F476959

General Info

Members Datasets Scaffolds Average Seq Length
714 235 714 179

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0083038|Ga0466966_0083038_1027_1629
Length 200
Sequence MLPECQVIRLNLFCFLEEEPPMKVTFLCLVLVVSTVSFAQQQDQSHKPAPTLKSILLEQLHSTHDKAEWFVPANTAIEGLTAEQASWTDGKNHSVGQLVNHLVYWDRRALEKFKGEPQDKYSGNNDDTFKFDPKQWNDSVKQLDAVMTEWEKAVESADEAKLKDWYSTIAHIGTHNAYHIGEIVMVRKEQGSWNPDKGVK

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 3.5
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10007720 3300002077 Bacteria 2223
2 Ga0065717_1010914 3300005276 Bacteria 608
3 Ga0065712_10077580 3300005290 Bacteria 3473
4 Ga0065712_10082421 3300005290 Bacteria 2917
5 Ga0065715_10101713 3300005293 Bacteria 3178
6 Ga0065715_10390192 3300005293 Bacteria 875
7 Ga0070676_10003926 3300005328 Bacteria 7802
8 Ga0070676_10903459 3300005328 Bacteria 658
9 Ga0070683_100000439 3300005329 Bacteria 28892
10 Ga0070683_100001669 3300005329 Bacteria 17224
11 Ga0070683_100405725 3300005329 Bacteria 1300
12 Ga0070690_100016990 3300005330 Bacteria 4368
13 Ga0070690_100118697 3300005330 Bacteria 1773
14 Ga0070670_100072103 3300005331 Unclassified 2966
15 Ga0070670_100093434 3300005331 Bacteria 2587
16 Ga0070670_100130310 3300005331 Unclassified 2171
17 Ga0068869_100002672 3300005334 Bacteria 10776
18 Ga0068869_100006472 3300005334 Bacteria 7433
19 Ga0068869_100006858 3300005334 Bacteria 7245
20 Ga0068869_100044611 3300005334 Bacteria 3188
21 Ga0068869_100461574 3300005334 Bacteria 1054
22 Ga0070666_10081321 3300005335 Bacteria 2215
23 Ga0070666_10135622 3300005335 Bacteria 1712
24 Ga0070666_10406230 3300005335 Bacteria 980
25 Ga0070666_10544469 3300005335 Bacteria 844
26 Ga0070680_100265908 3300005336 Unclassified 1451
27 Ga0070682_100060753 3300005337 Bacteria 2390
28 Ga0070682_100280608 3300005337 Unclassified 1214
29 Ga0070682_100614700 3300005337 Bacteria 860
30 Ga0068868_100000658 3300005338 Bacteria 23281
31 Ga0068868_100007650 3300005338 Bacteria 7706
32 Ga0068868_100009529 3300005338 Bacteria 6996
33 Ga0068868_100033454 3300005338 Bacteria 3963
34 Ga0068868_100057200 3300005338 Unclassified 3080
35 Ga0068868_100353698 3300005338 Bacteria 1259
36 Ga0068868_100566989 3300005338 Bacteria 1002
37 Ga0070660_100491283 3300005339 Bacteria 1021
38 Ga0070660_100584770 3300005339 Bacteria 933
39 Ga0070689_100141020 3300005340 Bacteria 1938
40 Ga0070689_100468845 3300005340 Bacteria 1074
41 Ga0070691_10038523 3300005341 Bacteria 2257
42 Ga0070661_100001766 3300005344 Bacteria 14999
43 Ga0070661_100017243 3300005344 Bacteria 5120
44 Ga0070661_100082543 3300005344 Bacteria 2373
45 Ga0070661_100092139 3300005344 Unclassified 2245
46 Ga0070661_100092968 3300005344 Bacteria 2235
47 Ga0070661_100236532 3300005344 Bacteria 1405
48 Ga0070692_10625789 3300005345 Unclassified 715
49 Ga0070668_100044661 3300005347 Bacteria 3399
50 Ga0070668_100101299 3300005347 Bacteria 2282
51 Ga0070668_100124256 3300005347 Bacteria 2066
52 Ga0070669_100594973 3300005353 Unclassified 926
53 Ga0070675_100022209 3300005354 Bacteria 5068
54 Ga0070675_100022283 3300005354 Bacteria 5060
55 Ga0070675_100065479 3300005354 Bacteria 3005
56 Ga0070671_100295330 3300005355 Bacteria 1379
57 Ga0070671_100814932 3300005355 Bacteria 813
58 Ga0070674_100028133 3300005356 Bacteria 3690
59 Ga0070674_100031914 3300005356 Bacteria 3495
60 Ga0070674_100064152 3300005356 Bacteria 2573
61 Ga0070673_100004642 3300005364 Bacteria 8714
62 Ga0070673_100023639 3300005364 Bacteria 4493
63 Ga0070673_100137488 3300005364 Bacteria 2058
64 Ga0070673_100189398 3300005364 Bacteria 1766
65 Ga0070673_100474440 3300005364 Bacteria 1128
66 Ga0070688_100091432 3300005365 Bacteria 1989
67 Ga0070688_100299138 3300005365 Bacteria 1163
68 Ga0070659_100009116 3300005366 Bacteria 7277
69 Ga0070659_100100450 3300005366 Unclassified 2328
70 Ga0070659_100743739 3300005366 Bacteria 850
71 Ga0070667_100084351 3300005367 Bacteria 2723
72 Ga0070667_100123158 3300005367 Bacteria 2257
73 Ga0070667_100437789 3300005367 Bacteria 1193
74 Ga0070709_10018590 3300005434 Bacteria 4005
75 Ga0070709_10162196 3300005434 Bacteria 1555
76 Ga0070714_100072039 3300005435 Unclassified 2990
77 Ga0070714_100289136 3300005435 Bacteria 1525
78 Ga0070714_101284846 3300005435 Bacteria 714
79 Ga0070713_100031800 3300005436 Bacteria 4207
80 Ga0070713_100065686 3300005436 Bacteria 3049
81 Ga0070713_100277971 3300005436 Bacteria 1535
82 Ga0070713_100561279 3300005436 Bacteria 1082
83 Ga0070713_100952531 3300005436 Bacteria 827
84 Ga0070711_100186715 3300005439 Bacteria 1590
85 Ga0070711_100186915 3300005439 Bacteria 1589
86 Ga0070705_100053017 3300005440 Unclassified 2372
87 Ga0070694_100543052 3300005444 Bacteria 930
88 Ga0070708_101000257 3300005445 Unclassified 784
89 Ga0070663_100263278 3300005455 Bacteria 1368
90 Ga0070663_100306396 3300005455 Unclassified 1273
91 Ga0070663_100565122 3300005455 Bacteria 952
92 Ga0070678_100001043 3300005456 Bacteria 14485
93 Ga0070678_100083670 3300005456 Unclassified 2426
94 Ga0070678_100173837 3300005456 Bacteria 1757
95 Ga0070678_100515140 3300005456 Unclassified 1057
96 Ga0070662_100031224 3300005457 Unclassified 3737
97 Ga0070662_100043320 3300005457 Bacteria 3220
98 Ga0070662_100063217 3300005457 Unclassified 2707
99 Ga0070662_100074027 3300005457 Bacteria 2518
100 Ga0070662_100120781 3300005457 Bacteria 2008
101 Ga0070662_100177982 3300005457 Bacteria 1675
102 Ga0070662_100343101 3300005457 Bacteria 1222
103 Ga0070681_10000026 3300005458 Bacteria 107615
104 Ga0070681_10003878 3300005458 Bacteria 14076
105 Ga0070681_10054805 3300005458 Unclassified 3973
106 Ga0070681_10176517 3300005458 Unclassified 2058
107 Ga0070681_10706160 3300005458 Unclassified 924
108 Ga0068867_100014983 3300005459 Bacteria 5496
109 Ga0068867_100016165 3300005459 Bacteria 5300
110 Ga0068867_100021678 3300005459 Unclassified 4584
111 Ga0068867_100061602 3300005459 Bacteria 2786
112 Ga0068867_100087321 3300005459 Bacteria 2361
113 Ga0068867_100406178 3300005459 Bacteria 1150
114 Ga0068867_100870697 3300005459 Bacteria 808
115 Ga0070685_10017481 3300005466 Unclassified 3839
116 Ga0070685_10080072 3300005466 Bacteria 1956
117 Ga0070685_10308959 3300005466 Bacteria 1068
118 Ga0070685_11096212 3300005466 Unclassified 601
119 Ga0070699_101066320 3300005518 Bacteria 741
120 Ga0070679_100028098 3300005530 Bacteria 5543
121 Ga0070679_100051762 3300005530 Unclassified 4090
122 Ga0070679_100060685 3300005530 Unclassified 3768
123 Ga0070679_100112824 3300005530 Unclassified 2704
124 Ga0070679_100386572 3300005530 Bacteria 1346
125 Ga0070679_100681135 3300005530 Unclassified 971
126 Ga0070684_100000465 3300005535 Bacteria 27738
127 Ga0070684_100003698 3300005535 Bacteria 11540
128 Ga0070684_100040832 3300005535 Bacteria 3997
129 Ga0070684_100121704 3300005535 Unclassified 2348
130 Ga0070684_100340166 3300005535 Bacteria 1379
131 Ga0070684_100587368 3300005535 Unclassified 1035
132 Ga0070684_101213773 3300005535 Unclassified 709
133 Ga0068853_100006912 3300005539 Bacteria 9059
134 Ga0068853_100010347 3300005539 Bacteria 7546
135 Ga0068853_100118535 3300005539 Bacteria 2359
136 Ga0068853_100123827 3300005539 Bacteria 2308
137 Ga0068853_100723423 3300005539 Unclassified 950
138 Ga0070672_100008231 3300005543 Bacteria 7125
139 Ga0070672_100198115 3300005543 Bacteria 1679
140 Ga0070672_100265370 3300005543 Bacteria 1449
141 Ga0070686_100010119 3300005544 Bacteria 5307
142 Ga0070686_100333134 3300005544 Bacteria 1135
143 Ga0070695_100143711 3300005545 Bacteria 1657
144 Ga0070695_100784392 3300005545 Unclassified 762
145 Ga0070696_100188444 3300005546 Bacteria 1534
146 Ga0070696_100341319 3300005546 Bacteria 1157
147 Ga0070693_100013377 3300005547 Bacteria 4178
148 Ga0070693_100072316 3300005547 Bacteria 2034
149 Ga0070665_100014552 3300005548 Bacteria 7894
150 Ga0070665_100022144 3300005548 Bacteria 6392
151 Ga0070665_100043681 3300005548 Bacteria 4502
152 Ga0070665_100047875 3300005548 Bacteria 4291
153 Ga0070665_100433939 3300005548 Bacteria 1323
154 Ga0070704_100387655 3300005549 Bacteria 1189
155 Ga0068855_100000295 3300005563 Bacteria 61909
156 Ga0068855_100054917 3300005563 Unclassified 4680
