 176 |
| 344 | 3300010375 | Ga0105239_10536837 | Ga0105239_105368372 | 176 |
| 345 | 3300010375 | Ga0105239_10731082 | Ga0105239_107310821 | 176 |
| 346 | 3300010375 | Ga0105239_11464716 | Ga0105239_114647161 | 176 |
| 347 | 3300011119 | Ga0105246_10006095 | Ga0105246_100060956 | 176 |
| 348 | 3300011119 | Ga0105246_10208251 | Ga0105246_102082512 | 176 |
| 349 | 3300011119 | Ga0105246_10346833 | Ga0105246_103468332 | 176 |
| 350 | 3300013100 | Ga0157373_10001291 | Ga0157373_100012916 | 176 |
| 351 | 3300013100 | Ga0157373_10040106 | Ga0157373_100401063 | 176 |
| 352 | 3300013100 | Ga0157373_10339926 | Ga0157373_103399261 | 176 |
| 353 | 3300013102 | Ga0157371_10046079 | Ga0157371_100460794 | 176 |
| 354 | 3300013102 | Ga0157371_10056746 | Ga0157371_100567464 | 176 |
| 355 | 3300013102 | Ga0157371_10082079 | Ga0157371_100820792 | 176 |
| 356 | 3300013102 | Ga0157371_10122219 | Ga0157371_101222193 | 176 |
| 357 | 3300013102 | Ga0157371_10316645 | Ga0157371_103166452 | 176 |
| 358 | 3300013104 | Ga0157370_10161224 | Ga0157370_101612241 | 176 |
| 359 | 3300013104 | Ga0157370_10479605 | Ga0157370_104796051 | 176 |
| 360 | 3300013105 | Ga0157369_10000124 | Ga0157369_1000012478 | 176 |
| 361 | 3300013105 | Ga0157369_10015527 | Ga0157369_100155278 | 176 |
| 362 | 3300013105 | Ga0157369_10026095 | Ga0157369_100260955 | 176 |
| 363 | 3300013105 | Ga0157369_10071837 | Ga0157369_100718373 | 176 |
| 364 | 3300013105 | Ga0157369_10115306 | Ga0157369_101153062 | 176 |
| 365 | 3300013105 | Ga0157369_10177446 | Ga0157369_101774462 | 176 |
| 366 | 3300013296 | Ga0157374_10000162 | Ga0157374_1000016223 | 176 |
| 367 | 3300013296 | Ga0157374_10000260 | Ga0157374_100002605 | 176 |
| 368 | 3300013296 | Ga0157374_10000667 | Ga0157374_100006673 | 176 |
| 369 | 3300013296 | Ga0157374_10061972 | Ga0157374_100619724 | 176 |
| 370 | 3300013296 | Ga0157374_10062877 | Ga0157374_100628773 | 176 |
| 371 | 3300013296 | Ga0157374_10113041 | Ga0157374_101130412 | 176 |
| 372 | 3300013296 | Ga0157374_10176221 | Ga0157374_101762212 | 176 |
| 373 | 3300013296 | Ga0157374_10217011 | Ga0157374_102170112 | 176 |
| 374 | 3300013297 | Ga0157378_10000020 | Ga0157378_1000002051 | 176 |
| 375 | 3300013297 | Ga0157378_10000320 | Ga0157378_1000032018 | 176 |
| 376 | 3300013297 | Ga0157378_10003732 | Ga0157378_100037329 | 176 |
| 377 | 3300013297 | Ga0157378_10020404 | Ga0157378_100204044 | 176 |
| 378 | 3300013297 | Ga0157378_10030936 | Ga0157378_100309363 | 176 |
| 379 | 3300013297 | Ga0157378_10163701 | Ga0157378_101637012 | 176 |
| 380 | 3300013297 | Ga0157378_10377901 | Ga0157378_103779013 | 176 |
| 381 | 3300013297 | Ga0157378_12297806 | Ga0157378_122978061 | 176 |
| 382 | 3300013306 | Ga0163162_10001370 | Ga0163162_1000137015 | 176 |
| 383 | 3300013306 | Ga0163162_10071305 | Ga0163162_100713052 | 176 |
| 384 | 3300013306 | Ga0163162_10136942 | Ga0163162_101369422 | 176 |
| 385 | 3300013306 | Ga0163162_10259597 | Ga0163162_102595972 | 176 |
| 386 | 3300013306 | Ga0163162_10364810 | Ga0163162_103648101 | 176 |
| 387 | 3300013307 | Ga0157372_10000084 | Ga0157372_1000008463 | 176 |
| 388 | 3300013307 | Ga0157372_10001112 | Ga0157372_100011126 | 176 |
| 389 | 3300013307 | Ga0157372_10005137 | Ga0157372_100051372 | 176 |
| 390 | 3300013307 | Ga0157372_10019034 | Ga0157372_100190346 | 176 |
| 391 | 3300013307 | Ga0157372_10064661 | Ga0157372_100646612 | 176 |
| 392 | 3300013307 | Ga0157372_10431044 | Ga0157372_104310442 | 176 |
| 393 | 3300013307 | Ga0157372_10438620 | Ga0157372_104386202 | 176 |