157 Ga0068855_100118543 3300005563 Bacteria 3031
158 Ga0068855_100130686 3300005563 Bacteria 2868
159 Ga0068855_100160629 3300005563 Bacteria 2551
160 Ga0068855_100269775 3300005563 Bacteria 1892
161 Ga0068855_100391523 3300005563 Unclassified 1524
162 Ga0068855_100961597 3300005563 Bacteria 899
163 Ga0070664_100000687 3300005564 Bacteria 25824
164 Ga0070664_100001035 3300005564 Bacteria 21877
165 Ga0070664_100004076 3300005564 Bacteria 11741
166 Ga0070664_100054439 3300005564 Bacteria 3394
167 Ga0070664_100211038 3300005564 Bacteria 1735
168 Ga0070664_100223656 3300005564 Bacteria 1685
169 Ga0070664_100331997 3300005564 Bacteria 1380
170 Ga0070664_100357807 3300005564 Unclassified 1329
171 Ga0070664_100749655 3300005564 Unclassified 911
172 Ga0068857_100001872 3300005577 Bacteria 16933
173 Ga0068857_100010663 3300005577 Bacteria 7994
174 Ga0068857_100112800 3300005577 Bacteria 2444
175 Ga0068857_100326756 3300005577 Unclassified 1417
176 Ga0068854_100023329 3300005578 Unclassified 4225
177 Ga0068854_100028511 3300005578 Bacteria 3858
178 Ga0068854_100029319 3300005578 Bacteria 3809
179 Ga0068854_100044525 3300005578 Bacteria 3151
180 Ga0068854_100147897 3300005578 Unclassified 1809
181 Ga0068854_100166195 3300005578 Bacteria 1713
182 Ga0068854_100369980 3300005578 Unclassified 1178
183 Ga0068854_100871739 3300005578 Unclassified 789
184 Ga0068856_100000407 3300005614 Bacteria 47326
185 Ga0068856_100001013 3300005614 Bacteria 29894
186 Ga0068856_100002064 3300005614 Bacteria 20820
187 Ga0068856_100006032 3300005614 Bacteria 11919
188 Ga0068856_100183456 3300005614 Bacteria 2106
189 Ga0068856_100344577 3300005614 Bacteria 1508
190 Ga0068856_100543346 3300005614 Bacteria 1183
191 Ga0068856_100579749 3300005614 Bacteria 1143
192 Ga0068856_101385317 3300005614 Unclassified 718
193 Ga0070702_100254863 3300005615 Unclassified 1191
194 Ga0068852_100007347 3300005616 Bacteria 8039
195 Ga0068852_100007670 3300005616 Bacteria 7894
196 Ga0068852_100044428 3300005616 Bacteria 3773
197 Ga0068852_100049918 3300005616 Bacteria 3582
198 Ga0068852_100189892 3300005616 Bacteria 1938
199 Ga0068859_100007556 3300005617 Bacteria 11039
200 Ga0068859_100039953 3300005617 Unclassified 4709
201 Ga0068859_100045630 3300005617 Bacteria 4402
202 Ga0068859_100071863 3300005617 Bacteria 3495
203 Ga0068859_100109212 3300005617 Bacteria 2827
204 Ga0068859_100148912 3300005617 Bacteria 2416
205 Ga0068859_100313329 3300005617 Unclassified 1663
206 Ga0068864_100000684 3300005618 Bacteria 28437
207 Ga0068864_100049730 3300005618 Bacteria 3607
208 Ga0068864_100079208 3300005618 Unclassified 2876
209 Ga0068864_100079900 3300005618 Unclassified 2864
210 Ga0068864_100429102 3300005618 Unclassified 1261
211 Ga0068864_100568977 3300005618 Bacteria 1097
212 Ga0068866_10011392 3300005718 Bacteria 3846
213 Ga0068866_10021659 3300005718 Bacteria 2964
214 Ga0068866_10480212 3300005718 Unclassified 818
215 Ga0068861_100021088 3300005719 Bacteria 4681
216 Ga0068861_100102778 3300005719 Unclassified 2276
217 Ga0068861_100414988 3300005719 Bacteria 1198
218 Ga0068861_101442499 3300005719 Bacteria 674
219 Ga0068851_10042410 3300005834 Bacteria 2290
220 Ga0068851_10245406 3300005834 Bacteria 1014
221 Ga0068851_10365552 3300005834 Unclassified 842
222 Ga0068870_10029178 3300005840 Bacteria 2776
223 Ga0068870_10181939 3300005840 Bacteria 1262
224 Ga0068863_100012509 3300005841 Bacteria 8191
225 Ga0068863_100140708 3300005841 Unclassified 2306
226 Ga0068863_100194888 3300005841 Bacteria 1948
227 Ga0068863_100654988 3300005841 Bacteria 1042
228 Ga0068863_100854381 3300005841 Bacteria 909
229 Ga0068858_100003346 3300005842 Bacteria 15959
230 Ga0068858_100072193 3300005842 Bacteria 3202
231 Ga0068858_100324207 3300005842 Unclassified 1472
232 Ga0068858_100481620 3300005842 Bacteria 1198
233 Ga0068860_100035179 3300005843 Unclassified 4806
234 Ga0068860_100056788 3300005843 Bacteria 3720
235 Ga0068860_100227616 3300005843 Bacteria 1812
236 Ga0068862_100021645 3300005844 Bacteria 5375
237 Ga0068862_100195439 3300005844 Bacteria 1822
238 Ga0068862_100272876 3300005844 Bacteria 1547
239 Ga0068862_100330105 3300005844 Bacteria 1410
240 Ga0068862_100581094 3300005844 Bacteria 1073
241 Ga0070717_10010731 3300006028 Bacteria 6933
242 Ga0070717_10333161 3300006028 Bacteria 1354
243 Ga0070715_10056958 3300006163 Bacteria 1701
244 Ga0070716_100009551 3300006173 Unclassified 4836
245 Ga0070716_100635101 3300006173 Bacteria 808
246 Ga0070712_100005964 3300006175 Bacteria 7532
247 Ga0070712_100071582 3300006175 Bacteria 2481
248 Ga0070712_100211001 3300006175 Bacteria 1531
249 Ga0070712_100317898 3300006175 Unclassified 1265
250 Ga0097621_100000237 3300006237 Bacteria 37036
251 Ga0097621_100009029 3300006237 Bacteria 7219
252 Ga0097621_100064654 3300006237 Unclassified 3009
253 Ga0097621_100103936 3300006237 Unclassified 2393
254 Ga0097621_100278011 3300006237 Unclassified 1473
255 Ga0068871_100003099 3300006358 Bacteria 11410
256 Ga0068871_100006408 3300006358 Bacteria 8325
257 Ga0068871_100016523 3300006358 Bacteria 5562
258 Ga0068871_100165928 3300006358 Bacteria 1890
259 Ga0068871_100187497 3300006358 Bacteria 1780
260 Ga0068871_100331251 3300006358 Bacteria 1343
261 Ga0068871_100444894 3300006358 Unclassified 1160
262 Ga0068871_100457076 3300006358 Unclassified 1145
263 Ga0075433_10057134 3300006852 Bacteria 3410
264 Ga0075434_100001350 3300006871 Bacteria 20603
265 Ga0075434_100226311 3300006871 Bacteria 1890
266 Ga0068865_100024968 3300006881 Unclassified 3926
267 Ga0068865_100032844 3300006881 Bacteria 3471
268 Ga0068865_100105664 3300006881 Unclassified 2069
269 Ga0075436_100002468 3300006914 Bacteria 12728
270 Ga0075436_100130440 3300006914 Bacteria 1762
271 Ga0097620_100007556 3300006931 Bacteria 11039
272 Ga0097620_100039953 3300006931 Unclassified 4709
273 Ga0097620_100045632 3300006931 Bacteria 4402
274 Ga0097620_100071864 3300006931 Bacteria 3495
275 Ga0097620_100109207 3300006931 Bacteria 2827
276 Ga0097620_100148901 3300006931 Bacteria 2416
277 Ga0097620_100313354 3300006931 Unclassified 1663
278 Ga0075435_100011776 3300007076 Bacteria 6453
279 Ga0075435_100015353 3300007076 Bacteria 5755
280 Ga0075435_100052825 3300007076 Bacteria 3275
281 Ga0105240_10007038 3300009093 Bacteria 16411
282 Ga0105240_10055164 3300009093 Bacteria 4976
283 Ga0105240_10063883 3300009093 Unclassified 4577
284 Ga0105240_10129224 3300009093 Bacteria 3032
285 Ga0105240_11008696 3300009093 Bacteria 890
286 Ga0105245_10055245 3300009098 Bacteria 3566
287 Ga0105245_10238347 3300009098 Unclassified 1762
288 Ga0105247_10094861 3300009101 Bacteria 1899
289 Ga0105243_10091371 3300009148 Bacteria 2507
290 Ga0105241_10000910 3300009174 Bacteria 22369
291 Ga0105241_10019884 3300009174 Bacteria 4956
292 Ga0105241_10281093 3300009174 Unclassified 1421
293 Ga0105241_10344394 3300009174 Bacteria 1292
294 Ga0105241_10347552 3300009174 Unclassified 1287
295 Ga0105241_10450500 3300009174 Bacteria 1138
296 Ga0105241_10658902 3300009174 Bacteria 952
297 Ga0105241_10844327 3300009174 Unclassified 847
298 Ga0105241_11471527 3300009174 Bacteria 654
299 Ga0105241_11623752 3300009174 Bacteria 626
300 Ga0105242_10003970 3300009176 Bacteria 11497
301 Ga0105242_10097287 3300009176 Bacteria 2488
302 Ga0105242_10210822 3300009176 Bacteria 1731
303 Ga0105248_10013380 3300009177 Bacteria 9031
304 Ga0105248_10596332 3300009177 Bacteria 1246
305 Ga0105248_10750218 3300009177 Unclassified 1101
306 Ga0105248_11505879 3300009177 Unclassified 762
307 Ga0105237_10054633 3300009545 Bacteria 4002
308 Ga0105237_10087839 3300009545 Unclassified 3098
309 Ga0105237_10108580 3300009545 Bacteria 2766
310 Ga0105237_10224019 3300009545 Bacteria 1881
311 Ga0105238_10000848 3300009551 Bacteria 31448
312 Ga0105238_10388083 3300009551 Bacteria 1388
313 Ga0105238_10492092 3300009551 Bacteria 1226
314 Ga0105238_10559004 3300009551 Bacteria 1149
315 Ga0105238_11008434 3300009551 Unclassified 853
316 Ga0105238_11038324 3300009551 Unclassified 841
317 Ga0105249_10012196 3300009553 Bacteria 7570
318 Ga0105249_10191684 3300009553 Bacteria 1995
319 Ga0105249_10613708 3300009553 Bacteria 1143
320 Ga0105249_11111614 3300009553 Bacteria 860