| 394 | 3300013307 | Ga0157372_10441710 | Ga0157372_104417101 | 176 |
| 395 | 3300013308 | Ga0157375_10030579 | Ga0157375_100305794 | 176 |
| 396 | 3300013308 | Ga0157375_10055033 | Ga0157375_100550334 | 176 |
| 397 | 3300013308 | Ga0157375_10057225 | Ga0157375_100572253 | 176 |
| 398 | 3300013308 | Ga0157375_10222957 | Ga0157375_102229572 | 176 |
| 399 | 3300013308 | Ga0157375_10277315 | Ga0157375_102773152 | 176 |
| 400 | 3300013308 | Ga0157375_10375116 | Ga0157375_103751162 | 176 |
| 401 | 3300013308 | Ga0157375_10499476 | Ga0157375_104994762 | 176 |
| 402 | 3300014325 | Ga0163163_10000279 | Ga0163163_1000027941 | 176 |
| 403 | 3300014325 | Ga0163163_10025732 | Ga0163163_100257324 | 176 |
| 404 | 3300014325 | Ga0163163_10054767 | Ga0163163_100547672 | 176 |
| 405 | 3300014325 | Ga0163163_10315674 | Ga0163163_103156742 | 176 |
| 406 | 3300014325 | Ga0163163_10514264 | Ga0163163_105142642 | 176 |
| 407 | 3300014326 | Ga0157380_10618263 | Ga0157380_106182631 | 176 |
| 408 | 3300014326 | Ga0157380_10768288 | Ga0157380_107682882 | 176 |
| 409 | 3300014745 | Ga0157377_10086377 | Ga0157377_100863772 | 176 |
| 410 | 3300014745 | Ga0157377_10267143 | Ga0157377_102671432 | 176 |
| 411 | 3300014968 | Ga0157379_10009420 | Ga0157379_100094207 | 176 |
| 412 | 3300014968 | Ga0157379_10222569 | Ga0157379_102225692 | 176 |
| 413 | 3300014969 | Ga0157376_10001784 | Ga0157376_1000178414 | 176 |
| 414 | 3300014969 | Ga0157376_10052979 | Ga0157376_100529794 | 176 |
| 415 | 3300014969 | Ga0157376_10105521 | Ga0157376_101055214 | 176 |
| 416 | 3300014969 | Ga0157376_10114169 | Ga0157376_101141693 | 176 |
| 417 | 3300014969 | Ga0157376_10118215 | Ga0157376_101182152 | 176 |
| 418 | 3300014969 | Ga0157376_10741383 | Ga0157376_107413831 | 176 |
| 419 | 3300017792 | Ga0163161_10063746 | Ga0163161_100637462 | 176 |
| 420 | 3300020070 | Ga0206356_10848496 | Ga0206356_108484963 | 176 |
| 421 | 3300020078 | Ga0206352_10003278 | Ga0206352_100032783 | 176 |
| 422 | 3300020080 | Ga0206350_11157382 | Ga0206350_111573823 | 176 |
| 423 | 3300025315 | Ga0207697_10077753 | Ga0207697_100777532 | 176 |
| 424 | 3300025321 | Ga0207656_10024326 | Ga0207656_100243264 | 176 |
| 425 | 3300025321 | Ga0207656_10297995 | Ga0207656_102979951 | 176 |
| 426 | 3300025898 | Ga0207692_10111478 | Ga0207692_101114782 | 176 |
| 427 | 3300025899 | Ga0207642_10016359 | Ga0207642_100163595 | 176 |
| 428 | 3300025899 | Ga0207642_10262309 | Ga0207642_102623091 | 176 |
| 429 | 3300025900 | Ga0207710_10043619 | Ga0207710_100436192 | 176 |
| 430 | 3300025900 | Ga0207710_10048241 | Ga0207710_100482412 | 176 |
| 431 | 3300025901 | Ga0207688_10249624 | Ga0207688_102496242 | 176 |
| 432 | 3300025903 | Ga0207680_10108006 | Ga0207680_101080062 | 176 |
| 433 | 3300025903 | Ga0207680_10388349 | Ga0207680_103883492 | 176 |
| 434 | 3300025904 | Ga0207647_10000811 | Ga0207647_100008117 | 176 |
| 435 | 3300025904 | Ga0207647_10031767 | Ga0207647_100317675 | 176 |
| 436 | 3300025904 | Ga0207647_10050804 | Ga0207647_100508042 | 176 |
| 437 | 3300025905 | Ga0207685_10190684 | Ga0207685_101906842 | 176 |
| 438 | 3300025906 | Ga0207699_10015704 | Ga0207699_100157042 | 176 |
| 439 | 3300025906 | Ga0207699_10111277 | Ga0207699_101112772 | 176 |
| 440 | 3300025907 | Ga0207645_10000352 | Ga0207645_100003527 | 176 |
| 441 | 3300025907 | Ga0207645_10006699 | Ga0207645_100066996 | 176 |
| 442 | 3300025907 | Ga0207645_10903948 | Ga0207645_109039481 | 176 |
| 443 | 3300025908 | Ga0207643_10020036 | Ga0207643_100200363 | 176 |