321 Ga0105239_10059067 3300010375 Bacteria 4209
322 Ga0105239_10127297 3300010375 Unclassified 2832
323 Ga0105239_10130997 3300010375 Bacteria 2790
324 Ga0105239_10359565 3300010375 Bacteria 1644
325 Ga0105239_10526076 3300010375 Bacteria 1346
326 Ga0105239_10536837 3300010375 Bacteria 1331
327 Ga0105239_10731082 3300010375 Bacteria 1132
328 Ga0105239_11464716 3300010375 Unclassified 789
329 Ga0105246_10006095 3300011119 Bacteria 7357
330 Ga0105246_10208251 3300011119 Bacteria 1525
331 Ga0105246_10346833 3300011119 Bacteria 1215
332 Ga0157373_10001291 3300013100 Bacteria 19116
333 Ga0157373_10040106 3300013100 Unclassified 3351
334 Ga0157373_10339926 3300013100 Bacteria 1070
335 Ga0157371_10046079 3300013102 Bacteria 3102
336 Ga0157371_10056746 3300013102 Bacteria 2778
337 Ga0157371_10082079 3300013102 Unclassified 2282
338 Ga0157371_10122219 3300013102 Bacteria 1851
339 Ga0157371_10316645 3300013102 Bacteria 1132
340 Ga0157370_10161224 3300013104 Unclassified 2086
341 Ga0157370_10479605 3300013104 Bacteria 1143
342 Ga0157369_10000124 3300013105 Bacteria 110693
343 Ga0157369_10015527 3300013105 Bacteria 8582
344 Ga0157369_10026095 3300013105 Bacteria 6482
345 Ga0157369_10071837 3300013105 Bacteria 3714
346 Ga0157369_10115306 3300013105 Unclassified 2853
347 Ga0157369_10177446 3300013105 Bacteria 2242
348 Ga0157374_10000162 3300013296 Bacteria 61913
349 Ga0157374_10000260 3300013296 Bacteria 48732
350 Ga0157374_10000667 3300013296 Bacteria 30210
351 Ga0157374_10061972 3300013296 Bacteria 3504
352 Ga0157374_10062877 3300013296 Bacteria 3480
353 Ga0157374_10113041 3300013296 Bacteria 2614
354 Ga0157374_10176221 3300013296 Bacteria 2087
355 Ga0157374_10217011 3300013296 Bacteria 1876
356 Ga0157378_10000020 3300013297 Bacteria 131245
357 Ga0157378_10000320 3300013297 Bacteria 47177
358 Ga0157378_10003732 3300013297 Bacteria 13503
359 Ga0157378_10020404 3300013297 Bacteria 5828
360 Ga0157378_10030936 3300013297 Unclassified 4726
361 Ga0157378_10163701 3300013297 Bacteria 2082
362 Ga0157378_10377901 3300013297 Bacteria 1391
363 Ga0157378_12297806 3300013297 Unclassified 591
364 Ga0163162_10001370 3300013306 Bacteria 22646
365 Ga0163162_10071305 3300013306 Bacteria 3527
366 Ga0163162_10136942 3300013306 Bacteria 2560
367 Ga0163162_10259597 3300013306 Bacteria 1869
368 Ga0163162_10364810 3300013306 Bacteria 1577
369 Ga0157372_10000084 3300013307 Bacteria 98431
370 Ga0157372_10001112 3300013307 Bacteria 29221
371 Ga0157372_10005137 3300013307 Bacteria 13912
372 Ga0157372_10019034 3300013307 Bacteria 7391
373 Ga0157372_10064661 3300013307 Bacteria 4104
374 Ga0157372_10431044 3300013307 Unclassified 1537
375 Ga0157372_10438620 3300013307 Bacteria 1522
376 Ga0157372_10441710 3300013307 Bacteria 1516
377 Ga0157375_10030579 3300013308 Bacteria 5080
378 Ga0157375_10055033 3300013308 Bacteria 3921
379 Ga0157375_10057225 3300013308 Bacteria 3853
380 Ga0157375_10222957 3300013308 Bacteria 2044
381 Ga0157375_10277315 3300013308 Bacteria 1839
382 Ga0157375_10375116 3300013308 Bacteria 1589
383 Ga0157375_10499476 3300013308 Bacteria 1381
384 Ga0163163_10000279 3300014325 Bacteria 50882
385 Ga0163163_10025732 3300014325 Bacteria 5613
386 Ga0163163_10039831 3300014325 Bacteria 4587
387 Ga0163163_10054767 3300014325 Bacteria 3941
388 Ga0163163_10315674 3300014325 Unclassified 1616
389 Ga0163163_10514264 3300014325 Bacteria 1259
390 Ga0157380_10618263 3300014326 Bacteria 1075
391 Ga0157380_10768288 3300014326 Bacteria 977
392 Ga0157377_10086377 3300014745 Bacteria 1844
393 Ga0157377_10267143 3300014745 Unclassified 1115
394 Ga0157379_10009420 3300014968 Bacteria 8508
395 Ga0157379_10222569 3300014968 Bacteria 1710
396 Ga0157376_10001784 3300014969 Bacteria 14330
397 Ga0157376_10052979 3300014969 Bacteria 3376
398 Ga0157376_10105521 3300014969 Bacteria 2471
399 Ga0157376_10114169 3300014969 Bacteria 2383
400 Ga0157376_10118215 3300014969 Bacteria 2345
401 Ga0157376_10741383 3300014969 Bacteria 991
402 Ga0163161_10063746 3300017792 Bacteria 2687
403 Ga0206356_10848496 3300020070 Unclassified 1325
404 Ga0206352_10003278 3300020078 Unclassified 1321
405 Ga0206350_11157382 3300020080 Bacteria 2636
406 Ga0228598_1020574 3300024227 Bacteria 1299
407 Ga0207697_10077753 3300025315 Bacteria 1395
408 Ga0207656_10024326 3300025321 Bacteria 2448
409 Ga0207656_10297995 3300025321 Unclassified 798
410 Ga0207692_10111478 3300025898 Bacteria 1518
411 Ga0207642_10016359 3300025899 Bacteria 2792
412 Ga0207642_10262309 3300025899 Unclassified 985
413 Ga0207710_10043619 3300025900 Unclassified 1995
414 Ga0207710_10048241 3300025900 Bacteria 1905
415 Ga0207688_10249624 3300025901 Bacteria 1075
416 Ga0207680_10108006 3300025903 Unclassified 1799
417 Ga0207680_10388349 3300025903 Bacteria 985
418 Ga0207647_10000811 3300025904 Bacteria 24230
419 Ga0207647_10031767 3300025904 Unclassified 3396
420 Ga0207647_10050804 3300025904 Bacteria 2565
421 Ga0207685_10190684 3300025905 Bacteria 957
422 Ga0207699_10015704 3300025906 Bacteria 3940
423 Ga0207699_10111277 3300025906 Unclassified 1755
424 Ga0207645_10000352 3300025907 Bacteria 38310
425 Ga0207645_10006699 3300025907 Bacteria 8232
426 Ga0207645_10903948 3300025907 Bacteria 600
427 Ga0207643_10020036 3300025908 Bacteria 3669
428 Ga0207643_10182181 3300025908 Bacteria 1272
429 Ga0207643_10310993 3300025908 Unclassified 982
430 Ga0207654_10005785 3300025911 Bacteria 6243
431 Ga0207654_10014299 3300025911 Unclassified 4100
432 Ga0207654_10060351 3300025911 Unclassified 2215
433 Ga0207654_10838761 3300025911 Unclassified 665
434 Ga0207654_11035792 3300025911 Bacteria 597
435 Ga0207707_10000800 3300025912 Bacteria 30836
436 Ga0207707_10008961 3300025912 Bacteria 8693
437 Ga0207707_10217052 3300025912 Unclassified 1665
438 Ga0207695_10018259 3300025913 Bacteria 8116
439 Ga0207695_10028234 3300025913 Bacteria 6227
440 Ga0207695_10049830 3300025913 Bacteria 4410
441 Ga0207695_10251683 3300025913 Bacteria 1666
442 Ga0207695_10331371 3300025913 Bacteria 1411
443 Ga0207671_10124175 3300025914 Bacteria 1976
444 Ga0207671_10206640 3300025914 Bacteria 1535
445 Ga0207671_10266800 3300025914 Unclassified 1348
446 Ga0207671_10341064 3300025914 Bacteria 1187
447 Ga0207671_10467076 3300025914 Unclassified 1005
448 Ga0207693_10008124 3300025915 Bacteria 8602
449 Ga0207693_10047290 3300025915 Bacteria 3380
450 Ga0207663_10009352 3300025916 Bacteria 5173
451 Ga0207663_10550427 3300025916 Bacteria 902
452 Ga0207663_10608187 3300025916 Bacteria 859
453 Ga0207660_10019266 3300025917 Bacteria 4559
454 Ga0207660_10170724 3300025917 Bacteria 1683
455 Ga0207657_10000511 3300025919 Bacteria 41041
456 Ga0207657_10139632 3300025919 Bacteria 1980
457 Ga0207657_10639821 3300025919 Bacteria 828
458 Ga0207649_10011512 3300025920 Bacteria 4879
459 Ga0207649_10052726 3300025920 Bacteria 2524
460 Ga0207649_10064174 3300025920 Bacteria 2321
461 Ga0207649_10186401 3300025920 Bacteria 1456
462 Ga0207649_10246771 3300025920 Bacteria 1284
463 Ga0207652_10052324 3300025921 Bacteria 3504
464 Ga0207652_10116544 3300025921 Unclassified 2373
465 Ga0207652_10269909 3300025921 Bacteria 1534
466 Ga0207652_10408063 3300025921 Bacteria 1226
467 Ga0207681_10105969 3300025923 Bacteria 2036
468 Ga0207694_10000434 3300025924 Bacteria 38832
469 Ga0207694_10110025 3300025924 Unclassified 2191
470 Ga0207694_10145009 3300025924 Bacteria 1911
471 Ga0207694_10264756 3300025924 Bacteria 1409
472 Ga0207650_10054510 3300025925 Unclassified 2966
473 Ga0207650_10156952 3300025925 Bacteria 1800
474 Ga0207659_10010229 3300025926 Bacteria 5884
475 Ga0207659_10724358 3300025926 Bacteria 852
476 Ga0207687_10049346 3300025927 Bacteria 2927
477 Ga0207687_10155612 3300025927 Bacteria 1748
478 Ga0207700_10009126 3300025928 Bacteria 6176
479 Ga0207700_10049542 3300025928 Bacteria 3125
480 Ga0207700_10606809 3300025928 Bacteria 974
481 Ga0207700_10780386 3300025928 Unclassified 854
482 Ga0207664_10352790 3300025929 Bacteria 1302
483 Ga0207664_10663015 3300025929 Bacteria 938
484 Ga0207644_10128256 3300025931 Bacteria 1939
485 Ga0207644_10268855 3300025931 Bacteria 1365
486 Ga0207690_10075694 3300025932 Unclassified 2335
487 Ga0207690_10137393 3300025932 Bacteria 1796
488 Ga0207706_10000130 3300025933 Bacteria 81196
489 Ga0207706_10027916 3300025933 Bacteria 5045
490 Ga0207706_10048352 3300025933 Bacteria 3762
491 Ga0207706_10416760 3300025933 Bacteria 1163
492 Ga0207686_10014173 3300025934 Bacteria 4432
493 Ga0207686_10092146 3300025934 Bacteria 2003
494 Ga0207686_10731288 3300025934 Bacteria 789
495 Ga0207709_10281936 3300025935 Bacteria 1228
496 Ga0207670_10003459 3300025936 Bacteria 8372
497 Ga0207670_10374429 3300025936 Bacteria 1133
498 Ga0207670_10816103 3300025936 Unclassified 778
499 Ga0207669_10047774 3300025937 Bacteria 2538
500 Ga0207669_10152218 3300025937 Bacteria 1622
501 Ga0207669_10418956 3300025937 Bacteria 1053
502 Ga0207704_10008470 3300025938 Bacteria 4922
503 Ga0207704_10095104 3300025938 Unclassified 1969
504 Ga0207704_10344365 3300025938 Bacteria 1158
505 Ga0207704_10584758 3300025938 Bacteria 912
506 Ga0207665_10030987 3300025939 Bacteria 3538
507 Ga0207665_10083131 3300025939 Unclassified 2208
508 Ga0207665_10864263 3300025939 Bacteria 716
509 Ga0207691_10005179 3300025940 Bacteria 12588
510 Ga0207691_10017119 3300025940 Bacteria 6876
511 Ga0207711_10000861 3300025941 Bacteria 29357
512 Ga0207711_10004283 3300025941 Bacteria 12191
513 Ga0207711_10152720 3300025941 Bacteria 2085
514 Ga0207711_11421965 3300025941 Bacteria 636
515 Ga0207689_10000359 3300025942 Bacteria 42877
516 Ga0207689_10003205 3300025942 Bacteria 14988
517 Ga0207689_10005656 3300025942 Bacteria 11124
518 Ga0207689_10008141 3300025942 Bacteria 9142
519 Ga0207689_10009652 3300025942 Bacteria 8319
520 Ga0207689_10011318 3300025942 Bacteria 7653
521 Ga0207661_10024017 3300025944 Bacteria 4613
522 Ga0207661_10699493 3300025944 Bacteria 932
523 Ga0207679_10004667 3300025945 Bacteria 8536
524 Ga0207679_10008676 3300025945 Bacteria 6482
525 Ga0207679_10293350 3300025945 Unclassified 1399
526 Ga0207679_10483427 3300025945 Bacteria 1103
527 Ga0207667_10000213 3300025949 Bacteria 81973
528 Ga0207667_10003075 3300025949 Bacteria 20688
529 Ga0207667_10010912 3300025949 Bacteria 10588
530 Ga0207667_10049664 3300025949 Bacteria 4430
531 Ga0207667_10147138 3300025949 Unclassified 2425
532 Ga0207667_10447248 3300025949 Bacteria 1313
533 Ga0207667_11065785 3300025949 Bacteria 793
534 Ga0207667_11540263 3300025949 Bacteria 635
535 Ga0207651_10067945 3300025960 Unclassified 2510
536 Ga0207651_10159386 3300025960 Bacteria 1767
537 Ga0207651_10284412 3300025960 Bacteria 1368
538 Ga0207651_10523003 3300025960 Bacteria 1028
539 Ga0207712_10128852 3300025961 Bacteria 1925
540 Ga0207712_10486123 3300025961 Bacteria 1053
541 Ga0207712_10501308 3300025961 Bacteria 1038
542 Ga0207668_10034689 3300025972 Bacteria 3352
543 Ga0207668_10553129 3300025972 Bacteria 997
544 Ga0207668_11167262 3300025972 Unclassified 691
545 Ga0207640_10003456 3300025981 Bacteria 8506
546 Ga0207640_10016573 3300025981 Unclassified 4290
547 Ga0207640_10032474 3300025981 Bacteria 3237
548 Ga0207640_10063766 3300025981 Bacteria 2450
549 Ga0207640_10437907 3300025981 Unclassified 1074
550 Ga0207640_10481123 3300025981 Unclassified 1030
551 Ga0207658_10072424 3300025986 Bacteria 2612
552 Ga0207677_10010698 3300026023 Bacteria 5200
553 Ga0207677_10040352 3300026023 Bacteria 3076
554 Ga0207677_10054814 3300026023 Unclassified 2723
555 Ga0207677_10064273 3300026023 Bacteria 2555
556 Ga0207677_10088538 3300026023 Bacteria 2245
557 Ga0207677_10090022 3300026023 Unclassified 2229
558 Ga0207677_10112481 3300026023 Bacteria 2030
559 Ga0207677_10184758 3300026023 Unclassified 1643
560 Ga0207703_10028509 3300026035 Bacteria 4401
561 Ga0207703_10135891 3300026035 Unclassified 2128
562 Ga0207703_10179676 3300026035 Unclassified 1867
563 Ga0207703_10421016 3300026035 Bacteria 1243
564 Ga0207639_10001622 3300026041 Bacteria 15128
565 Ga0207639_10037672 3300026041 Bacteria 3593
566 Ga0207639_10104297 3300026041 Bacteria 2299
567 Ga0207639_10477092 3300026041 Bacteria 1136
568 Ga0207639_10680959 3300026041 Unclassified 953
569 Ga0207639_10962130 3300026041 Bacteria 799
570 Ga0207639_10975205 3300026041 Bacteria 793
571 Ga0207678_10000169 3300026067 Bacteria 54815
572 Ga0207678_10215040 3300026067 Bacteria 1645
573 Ga0207678_10331695 3300026067 Unclassified 1310
574 Ga0207678_10950858 3300026067 Unclassified 760
575 Ga0207678_11068388 3300026067 Unclassified 715
576 Ga0207702_10000114 3300026078 Bacteria 93951
577 Ga0207702_10001495 3300026078 Bacteria 23103
578 Ga0207702_10007437 3300026078 Bacteria 9347
579 Ga0207702_10090167 3300026078 Bacteria 2682
580 Ga0207702_10151691 3300026078 Unclassified 2108
581 Ga0207702_10184342 3300026078 Bacteria 1924
582 Ga0207702_10520069 3300026078 Bacteria 1162
583 Ga0207641_10210909 3300026088 Unclassified 1796
584 Ga0207648_10000215 3300026089 Bacteria 62218
585 Ga0207648_10016987 3300026089 Bacteria 6632
586 Ga0207648_10026158 3300026089 Bacteria 5188
587 Ga0207648_10037810 3300026089 Unclassified 4250
588 Ga0207648_10040178 3300026089 Unclassified 4111
589 Ga0207648_10160347 3300026089 Unclassified 1986
590 Ga0207676_10002123 3300026095 Bacteria 14348
591 Ga0207676_10011474 3300026095 Bacteria 6335
592 Ga0207676_10036414 3300026095 Unclassified 3743
593 Ga0207676_10072642 3300026095 Unclassified 2766
594 Ga0207676_10147703 3300026095 Bacteria 2021
595 Ga0207676_10622601 3300026095 Bacteria 1039
596 Ga0207674_10000860 3300026116 Bacteria 39670
597 Ga0207674_10001389 3300026116 Bacteria 31181
598 Ga0207674_10005344 3300026116 Bacteria 15272
599 Ga0207674_10007882 3300026116 Bacteria 12374
600 Ga0207674_10231091 3300026116 Bacteria 1797
601 Ga0207675_100009538 3300026118 Bacteria 9078
602 Ga0207675_100010295 3300026118 Bacteria 8762
603 Ga0207675_100014105 3300026118 Bacteria 7451
604 Ga0207675_100871895 3300026118 Unclassified 916
605 Ga0207675_101245471 3300026118 Bacteria 764
606 Ga0207683_10001515 3300026121 Bacteria 20921
607 Ga0207683_10054140 3300026121 Bacteria 3518
608 Ga0207698_10007054 3300026142 Bacteria 7036
609 Ga0207698_10070942 3300026142 Unclassified 2762
610 Ga0207698_10115980 3300026142 Bacteria 2256
611 Ga0207698_10570894 3300026142 Bacteria 1111
612 Ga0268266_10009490 3300028379 Bacteria 8561
613 Ga0268266_10049630 3300028379 Bacteria 3599
614 Ga0268266_10656520 3300028379 Bacteria 1009
615 Ga0268265_10463515 3300028380 Bacteria 1186
616 Ga0268265_11013948 3300028380 Unclassified 820
617 Ga0268264_10054667 3300028381 Unclassified 3334
618 Ga0268264_10099321 3300028381 Bacteria 2525
619 Ga0268264_10155474 3300028381 Bacteria 2055
620 Ga0265314_10019719 3300031711 Bacteria 5216
621 Ga0373930_0010220 3300034816 Bacteria 1674
622 Ga0373930_0061177 3300034816 Unclassified 840
623 Ga0373948_0023368 3300034817 Bacteria 1199
624 Ga0373950_0029163 3300034818 Bacteria 1014
625 Ga0373929_0072675 3300035085 Unclassified 825
626 Ga0373949_0057033 3300035090 Unclassified 997
627 Ga0373951_0137356 3300035091 Unclassified 676
628 Ga0373936_0071568 3300035113 Bacteria 1430
629 Ga0373939_0048312 3300035114 Bacteria 1311
630 Ga0373939_0191839 3300035114 Bacteria 768
631 Ga0373941_0306336 3300035115 Unclassified 635
632 Ga0373960_0009147 3300035121 Bacteria 2393
633 Ga0373943_0020134 3300035170 Unclassified 3074
634 Ga0373943_0082225 3300035170 Bacteria 1653
635 Ga0373961_0078557 3300035241 Unclassified 1034
636 Ga0373962_0117228 3300035242 Unclassified 846
637 Ga0373931_0051116 3300035691 Unclassified 2200
638 Ga0373931_0195897 3300035691 Bacteria 1204
639 Ga0373935_0407815 3300035692 Bacteria 977
640 Ga0373935_0436448 3300035692 Bacteria 944
641 Ga0373927_0066421 3300035695 Bacteria 2333
642 Ga0373927_0103828 3300035695 Bacteria 1850
643 Ga0373927_0109300 3300035695 Unclassified 1801
644 Ga0373927_0233802 3300035695 Unclassified 1208
645 Ga0373947_0004931 3300035725 Bacteria 7805
646 Ga0373937_0019513 3300036401 Bacteria 6066
647 Ga0373937_0064885 3300036401 Unclassified 3360
648 Ga0373925_0002528 3300037068 Bacteria 14568
649 Ga0373925_0003931 3300037068 Bacteria 11347
650 Ga0242420_032641 3300038996 Unclassified 971
651 Ga0436363_0138485 3300039450 Unclassified 658
652 Ga0436363_0452538 3300039450 Bacteria 4156
653 Ga0436363_0678730 3300039450 Bacteria 3317