| 444 | 3300025908 | Ga0207643_10182181 | Ga0207643_101821811 | 176 |
| 445 | 3300025908 | Ga0207643_10310993 | Ga0207643_103109932 | 176 |
| 446 | 3300025911 | Ga0207654_10005785 | Ga0207654_100057857 | 176 |
| 447 | 3300025911 | Ga0207654_10014299 | Ga0207654_100142997 | 176 |
| 448 | 3300025911 | Ga0207654_10060351 | Ga0207654_100603512 | 176 |
| 449 | 3300025911 | Ga0207654_10838761 | Ga0207654_108387611 | 176 |
| 450 | 3300025911 | Ga0207654_11035792 | Ga0207654_110357921 | 176 |
| 451 | 3300025912 | Ga0207707_10000800 | Ga0207707_1000080017 | 176 |
| 452 | 3300025912 | Ga0207707_10008961 | Ga0207707_100089615 | 176 |
| 453 | 3300025912 | Ga0207707_10217052 | Ga0207707_102170522 | 176 |
| 454 | 3300025913 | Ga0207695_10018259 | Ga0207695_100182595 | 176 |
| 455 | 3300025913 | Ga0207695_10028234 | Ga0207695_100282344 | 176 |
| 456 | 3300025913 | Ga0207695_10049830 | Ga0207695_100498305 | 176 |
| 457 | 3300025913 | Ga0207695_10251683 | Ga0207695_102516832 | 176 |
| 458 | 3300025913 | Ga0207695_10331371 | Ga0207695_103313711 | 176 |
| 459 | 3300025914 | Ga0207671_10124175 | Ga0207671_101241752 | 176 |
| 460 | 3300025914 | Ga0207671_10266800 | Ga0207671_102668001 | 176 |
| 461 | 3300025914 | Ga0207671_10341064 | Ga0207671_103410642 | 176 |
| 462 | 3300025914 | Ga0207671_10467076 | Ga0207671_104670762 | 176 |
| 463 | 3300025915 | Ga0207693_10008124 | Ga0207693_100081245 | 176 |
| 464 | 3300025915 | Ga0207693_10047290 | Ga0207693_100472904 | 176 |
| 465 | 3300025916 | Ga0207663_10009352 | Ga0207663_100093526 | 176 |
| 466 | 3300025916 | Ga0207663_10550427 | Ga0207663_105504272 | 176 |
| 467 | 3300025916 | Ga0207663_10608187 | Ga0207663_106081871 | 176 |
| 468 | 3300025917 | Ga0207660_10019266 | Ga0207660_100192664 | 176 |
| 469 | 3300025917 | Ga0207660_10170724 | Ga0207660_101707242 | 176 |
| 470 | 3300025919 | Ga0207657_10000511 | Ga0207657_1000051119 | 176 |
| 471 | 3300025919 | Ga0207657_10139632 | Ga0207657_101396322 | 176 |
| 472 | 3300025919 | Ga0207657_10639821 | Ga0207657_106398211 | 176 |
| 473 | 3300025920 | Ga0207649_10011512 | Ga0207649_100115121 | 176 |
| 474 | 3300025920 | Ga0207649_10052726 | Ga0207649_100527263 | 176 |
| 475 | 3300025920 | Ga0207649_10064174 | Ga0207649_100641741 | 176 |
| 476 | 3300025920 | Ga0207649_10186401 | Ga0207649_101864012 | 176 |
| 477 | 3300025920 | Ga0207649_10246771 | Ga0207649_102467712 | 176 |
| 478 | 3300025921 | Ga0207652_10052324 | Ga0207652_100523244 | 176 |
| 479 | 3300025921 | Ga0207652_10116544 | Ga0207652_101165443 | 176 |
| 480 | 3300025921 | Ga0207652_10269909 | Ga0207652_102699092 | 176 |
| 481 | 3300025921 | Ga0207652_10408063 | Ga0207652_104080632 | 176 |
| 482 | 3300025924 | Ga0207694_10000434 | Ga0207694_1000043433 | 176 |
| 483 | 3300025924 | Ga0207694_10110025 | Ga0207694_101100253 | 176 |
| 484 | 3300025924 | Ga0207694_10145009 | Ga0207694_101450093 | 176 |
| 485 | 3300025924 | Ga0207694_10264756 | Ga0207694_102647562 | 176 |
| 486 | 3300025925 | Ga0207650_10054510 | Ga0207650_100545102 | 176 |
| 487 | 3300025925 | Ga0207650_10156952 | Ga0207650_101569522 | 176 |
| 488 | 3300025926 | Ga0207659_10010229 | Ga0207659_100102297 | 176 |
| 489 | 3300025926 | Ga0207659_10724358 | Ga0207659_107243582 | 176 |
| 490 | 3300025927 | Ga0207687_10049346 | Ga0207687_100493464 | 176 |
| 491 | 3300025927 | Ga0207687_10155612 | Ga0207687_101556121 | 176 |
| 492 | 3300025928 | Ga0207700_10009126 | Ga0207700_100091266 | 176 |
| 493 | 3300025928 | Ga0207700_10049542 | Ga0207700_100495422 | 176 |