654 Ga0451577_0865583 3300042876 Unclassified 815
655 Ga0466966_0083038 3300044684 Bacteria 1994
656 Ga0466964_0394109 3300044706 Unclassified 722
657 Ga0451576_0417481 3300045051 Bacteria 1408
658 Ga0451576_0448547 3300045051 Bacteria 1354
659 Ga0466967_0440923 3300045976 Bacteria 1272
660 Ga0495650_0017412 3300046471 Bacteria 3604
661 Ga0495580_0000068 3300046472 Bacteria 63122
662 Ga0495580_0016338 3300046472 Bacteria 5572
663 Ga0495580_0765153 3300046472 Unclassified 628
664 Ga0495582_0000291 3300046473 Bacteria 27648
665 Ga0495648_0161115 3300046524 Bacteria 1160
666 Ga0495666_0081374 3300046526 Unclassified 1532
667 Ga0495661_0018438 3300046665 Bacteria 4591
668 Ga0495588_0085859 3300046674 Unclassified 1646
669 Ga0495581_0144563 3300047315 Bacteria 1388
670 Ga0495604_0347772 3300047317 Unclassified 986
671 Ga0495604_0641971 3300047317 Unclassified 678
672 Ga0495674_0103640 3300047319 Bacteria 2419
673 Ga0495672_0014759 3300047320 Bacteria 5330
674 Ga0495675_0424266 3300047444 Unclassified 772
675 Ga0495673_0027796 3300047469 Bacteria 2687
676 Ga0495602_0090848 3300048088 Unclassified 2535
677 Ga0496100_0013016 3300048903 Bacteria 4787
678 Ga0496102_0055044 3300048905 Bacteria 3628
679 Ga0496102_0082857 3300048905 Bacteria 2958
680 Ga0496104_0175175 3300048907 Bacteria 2055
681 Ga0496104_0310504 3300048907 Unclassified 1490
682 Ga0496104_0387683 3300048907 Bacteria 1309
683 Ga0496105_0123282 3300048908 Bacteria 2136
684 Ga0496105_0686701 3300048908 Bacteria 787
685 Ga0496105_0757091 3300048908 Unclassified 741
686 Ga0496106_0171922 3300048909 Bacteria 1718
687 Ga0496106_0324021 3300048909 Bacteria 1237
688 Ga0496107_0445557 3300048910 Unclassified 962
689 Ga0496109_1044853 3300048912 Unclassified 754
690 Ga0496110_0013298 3300048913 Bacteria 6799
691 Ga0496110_0059899 3300048913 Bacteria 3357
692 Ga0496111_0721866 3300048914 Bacteria 724
693 Ga0496112_0010933 3300048915 Bacteria 8264
694 Ga0496112_0011133 3300048915 Bacteria 8201
695 Ga0496112_0093619 3300048915 Bacteria 2975
696 Ga0496112_0333281 3300048915 Bacteria 1461
697 Ga0496112_0348878 3300048915 Unclassified 1422
698 Ga0496112_0795584 3300048915 Unclassified 871
699 Ga0496115_0144082 3300048918 Bacteria 1966
700 Ga0496115_0170915 3300048918 Bacteria 1798
701 Ga0496115_0216962 3300048918 Unclassified 1579
702 Ga0501083_0063924 3300049744 Unclassified 2454
703 nmdc:mga0n895_123205_c1 3300050512 Bacteria 2614
704 nmdc:mga0n895_17489_c1 3300050512 Bacteria 6608
705 nmdc:mga0rr50_124073_c2 3300050513 Bacteria 1588
706 nmdc:mga0rr50_18132_c1 3300050513 Bacteria 4720
707 nmdc:mga0rr50_32577_c1 3300050513 Bacteria 3714
708 nmdc:mga0rr50_4897_c1 3300050513 Bacteria 7919
709 nmdc:mga08x19_859_c1 3300050514 Bacteria 19283
710 nmdc:mga08x19_9722_c1 3300050514 Bacteria 5759
711 nmdc:mga0a205_54288_c1 3300050515 Bacteria 3409
712 Ga0495601_0264188 3300053077 Bacteria 1123
713 Ga0500651_0000007 3300053093 Bacteria 295019
714 Ga0500661_000345 3300055283 Bacteria 8445

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10105969 Ga0207681_101059692 164
2 3300026067 Ga0207678_11068388 Ga0207678_110683881 166
3 3300005338 Ga0068868_100566989 Ga0068868_1005669892 169
4 3300031711 Ga0265314_10019719 Ga0265314_100197194 169
5 3300009177 Ga0105248_11505879 Ga0105248_115058791 170
6 3300014325 Ga0163163_10039831 Ga0163163_100398311 170
7 3300025941 Ga0207711_11421965 Ga0207711_114219651 170
8 3300006358 Ga0068871_100187497 Ga0068871_1001874973 172
9 3300009174 Ga0105241_10281093 Ga0105241_102810932 172
10 3300009545 Ga0105237_10054633 Ga0105237_100546334 172
11 3300025914 Ga0207671_10206640 Ga0207671_102066403 172
12 3300005293 Ga0065715_10390192 Ga0065715_103901921 173
13 3300005546 Ga0070696_100188444 Ga0070696_1001884441 173
14 3300047320 Ga0495672_0014759 Ga0495672_0014759_1141_1662 173
15 3300049744 Ga0501083_0063924 Ga0501083_0063924_628_1179 173
16 3300044684 Ga0466966_0083038 Ga0466966_0083038_1027_1629 174
17 3300044706 Ga0466964_0394109 Ga0466964_0394109_61_591 174
18 3300005455 Ga0070663_100306396 Ga0070663_1003063961 175
19 3300006852 Ga0075433_10057134 Ga0075433_100571342 175
20 3300006871 Ga0075434_100001350 Ga0075434_1000013502 175
21 3300007076 Ga0075435_100011776 Ga0075435_1000117764 175
22 3300024227 Ga0228598_1020574 Ga0228598_10205742 175
23 3300026067 Ga0207678_10331695 Ga0207678_103316952 175
24 3300039450 Ga0436363_0678730 Ga0436363_0678730_2658_3197 175
25 3300045051 Ga0451576_0417481 Ga0451576_0417481_167_697 175
26 3300050512 nmdc:mga0n895_17489_c1 nmdc:mga0n895_17489_c1_1881_2414 175
27 3300050513 nmdc:mga0rr50_18132_c1 nmdc:mga0rr50_18132_c1_1522_2055 175
28 3300050515 nmdc:mga0a205_54288_c1 nmdc:mga0a205_54288_c1_1064_1597 175
29 3300055283 Ga0500661_000345 Ga0500661_000345_4255_4806 175
30 3300002077 JGI24744J21845_10007720 JGI24744J21845_100077202 176
31 3300005276 Ga0065717_1010914 Ga0065717_10109141 176
32 3300005290 Ga0065712_10077580 Ga0065712_100775802 176
33 3300005290 Ga0065712_10082421 Ga0065712_100824214 176
34 3300005293 Ga0065715_10101713 Ga0065715_101017131 176
35 3300005328 Ga0070676_10003926 Ga0070676_100039264 176
36 3300005328 Ga0070676_10903459 Ga0070676_109034591 176
37 3300005329 Ga0070683_100000439 Ga0070683_1000004395 176
38 3300005329 Ga0070683_100001669 Ga0070683_10000166910 176
39 3300005329 Ga0070683_100405725 Ga0070683_1004057252 176
40 3300005330 Ga0070690_100016990 Ga0070690_1000169904 176
41 3300005330 Ga0070690_100118697 Ga0070690_1001186972 176
42 3300005331 Ga0070670_100072103 Ga0070670_1000721032 176
43 3300005331 Ga0070670_100093434 Ga0070670_1000934342 176
44 3300005331 Ga0070670_100130310 Ga0070670_1001303102 176
45 3300005334 Ga0068869_100002672 Ga0068869_1000026729 176
46 3300005334 Ga0068869_100006472 Ga0068869_1000064726 176
47 3300005334 Ga0068869_100006858 Ga0068869_1000068587 176
48 3300005334 Ga0068869_100044611 Ga0068869_1000446111 176
49 3300005334 Ga0068869_100461574 Ga0068869_1004615742 176
50 3300005335 Ga0070666_10081321 Ga0070666_100813212 176
51 3300005335 Ga0070666_10135622 Ga0070666_101356221 176
52 3300005335 Ga0070666_10406230 Ga0070666_104062302 176
53 3300005335 Ga0070666_10544469 Ga0070666_105444692 176
54 3300005336 Ga0070680_100265908 Ga0070680_1002659081 176
55 3300005337 Ga0070682_100060753 Ga0070682_1000607531 176
56 3300005337 Ga0070682_100280608 Ga0070682_1002806082 176
57 3300005337 Ga0070682_100614700 Ga0070682_1006147001 176
58 3300005338 Ga0068868_100000658 Ga0068868_1000006589 176
59 3300005338 Ga0068868_100007650 Ga0068868_1000076506 176
60 3300005338 Ga0068868_100009529 Ga0068868_1000095298 176
61 3300005338 Ga0068868_100033454 Ga0068868_1000334543 176
62 3300005338 Ga0068868_100057200 Ga0068868_1000572004 176
63 3300005338 Ga0068868_100353698 Ga0068868_1003536982 176
64 3300005339 Ga0070660_100491283 Ga0070660_1004912832 176
65 3300005339 Ga0070660_100584770 Ga0070660_1005847701 176
66 3300005340 Ga0070689_100141020 Ga0070689_1001410202 176
67 3300005340 Ga0070689_100468845 Ga0070689_1004688451 176
68 3300005341 Ga0070691_10038523 Ga0070691_100385232 176
69 3300005344 Ga0070661_100001766 Ga0070661_1000017669 176
70 3300005344 Ga0070661_100017243 Ga0070661_1000172434 176
71 3300005344 Ga0070661_100082543 Ga0070661_1000825432 176
72 3300005344 Ga0070661_100092139 Ga0070661_1000921393 176
73 3300005344 Ga0070661_100092968 Ga0070661_1000929682 176
74 3300005344 Ga0070661_100236532 Ga0070661_1002365322 176
75 3300005345 Ga0070692_10625789 Ga0070692_106257891 176
76 3300005347 Ga0070668_100044661 Ga0070668_1000446613 176
77 3300005347 Ga0070668_100101299 Ga0070668_1001012991 176
78 3300005347 Ga0070668_100124256 Ga0070668_1001242562 176
79 3300005353 Ga0070669_100594973 Ga0070669_1005949732 176
80 3300005354 Ga0070675_100022209 Ga0070675_1000222093 176
81 3300005354 Ga0070675_100022283 Ga0070675_1000222835 176
82 3300005354 Ga0070675_100065479 Ga0070675_1000654791 176
83 3300005355 Ga0070671_100295330 Ga0070671_1002953301 176
84 3300005355 Ga0070671_100814932 Ga0070671_1008149321 176
85 3300005356 Ga0070674_100028133 Ga0070674_1000281332 176
86 3300005356 Ga0070674_100031914 Ga0070674_1000319144 176
87 3300005356 Ga0070674_100064152 Ga0070674_1000641522 176
88 3300005364 Ga0070673_100004642 Ga0070673_1000046423 176
89 3300005364 Ga0070673_100023639 Ga0070673_1000236394 176
90 3300005364 Ga0070673_100137488 Ga0070673_1001374882 176
91 3300005364 Ga0070673_100189398 Ga0070673_1001893981 176
92 3300005364 Ga0070673_100474440 Ga0070673_1004744402 176
93 3300005365 Ga0070688_100091432 Ga0070688_1000914323 176
94 3300005365 Ga0070688_100299138 Ga0070688_1002991382 176
95 3300005366 Ga0070659_100009116 Ga0070659_1000091161 176
96 3300005366 Ga0070659_100100450 Ga0070659_1001004504 176
97 3300005366 Ga0070659_100743739 Ga0070659_1007437391 176
98 3300005367 Ga0070667_100084351 Ga0070667_1000843513 176
99 3300005367 Ga0070667_100123158 Ga0070667_1001231583 176
100 3300005367 Ga0070667_100437789 Ga0070667_1004377893 176
101 3300005434 Ga0070709_10018590 Ga0070709_100185904 176
102 3300005434 Ga0070709_10162196 Ga0070709_101621962 176
103 3300005435 Ga0070714_100072039 Ga0070714_1000720393 176
104 3300005435 Ga0070714_100289136 Ga0070714_1002891362 176
105 3300005435 Ga0070714_101284846 Ga0070714_1012848461 176
106 3300005436 Ga0070713_100031800 Ga0070713_1000318006 176
107 3300005436 Ga0070713_100065686 Ga0070713_1000656862 176
108 3300005436 Ga0070713_100277971 Ga0070713_1002779712 176
109 3300005436 Ga0070713_100561279 Ga0070713_1005612792 176
110 3300005436 Ga0070713_100952531 Ga0070713_1009525312 176
111 3300005439 Ga0070711_100186715 Ga0070711_1001867152 176
112 3300005439 Ga0070711_100186915 Ga0070711_1001869153 176
113 3300005440 Ga0070705_100053017 Ga0070705_1000530172 176
114 3300005444 Ga0070694_100543052 Ga0070694_1005430522 176
115 3300005445 Ga0070708_101000257 Ga0070708_1010002571 176
116 3300005455 Ga0070663_100263278 Ga0070663_1002632782 176
117 3300005455 Ga0070663_100565122 Ga0070663_1005651222 176
118 3300005456 Ga0070678_100001043 Ga0070678_1000010434 176
119 3300005456 Ga0070678_100083670 Ga0070678_1000836702 176
120 3300005456 Ga0070678_100173837 Ga0070678_1001738372 176
121 3300005456 Ga0070678_100515140 Ga0070678_1005151402 176
122 3300005457 Ga0070662_100031224 Ga0070662_1000312241 176
123 3300005457 Ga0070662_100043320 Ga0070662_1000433202 176
124 3300005457 Ga0070662_100063217 Ga0070662_1000632174 176
125 3300005457 Ga0070662_100074027 Ga0070662_1000740272 176
126 3300005457 Ga0070662_100120781 Ga0070662_1001207813 176
127 3300005457 Ga0070662_100177982 Ga0070662_1001779822 176
128 3300005457 Ga0070662_100343101 Ga0070662_1003431011 176
129 3300005458 Ga0070681_10000026 Ga0070681_1000002672 176
130 3300005458 Ga0070681_10003878 Ga0070681_100038786 176
131 3300005458 Ga0070681_10054805 Ga0070681_100548052 176
132 3300005458 Ga0070681_10176517 Ga0070681_101765172 176
133 3300005458 Ga0070681_10706160 Ga0070681_107061602 176
134 3300005459 Ga0068867_100014983 Ga0068867_1000149836 176
135 3300005459 Ga0068867_100016165 Ga0068867_1000161653 176
136 3300005459 Ga0068867_100021678 Ga0068867_1000216783 176
137 3300005459 Ga0068867_100061602 Ga0068867_1000616023 176
138 3300005459 Ga0068867_100087321 Ga0068867_1000873212 176
139 3300005459 Ga0068867_100406178 Ga0068867_1004061782 176
140 3300005459 Ga0068867_100870697 Ga0068867_1008706971 176
141 3300005466 Ga0070685_10017481 Ga0070685_100174813 176
142 3300005466 Ga0070685_10080072 Ga0070685_100800722 176
143 3300005466 Ga0070685_10308959 Ga0070685_103089592 176
144 3300005466 Ga0070685_11096212 Ga0070685_110962121 176
145 3300005518 Ga0070699_101066320 Ga0070699_1010663201 176
146 3300005530 Ga0070679_100028098 Ga0070679_1000280982 176
147 3300005530 Ga0070679_100051762 Ga0070679_1000517624 176
148 3300005530 Ga0070679_100060685 Ga0070679_1000606851 176
149 3300005530 Ga0070679_100112824 Ga0070679_1001128243 176
150 3300005530 Ga0070679_100386572 Ga0070679_1003865722 176
151 3300005530 Ga0070679_100681135 Ga0070679_1006811352 176
152 3300005535 Ga0070684_100000465 Ga0070684_10000046515 176
153 3300005535 Ga0070684_100003698 Ga0070684_1000036986 176
154 3300005535 Ga0070684_100040832 Ga0070684_1000408322 176
155 3300005535 Ga0070684_100121704 Ga0070684_1001217041 176
156 3300005535 Ga0070684_100340166 Ga0070684_1003401662 176
157 3300005535 Ga0070684_100587368 Ga0070684_1005873681 176
158 3300005535 Ga0070684_101213773 Ga0070684_1012137731 176
159 3300005539 Ga0068853_100006912 Ga0068853_1000069128 176
160 3300005539 Ga0068853_100010347 Ga0068853_1000103471 176
161 3300005539 Ga0068853_100118535 Ga0068853_1001185351 176
162 3300005539 Ga0068853_100123827 Ga0068853_1001238272 176
163 3300005539 Ga0068853_100723423 Ga0068853_1007234232 176
164 3300005543 Ga0070672_100008231 Ga0070672_1000082314 176
165 3300005543 Ga0070672_100198115 Ga0070672_1001981152 176
166 3300005543 Ga0070672_100265370 Ga0070672_1002653702 176
167 3300005544 Ga0070686_100010119 Ga0070686_1000101193 176
168 3300005544 Ga0070686_100333134 Ga0070686_1003331342 176
169 3300005545 Ga0070695_100143711 Ga0070695_1001437111 176
170 3300005545 Ga0070695_100784392 Ga0070695_1007843921 176
171 3300005546 Ga0070696_100341319 Ga0070696_1003413192 176
172 3300005547 Ga0070693_100013377 Ga0070693_1000133773 176
173 3300005547 Ga0070693_100072316 Ga0070693_1000723161 176
174 3300005548 Ga0070665_100014552 Ga0070665_1000145524 176
175 3300005548 Ga0070665_100022144 Ga0070665_1000221444 176
176 3300005548 Ga0070665_100043681 Ga0070665_1000436815 176
177 3300005548 Ga0070665_100047875 Ga0070665_1000478754 176
178 3300005548 Ga0070665_100433939 Ga0070665_1004339392 176
179 3300005549 Ga0070704_100387655 Ga0070704_1003876551 176
180 3300005563 Ga0068855_100000295 Ga0068855_10000029523 176
181 3300005563 Ga0068855_100054917 Ga0068855_1000549175 176
182 3300005563 Ga0068855_100118543 Ga0068855_1001185432 176
183 3300005563 Ga0068855_100130686 Ga0068855_1001306862 176
184 3300005563 Ga0068855_100160629 Ga0068855_1001606293 176
185 3300005563 Ga0068855_100269775 Ga0068855_1002697752 176
186 3300005563 Ga0068855_100391523 Ga0068855_1003915232 176
187 3300005563 Ga0068855_100961597 Ga0068855_1009615972 176
188 3300005564 Ga0070664_100000687 Ga0070664_10000068722 176
189 3300005564 Ga0070664_100001035 Ga0070664_10000103513 176
190 3300005564 Ga0070664_100004076 Ga0070664_1000040764 176
191 3300005564 Ga0070664_100054439 Ga0070664_1000544392 176
192 3300005564 Ga0070664_100211038 Ga0070664_1002110382 176
193 3300005564 Ga0070664_100223656 Ga0070664_1002236562 176
194 3300005564 Ga0070664_100331997 Ga0070664_1003319972 176
195 3300005564 Ga0070664_100357807 Ga0070664_1003578073 176
196 3300005564 Ga0070664_100749655 Ga0070664_1007496552 176
197 3300005577 Ga0068857_100001872 Ga0068857_10000187216 176
198 3300005577 Ga0068857_100010663 Ga0068857_1000106635 176
199 3300005577 Ga0068857_100112800 Ga0068857_1001128003 176
200 3300005577 Ga0068857_100326756 Ga0068857_1003267562 176
201 3300005578 Ga0068854_100023329 Ga0068854_1000233292 176
202 3300005578 Ga0068854_100028511 Ga0068854_1000285114 176
203 3300005578 Ga0068854_100029319 Ga0068854_1000293192 176
204 3300005578 Ga0068854_100044525 Ga0068854_1000445252 176
205 3300005578 Ga0068854_100147897 Ga0068854_1001478972 176
206 3300005578 Ga0068854_100166195 Ga0068854_1001661952 176
207 3300005578 Ga0068854_100369980 Ga0068854_1003699802 176
208 3300005578 Ga0068854_100871739 Ga0068854_1008717391 176
209 3300005614 Ga0068856_100000407 Ga0068856_10000040718 176
210 3300005614 Ga0068856_100001013 Ga0068856_1000010132 176
211 3300005614 Ga0068856_100002064 Ga0068856_1000020646 176
212 3300005614 Ga0068856_100006032 Ga0068856_1000060326 176
213 3300005614 Ga0068856_100183456 Ga0068856_1001834562 176
214 3300005614 Ga0068856_100344577 Ga0068856_1003445772 176
215 3300005614 Ga0068856_100543346 Ga0068856_1005433462 176
216 3300005614 Ga0068856_100579749 Ga0068856_1005797492 176
217 3300005614 Ga0068856_101385317 Ga0068856_1013853171 176
218 3300005615 Ga0070702_100254863 Ga0070702_1002548632 176
219 3300005616 Ga0068852_100007347 Ga0068852_1000073472 176
220 3300005616 Ga0068852_100007670 Ga0068852_1000076704 176
221 3300005616 Ga0068852_100044428 Ga0068852_1000444284 176
222 3300005616 Ga0068852_100049918 Ga0068852_1000499182 176
223 3300005616 Ga0068852_100189892 Ga0068852_1001898922 176