| 494 | 3300025928 | Ga0207700_10606809 | Ga0207700_106068092 | 176 |
| 495 | 3300025928 | Ga0207700_10780386 | Ga0207700_107803861 | 176 |
| 496 | 3300025929 | Ga0207664_10352790 | Ga0207664_103527902 | 176 |
| 497 | 3300025929 | Ga0207664_10663015 | Ga0207664_106630152 | 176 |
| 498 | 3300025931 | Ga0207644_10128256 | Ga0207644_101282561 | 176 |
| 499 | 3300025931 | Ga0207644_10268855 | Ga0207644_102688552 | 176 |
| 500 | 3300025932 | Ga0207690_10075694 | Ga0207690_100756942 | 176 |
| 501 | 3300025932 | Ga0207690_10137393 | Ga0207690_101373931 | 176 |
| 502 | 3300025933 | Ga0207706_10000130 | Ga0207706_1000013045 | 176 |
| 503 | 3300025933 | Ga0207706_10027916 | Ga0207706_100279162 | 176 |
| 504 | 3300025933 | Ga0207706_10048352 | Ga0207706_100483522 | 176 |
| 505 | 3300025933 | Ga0207706_10416760 | Ga0207706_104167601 | 176 |
| 506 | 3300025934 | Ga0207686_10014173 | Ga0207686_100141732 | 176 |
| 507 | 3300025934 | Ga0207686_10092146 | Ga0207686_100921462 | 176 |
| 508 | 3300025934 | Ga0207686_10731288 | Ga0207686_107312882 | 176 |
| 509 | 3300025935 | Ga0207709_10281936 | Ga0207709_102819361 | 176 |
| 510 | 3300025936 | Ga0207670_10003459 | Ga0207670_100034594 | 176 |
| 511 | 3300025936 | Ga0207670_10374429 | Ga0207670_103744292 | 176 |
| 512 | 3300025936 | Ga0207670_10816103 | Ga0207670_108161031 | 176 |
| 513 | 3300025937 | Ga0207669_10047774 | Ga0207669_100477742 | 176 |
| 514 | 3300025937 | Ga0207669_10152218 | Ga0207669_101522182 | 176 |
| 515 | 3300025937 | Ga0207669_10418956 | Ga0207669_104189562 | 176 |
| 516 | 3300025938 | Ga0207704_10008470 | Ga0207704_100084703 | 176 |
| 517 | 3300025938 | Ga0207704_10095104 | Ga0207704_100951043 | 176 |
| 518 | 3300025938 | Ga0207704_10344365 | Ga0207704_103443652 | 176 |
| 519 | 3300025938 | Ga0207704_10584758 | Ga0207704_105847582 | 176 |
| 520 | 3300025939 | Ga0207665_10030987 | Ga0207665_100309872 | 176 |
| 521 | 3300025939 | Ga0207665_10083131 | Ga0207665_100831311 | 176 |
| 522 | 3300025939 | Ga0207665_10864263 | Ga0207665_108642631 | 176 |
| 523 | 3300025940 | Ga0207691_10005179 | Ga0207691_100051794 | 176 |
| 524 | 3300025940 | Ga0207691_10017119 | Ga0207691_100171192 | 176 |
| 525 | 3300025941 | Ga0207711_10000861 | Ga0207711_1000086113 | 176 |
| 526 | 3300025941 | Ga0207711_10004283 | Ga0207711_100042836 | 176 |
| 527 | 3300025941 | Ga0207711_10152720 | Ga0207711_101527204 | 176 |
| 528 | 3300025942 | Ga0207689_10000359 | Ga0207689_1000035929 | 176 |
| 529 | 3300025942 | Ga0207689_10003205 | Ga0207689_100032055 | 176 |
| 530 | 3300025942 | Ga0207689_10005656 | Ga0207689_100056562 | 176 |
| 531 | 3300025942 | Ga0207689_10008141 | Ga0207689_100081414 | 176 |
| 532 | 3300025942 | Ga0207689_10009652 | Ga0207689_100096522 | 176 |
| 533 | 3300025942 | Ga0207689_10011318 | Ga0207689_100113185 | 176 |
| 534 | 3300025944 | Ga0207661_10024017 | Ga0207661_100240171 | 176 |
| 535 | 3300025944 | Ga0207661_10699493 | Ga0207661_106994931 | 176 |
| 536 | 3300025945 | Ga0207679_10004667 | Ga0207679_100046672 | 176 |
| 537 | 3300025945 | Ga0207679_10008676 | Ga0207679_100086764 | 176 |
| 538 | 3300025945 | Ga0207679_10293350 | Ga0207679_102933501 | 176 |
| 539 | 3300025945 | Ga0207679_10483427 | Ga0207679_104834272 | 176 |
| 540 | 3300025949 | Ga0207667_10000213 | Ga0207667_1000021310 | 176 |
| 541 | 3300025949 | Ga0207667_10003075 | Ga0207667_100030755 | 176 |
| 542 | 3300025949 | Ga0207667_10010912 | Ga0207667_100109124 | 176 |
| 543 | 3300025949 | Ga0207667_10049664 | Ga0207667_100496643 | 176 |