224 3300005617 Ga0068859_100007556 Ga0068859_10000755611 176
225 3300005617 Ga0068859_100039953 Ga0068859_1000399536 176
226 3300005617 Ga0068859_100045630 Ga0068859_1000456305 176
227 3300005617 Ga0068859_100071863 Ga0068859_1000718633 176
228 3300005617 Ga0068859_100109212 Ga0068859_1001092122 176
229 3300005617 Ga0068859_100148912 Ga0068859_1001489122 176
230 3300005617 Ga0068859_100313329 Ga0068859_1003133291 176
231 3300005618 Ga0068864_100000684 Ga0068864_10000068424 176
232 3300005618 Ga0068864_100049730 Ga0068864_1000497305 176
233 3300005618 Ga0068864_100079208 Ga0068864_1000792083 176
234 3300005618 Ga0068864_100079900 Ga0068864_1000799004 176
235 3300005618 Ga0068864_100429102 Ga0068864_1004291021 176
236 3300005618 Ga0068864_100568977 Ga0068864_1005689772 176
237 3300005718 Ga0068866_10011392 Ga0068866_100113922 176
238 3300005718 Ga0068866_10021659 Ga0068866_100216591 176
239 3300005718 Ga0068866_10480212 Ga0068866_104802121 176
240 3300005719 Ga0068861_100021088 Ga0068861_1000210884 176
241 3300005719 Ga0068861_100102778 Ga0068861_1001027783 176
242 3300005719 Ga0068861_100414988 Ga0068861_1004149883 176
243 3300005719 Ga0068861_101442499 Ga0068861_1014424991 176
244 3300005834 Ga0068851_10042410 Ga0068851_100424101 176
245 3300005834 Ga0068851_10245406 Ga0068851_102454062 176
246 3300005834 Ga0068851_10365552 Ga0068851_103655522 176
247 3300005840 Ga0068870_10029178 Ga0068870_100291782 176
248 3300005840 Ga0068870_10181939 Ga0068870_101819391 176
249 3300005841 Ga0068863_100012509 Ga0068863_1000125096 176
250 3300005841 Ga0068863_100140708 Ga0068863_1001407082 176
251 3300005841 Ga0068863_100194888 Ga0068863_1001948881 176
252 3300005841 Ga0068863_100654988 Ga0068863_1006549882 176
253 3300005841 Ga0068863_100854381 Ga0068863_1008543812 176
254 3300005842 Ga0068858_100003346 Ga0068858_1000033468 176
255 3300005842 Ga0068858_100072193 Ga0068858_1000721934 176
256 3300005842 Ga0068858_100324207 Ga0068858_1003242071 176
257 3300005842 Ga0068858_100481620 Ga0068858_1004816201 176
258 3300005843 Ga0068860_100035179 Ga0068860_1000351795 176
259 3300005843 Ga0068860_100056788 Ga0068860_1000567882 176
260 3300005843 Ga0068860_100227616 Ga0068860_1002276164 176
261 3300005844 Ga0068862_100021645 Ga0068862_1000216454 176
262 3300005844 Ga0068862_100195439 Ga0068862_1001954392 176
263 3300005844 Ga0068862_100272876 Ga0068862_1002728762 176
264 3300005844 Ga0068862_100330105 Ga0068862_1003301052 176
265 3300005844 Ga0068862_100581094 Ga0068862_1005810942 176
266 3300006028 Ga0070717_10010731 Ga0070717_100107317 176
267 3300006028 Ga0070717_10333161 Ga0070717_103331612 176
268 3300006163 Ga0070715_10056958 Ga0070715_100569583 176
269 3300006173 Ga0070716_100009551 Ga0070716_1000095514 176
270 3300006173 Ga0070716_100635101 Ga0070716_1006351011 176
271 3300006175 Ga0070712_100005964 Ga0070712_1000059642 176
272 3300006175 Ga0070712_100071582 Ga0070712_1000715824 176
273 3300006175 Ga0070712_100211001 Ga0070712_1002110012 176
274 3300006175 Ga0070712_100317898 Ga0070712_1003178982 176
275 3300006237 Ga0097621_100000237 Ga0097621_10000023719 176
276 3300006237 Ga0097621_100009029 Ga0097621_1000090294 176
277 3300006237 Ga0097621_100064654 Ga0097621_1000646544 176
278 3300006237 Ga0097621_100103936 Ga0097621_1001039364 176
279 3300006237 Ga0097621_100278011 Ga0097621_1002780111 176
280 3300006358 Ga0068871_100003099 Ga0068871_1000030993 176
281 3300006358 Ga0068871_100006408 Ga0068871_1000064087 176
282 3300006358 Ga0068871_100016523 Ga0068871_1000165233 176
283 3300006358 Ga0068871_100165928 Ga0068871_1001659283 176
284 3300006358 Ga0068871_100331251 Ga0068871_1003312512 176
285 3300006358 Ga0068871_100444894 Ga0068871_1004448942 176
286 3300006358 Ga0068871_100457076 Ga0068871_1004570762 176
287 3300006871 Ga0075434_100226311 Ga0075434_1002263112 176
288 3300006881 Ga0068865_100024968 Ga0068865_1000249682 176
289 3300006881 Ga0068865_100032844 Ga0068865_1000328443 176
290 3300006881 Ga0068865_100105664 Ga0068865_1001056643 176
291 3300006914 Ga0075436_100002468 Ga0075436_1000024686 176
292 3300006914 Ga0075436_100130440 Ga0075436_1001304402 176
293 3300006931 Ga0097620_100007556 Ga0097620_10000755611 176
294 3300006931 Ga0097620_100039953 Ga0097620_1000399531 176
295 3300006931 Ga0097620_100045632 Ga0097620_1000456325 176
296 3300006931 Ga0097620_100071864 Ga0097620_1000718643 176
297 3300006931 Ga0097620_100109207 Ga0097620_1001092073 176
298 3300006931 Ga0097620_100148901 Ga0097620_1001489012 176
299 3300006931 Ga0097620_100313354 Ga0097620_1003133541 176
300 3300007076 Ga0075435_100015353 Ga0075435_1000153537 176
301 3300007076 Ga0075435_100052825 Ga0075435_1000528255 176
302 3300009093 Ga0105240_10007038 Ga0105240_100070383 176
303 3300009093 Ga0105240_10055164 Ga0105240_100551645 176
304 3300009093 Ga0105240_10063883 Ga0105240_100638834 176
305 3300009093 Ga0105240_10129224 Ga0105240_101292244 176
306 3300009093 Ga0105240_11008696 Ga0105240_110086961 176
307 3300009098 Ga0105245_10055245 Ga0105245_100552452 176
308 3300009098 Ga0105245_10238347 Ga0105245_102383472 176
309 3300009101 Ga0105247_10094861 Ga0105247_100948612 176
310 3300009148 Ga0105243_10091371 Ga0105243_100913712 176
311 3300009174 Ga0105241_10000910 Ga0105241_1000091014 176
312 3300009174 Ga0105241_10019884 Ga0105241_100198842 176
313 3300009174 Ga0105241_10344394 Ga0105241_103443941 176
314 3300009174 Ga0105241_10347552 Ga0105241_103475522 176
315 3300009174 Ga0105241_10450500 Ga0105241_104505002 176
316 3300009174 Ga0105241_10658902 Ga0105241_106589022 176
317 3300009174 Ga0105241_10844327 Ga0105241_108443271 176
318 3300009174 Ga0105241_11471527 Ga0105241_114715271 176
319 3300009174 Ga0105241_11623752 Ga0105241_116237521 176
320 3300009176 Ga0105242_10003970 Ga0105242_100039702 176
321 3300009176 Ga0105242_10097287 Ga0105242_100972872 176
322 3300009176 Ga0105242_10210822 Ga0105242_102108222 176
323 3300009177 Ga0105248_10013380 Ga0105248_100133808 176
324 3300009177 Ga0105248_10596332 Ga0105248_105963322 176
325 3300009177 Ga0105248_10750218 Ga0105248_107502181 176
326 3300009545 Ga0105237_10087839 Ga0105237_100878394 176
327 3300009545 Ga0105237_10108580 Ga0105237_101085804 176
328 3300009545 Ga0105237_10224019 Ga0105237_102240192 176
329 3300009551 Ga0105238_10000848 Ga0105238_1000084833 176
330 3300009551 Ga0105238_10388083 Ga0105238_103880832 176
331 3300009551 Ga0105238_10492092 Ga0105238_104920922 176
332 3300009551 Ga0105238_10559004 Ga0105238_105590042 176
333 3300009551 Ga0105238_11008434 Ga0105238_110084342 176
334 3300009551 Ga0105238_11038324 Ga0105238_110383241 176
335 3300009553 Ga0105249_10012196 Ga0105249_100121962 176
336 3300009553 Ga0105249_10191684 Ga0105249_101916842 176
337 3300009553 Ga0105249_10613708 Ga0105249_106137082 176
338 3300009553 Ga0105249_11111614 Ga0105249_111116141 176
339 3300010375 Ga0105239_10059067 Ga0105239_100590674 176
340 3300010375 Ga0105239_10127297 Ga0105239_101272974 176
341 3300010375 Ga0105239_10130997 Ga0105239_101309972 176
342 3300010375 Ga0105239_10359565 Ga0105239_103595652 176
343 3300010375 Ga0105239_10526076 Ga0105239_105260762 176
344 3300010375 Ga0105239_10536837 Ga0105239_105368372 176
345 3300010375 Ga0105239_10731082 Ga0105239_107310821 176
346 3300010375 Ga0105239_11464716 Ga0105239_114647161 176
347 3300011119 Ga0105246_10006095 Ga0105246_100060956 176
348 3300011119 Ga0105246_10208251 Ga0105246_102082512 176
349 3300011119 Ga0105246_10346833 Ga0105246_103468332 176
350 3300013100 Ga0157373_10001291 Ga0157373_100012916 176
351 3300013100 Ga0157373_10040106 Ga0157373_100401063 176
352 3300013100 Ga0157373_10339926 Ga0157373_103399261 176
353 3300013102 Ga0157371_10046079 Ga0157371_100460794 176
354 3300013102 Ga0157371_10056746 Ga0157371_100567464 176
355 3300013102 Ga0157371_10082079 Ga0157371_100820792 176
356 3300013102 Ga0157371_10122219 Ga0157371_101222193 176
357 3300013102 Ga0157371_10316645 Ga0157371_103166452 176
358 3300013104 Ga0157370_10161224 Ga0157370_101612241 176
359 3300013104 Ga0157370_10479605 Ga0157370_104796051 176
360 3300013105 Ga0157369_10000124 Ga0157369_1000012478 176
361 3300013105 Ga0157369_10015527 Ga0157369_100155278 176