| 544 | 3300025949 | Ga0207667_10147138 | Ga0207667_101471382 | 176 |
| 545 | 3300025949 | Ga0207667_10447248 | Ga0207667_104472481 | 176 |
| 546 | 3300025949 | Ga0207667_11065785 | Ga0207667_110657851 | 176 |
| 547 | 3300025949 | Ga0207667_11540263 | Ga0207667_115402631 | 176 |
| 548 | 3300025960 | Ga0207651_10067945 | Ga0207651_100679452 | 176 |
| 549 | 3300025960 | Ga0207651_10159386 | Ga0207651_101593861 | 176 |
| 550 | 3300025960 | Ga0207651_10284412 | Ga0207651_102844122 | 176 |
| 551 | 3300025960 | Ga0207651_10523003 | Ga0207651_105230031 | 176 |
| 552 | 3300025961 | Ga0207712_10128852 | Ga0207712_101288522 | 176 |
| 553 | 3300025961 | Ga0207712_10486123 | Ga0207712_104861232 | 176 |
| 554 | 3300025961 | Ga0207712_10501308 | Ga0207712_105013082 | 176 |
| 555 | 3300025972 | Ga0207668_10034689 | Ga0207668_100346893 | 176 |
| 556 | 3300025972 | Ga0207668_10553129 | Ga0207668_105531291 | 176 |
| 557 | 3300025972 | Ga0207668_11167262 | Ga0207668_111672621 | 176 |
| 558 | 3300025981 | Ga0207640_10003456 | Ga0207640_100034565 | 176 |
| 559 | 3300025981 | Ga0207640_10016573 | Ga0207640_100165732 | 176 |
| 560 | 3300025981 | Ga0207640_10032474 | Ga0207640_100324744 | 176 |
| 561 | 3300025981 | Ga0207640_10063766 | Ga0207640_100637664 | 176 |
| 562 | 3300025981 | Ga0207640_10437907 | Ga0207640_104379072 | 176 |
| 563 | 3300025981 | Ga0207640_10481123 | Ga0207640_104811232 | 176 |
| 564 | 3300025986 | Ga0207658_10072424 | Ga0207658_100724242 | 176 |
| 565 | 3300026023 | Ga0207677_10010698 | Ga0207677_100106985 | 176 |
| 566 | 3300026023 | Ga0207677_10040352 | Ga0207677_100403522 | 176 |
| 567 | 3300026023 | Ga0207677_10054814 | Ga0207677_100548142 | 176 |
| 568 | 3300026023 | Ga0207677_10064273 | Ga0207677_100642734 | 176 |
| 569 | 3300026023 | Ga0207677_10088538 | Ga0207677_100885383 | 176 |
| 570 | 3300026023 | Ga0207677_10090022 | Ga0207677_100900222 | 176 |
| 571 | 3300026023 | Ga0207677_10112481 | Ga0207677_101124812 | 176 |
| 572 | 3300026023 | Ga0207677_10184758 | Ga0207677_101847582 | 176 |
| 573 | 3300026035 | Ga0207703_10028509 | Ga0207703_100285092 | 176 |
| 574 | 3300026035 | Ga0207703_10135891 | Ga0207703_101358911 | 176 |
| 575 | 3300026035 | Ga0207703_10179676 | Ga0207703_101796763 | 176 |
| 576 | 3300026035 | Ga0207703_10421016 | Ga0207703_104210161 | 176 |
| 577 | 3300026041 | Ga0207639_10001622 | Ga0207639_100016226 | 176 |
| 578 | 3300026041 | Ga0207639_10037672 | Ga0207639_100376724 | 176 |
| 579 | 3300026041 | Ga0207639_10104297 | Ga0207639_101042972 | 176 |
| 580 | 3300026041 | Ga0207639_10477092 | Ga0207639_104770922 | 176 |
| 581 | 3300026041 | Ga0207639_10680959 | Ga0207639_106809591 | 176 |
| 582 | 3300026041 | Ga0207639_10962130 | Ga0207639_109621302 | 176 |
| 583 | 3300026041 | Ga0207639_10975205 | Ga0207639_109752051 | 176 |
| 584 | 3300026067 | Ga0207678_10000169 | Ga0207678_1000016916 | 176 |
| 585 | 3300026067 | Ga0207678_10215040 | Ga0207678_102150403 | 176 |
| 586 | 3300026067 | Ga0207678_10950858 | Ga0207678_109508581 | 176 |
| 587 | 3300026078 | Ga0207702_10000114 | Ga0207702_1000011422 | 176 |
| 588 | 3300026078 | Ga0207702_10001495 | Ga0207702_100014956 | 176 |
| 589 | 3300026078 | Ga0207702_10007437 | Ga0207702_100074377 | 176 |
| 590 | 3300026078 | Ga0207702_10090167 | Ga0207702_100901672 | 176 |
| 591 | 3300026078 | Ga0207702_10151691 | Ga0207702_101516911 | 176 |
| 592 | 3300026078 | Ga0207702_10184342 | Ga0207702_101843421 | 176 |
| 593 | 3300026078 | Ga0207702_10520069 | Ga0207702_105200692 | 176 |
| 594 | 3300026088 | Ga0207641_10210909 | Ga0207641_102109093 | 176 |
| 595 | 3300026089 | Ga0207648_10000215 | Ga0207648_1000021539 | 176 |
| 596 | 3300026089 | Ga0207648_10016987 | Ga0207648_100169874 | 176 |
| 597 | 3300026089 | Ga0207648_10026158 | Ga0207648_100261585 | 176 |
| 598 | 3300026089 | Ga0207648_10037810 | Ga0207648_100378102 | 176 |
| 599 | 3300026089 | Ga0207648_10040178 | Ga0207648_100401782 | 176 |
| 600 | 3300026089 | Ga0207648_10160347 | Ga0207648_101603472 | 176 |
| 601 | 3300026095 | Ga0207676_10002123 | Ga0207676_100021238 | 176 |
| 602 | 3300026095 | Ga0207676_10011474 | Ga0207676_100114745 | 176 |
| 603 | 3300026095 | Ga0207676_10036414 | Ga0207676_100364145 | 176 |
| 604 | 3300026095 | Ga0207676_10072642 | Ga0207676_100726422 | 176 |
| 605 | 3300026095 | Ga0207676_10147703 | Ga0207676_101477031 | 176 |
| 606 | 3300026095 | Ga0207676_10622601 | Ga0207676_106226012 | 176 |
| 607 | 3300026116 | Ga0207674_10000860 | Ga0207674_100008608 | 176 |
| 608 | 3300026116 | Ga0207674_10001389 | Ga0207674_1000138926 | 176 |
| 609 | 3300026116 | Ga0207674_10005344 | Ga0207674_100053444 | 176 |
| 610 | 3300026116 | Ga0207674_10007882 | Ga0207674_1000788210 | 176 |
| 611 | 3300026116 | Ga0207674_10231091 | Ga0207674_102310912 | 176 |
| 612 | 3300026118 | Ga0207675_100009538 | Ga0207675_1000095384 | 176 |
| 613 | 3300026118 | Ga0207675_100010295 | Ga0207675_1000102955 | 176 |
| 614 | 3300026118 | Ga0207675_100014105 | Ga0207675_1000141055 | 176 |
| 615 | 3300026118 | Ga0207675_100871895 | Ga0207675_1008718951 | 176 |
| 616 | 3300026118 | Ga0207675_101245471 | Ga0207675_1012454712 | 176 |
| 617 | 3300026121 | Ga0207683_10001515 | Ga0207683_100015157 | 176 |
| 618 | 3300026121 | Ga0207683_10054140 | Ga0207683_100541402 | 176 |
| 619 | 3300026142 | Ga0207698_10007054 | Ga0207698_100070542 | 176 |
| 620 | 3300026142 | Ga0207698_10070942 | Ga0207698_100709422 | 176 |
| 621 | 3300026142 | Ga0207698_10115980 | Ga0207698_101159802 | 176 |
| 622 | 3300026142 | Ga0207698_10570894 | Ga0207698_105708942 | 176 |
| 623 | 3300028379 | Ga0268266_10009490 | Ga0268266_100094904 | 176 |
| 624 | 3300028379 | Ga0268266_10049630 | Ga0268266_100496302 | 176 |
| 625 | 3300028379 | Ga0268266_10656520 | Ga0268266_106565202 | 176 |
| 626 | 3300028380 | Ga0268265_10463515 | Ga0268265_104635152 | 176 |
| 627 | 3300028380 | Ga0268265_11013948 | Ga0268265_110139481 | 176 |
| 628 | 3300028381 | Ga0268264_10054667 | Ga0268264_100546675 | 176 |
| 629 | 3300028381 | Ga0268264_10099321 | Ga0268264_100993211 | 176 |
| 630 | 3300028381 | Ga0268264_10155474 | Ga0268264_101554742 | 176 |
| 631 | 3300034816 | Ga0373930_0010220 | Ga0373930_0010220_474_1007 | 176 |
| 632 | 3300034816 | Ga0373930_0061177 | Ga0373930_0061177_211_756 | 176 |
| 633 | 3300034817 | Ga0373948_0023368 | Ga0373948_0023368_243_776 | 176 |
| 634 | 3300034818 | Ga0373950_0029163 | Ga0373950_0029163_440_973 | 176 |
| 635 | 3300035085 | Ga0373929_0072675 | Ga0373929_0072675_77_610 | 176 |
| 636 | 3300035090 | Ga0373949_0057033 | Ga0373949_0057033_327_860 | 176 |
| 637 | 3300035091 | Ga0373951_0137356 | Ga0373951_0137356_115_648 | 176 |
| 638 | 3300035113 | Ga0373936_0071568 | Ga0373936_0071568_370_903 | 176 |
| 639 | 3300035114 | Ga0373939_0048312 | Ga0373939_0048312_261_794 | 176 |
| 640 | 3300035114 | Ga0373939_0191839 | Ga0373939_0191839_95_628 | 176 |
| 641 | 3300035115 | Ga0373941_0306336 | Ga0373941_0306336_83_616 | 176 |
| 642 | 3300035121 | Ga0373960_0009147 | Ga0373960_0009147_115_648 | 176 |