362 3300013105 Ga0157369_10026095 Ga0157369_100260955 176
363 3300013105 Ga0157369_10071837 Ga0157369_100718373 176
364 3300013105 Ga0157369_10115306 Ga0157369_101153062 176
365 3300013105 Ga0157369_10177446 Ga0157369_101774462 176
366 3300013296 Ga0157374_10000162 Ga0157374_1000016223 176
367 3300013296 Ga0157374_10000260 Ga0157374_100002605 176
368 3300013296 Ga0157374_10000667 Ga0157374_100006673 176
369 3300013296 Ga0157374_10061972 Ga0157374_100619724 176
370 3300013296 Ga0157374_10062877 Ga0157374_100628773 176
371 3300013296 Ga0157374_10113041 Ga0157374_101130412 176
372 3300013296 Ga0157374_10176221 Ga0157374_101762212 176
373 3300013296 Ga0157374_10217011 Ga0157374_102170112 176
374 3300013297 Ga0157378_10000020 Ga0157378_1000002051 176
375 3300013297 Ga0157378_10000320 Ga0157378_1000032018 176
376 3300013297 Ga0157378_10003732 Ga0157378_100037329 176
377 3300013297 Ga0157378_10020404 Ga0157378_100204044 176
378 3300013297 Ga0157378_10030936 Ga0157378_100309363 176
379 3300013297 Ga0157378_10163701 Ga0157378_101637012 176
380 3300013297 Ga0157378_10377901 Ga0157378_103779013 176
381 3300013297 Ga0157378_12297806 Ga0157378_122978061 176
382 3300013306 Ga0163162_10001370 Ga0163162_1000137015 176
383 3300013306 Ga0163162_10071305 Ga0163162_100713052 176
384 3300013306 Ga0163162_10136942 Ga0163162_101369422 176
385 3300013306 Ga0163162_10259597 Ga0163162_102595972 176
386 3300013306 Ga0163162_10364810 Ga0163162_103648101 176
387 3300013307 Ga0157372_10000084 Ga0157372_1000008463 176
388 3300013307 Ga0157372_10001112 Ga0157372_100011126 176
389 3300013307 Ga0157372_10005137 Ga0157372_100051372 176
390 3300013307 Ga0157372_10019034 Ga0157372_100190346 176
391 3300013307 Ga0157372_10064661 Ga0157372_100646612 176
392 3300013307 Ga0157372_10431044 Ga0157372_104310442 176
393 3300013307 Ga0157372_10438620 Ga0157372_104386202 176
394 3300013307 Ga0157372_10441710 Ga0157372_104417101 176
395 3300013308 Ga0157375_10030579 Ga0157375_100305794 176
396 3300013308 Ga0157375_10055033 Ga0157375_100550334 176
397 3300013308 Ga0157375_10057225 Ga0157375_100572253 176
398 3300013308 Ga0157375_10222957 Ga0157375_102229572 176
399 3300013308 Ga0157375_10277315 Ga0157375_102773152 176
400 3300013308 Ga0157375_10375116 Ga0157375_103751162 176
401 3300013308 Ga0157375_10499476 Ga0157375_104994762 176
402 3300014325 Ga0163163_10000279 Ga0163163_1000027941 176
403 3300014325 Ga0163163_10025732 Ga0163163_100257324 176
404 3300014325 Ga0163163_10054767 Ga0163163_100547672 176
405 3300014325 Ga0163163_10315674 Ga0163163_103156742 176
406 3300014325 Ga0163163_10514264 Ga0163163_105142642 176
407 3300014326 Ga0157380_10618263 Ga0157380_106182631 176
408 3300014326 Ga0157380_10768288 Ga0157380_107682882 176
409 3300014745 Ga0157377_10086377 Ga0157377_100863772 176
410 3300014745 Ga0157377_10267143 Ga0157377_102671432 176
411 3300014968 Ga0157379_10009420 Ga0157379_100094207 176
412 3300014968 Ga0157379_10222569 Ga0157379_102225692 176
413 3300014969 Ga0157376_10001784 Ga0157376_1000178414 176
414 3300014969 Ga0157376_10052979 Ga0157376_100529794 176
415 3300014969 Ga0157376_10105521 Ga0157376_101055214 176
416 3300014969 Ga0157376_10114169 Ga0157376_101141693 176
417 3300014969 Ga0157376_10118215 Ga0157376_101182152 176
418 3300014969 Ga0157376_10741383 Ga0157376_107413831 176
419 3300017792 Ga0163161_10063746 Ga0163161_100637462 176
420 3300020070 Ga0206356_10848496 Ga0206356_108484963 176
421 3300020078 Ga0206352_10003278 Ga0206352_100032783 176
422 3300020080 Ga0206350_11157382 Ga0206350_111573823 176
423 3300025315 Ga0207697_10077753 Ga0207697_100777532 176
424 3300025321 Ga0207656_10024326 Ga0207656_100243264 176
425 3300025321 Ga0207656_10297995 Ga0207656_102979951 176
426 3300025898 Ga0207692_10111478 Ga0207692_101114782 176
427 3300025899 Ga0207642_10016359 Ga0207642_100163595 176
428 3300025899 Ga0207642_10262309 Ga0207642_102623091 176
429 3300025900 Ga0207710_10043619 Ga0207710_100436192 176
430 3300025900 Ga0207710_10048241 Ga0207710_100482412 176
431 3300025901 Ga0207688_10249624 Ga0207688_102496242 176
432 3300025903 Ga0207680_10108006 Ga0207680_101080062 176
433 3300025903 Ga0207680_10388349 Ga0207680_103883492 176
434 3300025904 Ga0207647_10000811 Ga0207647_100008117 176
435 3300025904 Ga0207647_10031767 Ga0207647_100317675 176
436 3300025904 Ga0207647_10050804 Ga0207647_100508042 176
437 3300025905 Ga0207685_10190684 Ga0207685_101906842 176
438 3300025906 Ga0207699_10015704 Ga0207699_100157042 176
439 3300025906 Ga0207699_10111277 Ga0207699_101112772 176
440 3300025907 Ga0207645_10000352 Ga0207645_100003527 176
441 3300025907 Ga0207645_10006699 Ga0207645_100066996 176
442 3300025907 Ga0207645_10903948 Ga0207645_109039481 176
443 3300025908 Ga0207643_10020036 Ga0207643_100200363 176
444 3300025908 Ga0207643_10182181 Ga0207643_101821811 176
445 3300025908 Ga0207643_10310993 Ga0207643_103109932 176
446 3300025911 Ga0207654_10005785 Ga0207654_100057857 176
447 3300025911 Ga0207654_10014299 Ga0207654_100142997 176
448 3300025911 Ga0207654_10060351 Ga0207654_100603512 176
449 3300025911 Ga0207654_10838761 Ga0207654_108387611 176
450 3300025911 Ga0207654_11035792 Ga0207654_110357921 176
451 3300025912 Ga0207707_10000800 Ga0207707_1000080017 176
452 3300025912 Ga0207707_10008961 Ga0207707_100089615 176
453 3300025912 Ga0207707_10217052 Ga0207707_102170522 176
454 3300025913 Ga0207695_10018259 Ga0207695_100182595 176
455 3300025913 Ga0207695_10028234 Ga0207695_100282344 176
456 3300025913 Ga0207695_10049830 Ga0207695_100498305 176
457 3300025913 Ga0207695_10251683 Ga0207695_102516832 176
458 3300025913 Ga0207695_10331371 Ga0207695_103313711 176
459 3300025914 Ga0207671_10124175 Ga0207671_101241752 176
460 3300025914 Ga0207671_10266800 Ga0207671_102668001 176
461 3300025914 Ga0207671_10341064 Ga0207671_103410642 176
462 3300025914 Ga0207671_10467076 Ga0207671_104670762 176
463 3300025915 Ga0207693_10008124 Ga0207693_100081245 176
464 3300025915 Ga0207693_10047290 Ga0207693_100472904 176
465 3300025916 Ga0207663_10009352 Ga0207663_100093526 176
466 3300025916 Ga0207663_10550427 Ga0207663_105504272 176
467 3300025916 Ga0207663_10608187 Ga0207663_106081871 176
468 3300025917 Ga0207660_10019266 Ga0207660_100192664 176
469 3300025917 Ga0207660_10170724 Ga0207660_101707242 176
470 3300025919 Ga0207657_10000511 Ga0207657_1000051119 176
471 3300025919 Ga0207657_10139632 Ga0207657_101396322 176
472 3300025919 Ga0207657_10639821 Ga0207657_106398211 176
473 3300025920 Ga0207649_10011512 Ga0207649_100115121 176
474 3300025920 Ga0207649_10052726 Ga0207649_100527263 176
475 3300025920 Ga0207649_10064174 Ga0207649_100641741 176
476 3300025920 Ga0207649_10186401 Ga0207649_101864012 176
477 3300025920 Ga0207649_10246771 Ga0207649_102467712 176
478 3300025921 Ga0207652_10052324 Ga0207652_100523244 176
479 3300025921 Ga0207652_10116544 Ga0207652_101165443 176
480 3300025921 Ga0207652_10269909 Ga0207652_102699092 176
481 3300025921 Ga0207652_10408063 Ga0207652_104080632 176
482 3300025924 Ga0207694_10000434 Ga0207694_1000043433 176
483 3300025924 Ga0207694_10110025 Ga0207694_101100253 176
484 3300025924 Ga0207694_10145009 Ga0207694_101450093 176
485 3300025924 Ga0207694_10264756 Ga0207694_102647562 176
486 3300025925 Ga0207650_10054510 Ga0207650_100545102 176
487 3300025925 Ga0207650_10156952 Ga0207650_101569522 176
488 3300025926 Ga0207659_10010229 Ga0207659_100102297 176
489 3300025926 Ga0207659_10724358 Ga0207659_107243582 176
490 3300025927 Ga0207687_10049346 Ga0207687_100493464 176
491 3300025927 Ga0207687_10155612 Ga0207687_101556121 176
492 3300025928 Ga0207700_10009126 Ga0207700_100091266 176
493 3300025928 Ga0207700_10049542 Ga0207700_100495422 176
494 3300025928 Ga0207700_10606809 Ga0207700_106068092 176
495 3300025928 Ga0207700_10780386 Ga0207700_107803861 176
496 3300025929 Ga0207664_10352790 Ga0207664_103527902 176
497 3300025929 Ga0207664_10663015 Ga0207664_106630152 176
498 3300025931 Ga0207644_10128256 Ga0207644_101282561 176
499 3300025931 Ga0207644_10268855 Ga0207644_102688552 176
500 3300025932 Ga0207690_10075694 Ga0207690_100756942 176
501 3300025932 Ga0207690_10137393 Ga0207690_101373931 176
502 3