| 643 | 3300035170 | Ga0373943_0020134 | Ga0373943_0020134_1010_1543 | 176 |
| 644 | 3300035170 | Ga0373943_0082225 | Ga0373943_0082225_143_676 | 176 |
| 645 | 3300035241 | Ga0373961_0078557 | Ga0373961_0078557_78_611 | 176 |
| 646 | 3300035242 | Ga0373962_0117228 | Ga0373962_0117228_254_787 | 176 |
| 647 | 3300035691 | Ga0373931_0051116 | Ga0373931_0051116_1490_2023 | 176 |
| 648 | 3300035691 | Ga0373931_0195897 | Ga0373931_0195897_431_1000 | 176 |
| 649 | 3300035692 | Ga0373935_0407815 | Ga0373935_0407815_165_698 | 176 |
| 650 | 3300035692 | Ga0373935_0436448 | Ga0373935_0436448_227_760 | 176 |
| 651 | 3300035695 | Ga0373927_0066421 | Ga0373927_0066421_21_560 | 176 |
| 652 | 3300035695 | Ga0373927_0103828 | Ga0373927_0103828_153_686 | 176 |
| 653 | 3300035695 | Ga0373927_0109300 | Ga0373927_0109300_28_561 | 176 |
| 654 | 3300035695 | Ga0373927_0233802 | Ga0373927_0233802_263_796 | 176 |
| 655 | 3300035725 | Ga0373947_0004931 | Ga0373947_0004931_1020_1553 | 176 |
| 656 | 3300036401 | Ga0373937_0019513 | Ga0373937_0019513_2724_3269 | 176 |
| 657 | 3300036401 | Ga0373937_0064885 | Ga0373937_0064885_100_633 | 176 |
| 658 | 3300037068 | Ga0373925_0002528 | Ga0373925_0002528_1266_1799 | 176 |
| 659 | 3300037068 | Ga0373925_0003931 | Ga0373925_0003931_4126_4659 | 176 |
| 660 | 3300038996 | Ga0242420_032641 | Ga0242420_032641_126_659 | 176 |
| 661 | 3300039450 | Ga0436363_0138485 | Ga0436363_0138485_104_640 | 176 |
| 662 | 3300039450 | Ga0436363_0452538 | Ga0436363_0452538_469_1050 | 176 |
| 663 | 3300042876 | Ga0451577_0865583 | Ga0451577_0865583_149_682 | 176 |
| 664 | 3300045051 | Ga0451576_0448547 | Ga0451576_0448547_541_1137 | 176 |
| 665 | 3300045976 | Ga0466967_0440923 | Ga0466967_0440923_539_1072 | 176 |
| 666 | 3300046471 | Ga0495650_0017412 | Ga0495650_0017412_1919_2449 | 176 |
| 667 | 3300046472 | Ga0495580_0000068 | Ga0495580_0000068_27347_27886 | 176 |
| 668 | 3300046472 | Ga0495580_0016338 | Ga0495580_0016338_4666_5199 | 176 |
| 669 | 3300046472 | Ga0495580_0765153 | Ga0495580_0765153_55_597 | 176 |
| 670 | 3300046473 | Ga0495582_0000291 | Ga0495582_0000291_16777_17310 | 176 |
| 671 | 3300046524 | Ga0495648_0161115 | Ga0495648_0161115_251_826 | 176 |
| 672 | 3300046526 | Ga0495666_0081374 | Ga0495666_0081374_987_1520 | 176 |
| 673 | 3300046665 | Ga0495661_0018438 | Ga0495661_0018438_3847_4422 | 176 |
| 674 | 3300046674 | Ga0495588_0085859 | Ga0495588_0085859_445_978 | 176 |
| 675 | 3300047315 | Ga0495581_0144563 | Ga0495581_0144563_101_634 | 176 |
| 676 | 3300047317 | Ga0495604_0347772 | Ga0495604_0347772_427_960 | 176 |
| 677 | 3300047317 | Ga0495604_0641971 | Ga0495604_0641971_67_612 | 176 |
| 678 | 3300047319 | Ga0495674_0103640 | Ga0495674_0103640_247_780 | 176 |
| 679 | 3300047444 | Ga0495675_0424266 | Ga0495675_0424266_158_703 | 176 |
| 680 | 3300047469 | Ga0495673_0027796 | Ga0495673_0027796_1785_2360 | 176 |
| 681 | 3300048088 | Ga0495602_0090848 | Ga0495602_0090848_447_992 | 176 |
| 682 | 3300048903 | Ga0496100_0013016 | Ga0496100_0013016_3911_4453 | 176 |
| 683 | 3300048905 | Ga0496102_0055044 | Ga0496102_0055044_209_751 | 176 |
| 684 | 3300048905 | Ga0496102_0082857 | Ga0496102_0082857_198_731 | 176 |
| 685 | 3300048907 | Ga0496104_0175175 | Ga0496104_0175175_1145_1738 | 176 |
| 686 | 3300048907 | Ga0496104_0310504 | Ga0496104_0310504_786_1319 | 176 |
| 687 | 3300048907 | Ga0496104_0387683 | Ga0496104_0387683_50_592 | 176 |
| 688 | 3300048908 | Ga0496105_0123282 | Ga0496105_0123282_863_1405 | 176 |
| 689 | 3300048908 | Ga0496105_0686701 | Ga0496105_0686701_208_741 | 176 |
| 690 | 3300048908 | Ga0496105_0757091 | Ga0496105_0757091_22_615 | 176 |
| 691 | 3300048909 | Ga0496106_0171922 | Ga0496106_0171922_912_1454 | 176 |
| 692 | 3300048909 | Ga0496106_0324021 | Ga0496106_0324021_330_863 | 176 |
| 693 | 3300048910 | Ga0496107_0445557 | Ga0496107_0445557_53_586 | 176 |
| 694 | 3300048912 | Ga0496109_1044853 | Ga0496109_1044853_83_616 | 176 |
| 695 | 3300048913 | Ga0496110_0013298 | Ga0496110_0013298_4396_4926 | 176 |
| 696 | 3300048913 | Ga0496110_0059899 | Ga0496110_0059899_1235_1777 | 176 |
| 697 | 3300048914 | Ga0496111_0721866 | Ga0496111_0721866_54_584 | 176 |
| 698 | 3300048915 | Ga0496112_0010933 | Ga0496112_0010933_1980_2513 | 176 |
| 699 | 3300048915 | Ga0496112_0011133 | Ga0496112_0011133_4750_5343 | 176 |
| 700 | 3300048915 | Ga0496112_0093619 | Ga0496112_0093619_2413_2946 | 176 |
| 701 | 3300048915 | Ga0496112_0333281 | Ga0496112_0333281_790_1335 | 176 |
| 702 | 3300048915 | Ga0496112_0348878 | Ga0496112_0348878_721_1263 | 176 |
| 703 | 3300048915 | Ga0496112_0795584 | Ga0496112_0795584_72_605 | 176 |
| 704 | 3300048918 | Ga0496115_0144082 | Ga0496115_0144082_802_1395 | 176 |
| 705 | 3300048918 | Ga0496115_0170915 | Ga0496115_0170915_973_1506 | 176 |
| 706 | 3300048918 | Ga0496115_0216962 | Ga0496115_0216962_776_1309 | 176 |
| 707 | 3300050512 | nmdc:mga0n895_123205_c1 | nmdc:mga0n895_123205_c1_425_958 | 176 |
| 708 | 3300050513 | nmdc:mga0rr50_124073_c2 | nmdc:mga0rr50_124073_c2_736_1269 | 176 |
| 709 | 3300050513 | nmdc:mga0rr50_32577_c1 | nmdc:mga0rr50_32577_c1_2468_3007 | 176 |
| 710 | 3300050513 | nmdc:mga0rr50_4897_c1 | nmdc:mga0rr50_4897_c1_5876_6409 | 176 |
| 711 | 3300050514 | nmdc:mga08x19_859_c1 | nmdc:mga08x19_859_c1_1848_2381 | 176 |
| 712 | 3300050514 | nmdc:mga08x19_9722_c1 | nmdc:mga08x19_9722_c1_1328_1867 | 176 |
| 713 | 3300053077 | Ga0495601_0264188 | Ga0495601_0264188_461_994 | 176 |
| 714 | 3300053093 | Ga0500651_0000007 | Ga0500651_0000007_246341_246916 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rxq-assembly1.cif.gz_B | yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology | 0.7078 | 21 | 170 |
| 6o6m-assembly1.cif.gz_C | the structure of egtb (cabther) | 0.6897 | 27 | 165 |
| 3cex-assembly1.cif.gz_A | crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis | 0.6816 | 23 | 164 |
| 2p1a-assembly1.cif.gz_A | crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution | 0.6816 | 26 | 162 |
| 6o6l-assembly1.cif.gz_C | the structure of egtb(cabther) in complex with hercynine | 0.6757 | 27 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05777_10_164_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.706 | 27 | 159 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6975 | 21 | 170 | 1.20.120.450 |
| 2nsgA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6791 | 23 | 159 | 1.20.120.450 |
| af_P71985_5_134_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6743 | 30 | 162 | 1.20.120.450 |
| 5civA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6706 | 23 | 166 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7V3R7-F1-model_v4 | DinB-like domain-containing protein | 0.9869 | 20 | 176 |
|
| AF-A0A3D5KL48-F1-model_v4 | DinB-like domain-containing protein | 0.9768 | 21 | 176 |
|
| AF-A0A847RJ41-F1-model_v4 | DinB family protein | 0.9717 | 20 | 176 |
|
| AF-A0A358G9T4-F1-model_v4 | deleted | 0.9707 | 26 | 170 |
|
| AF-A0A7Y4VIN9-F1-model_v4 | DinB family protein | 0.9613 | 24 | 175 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar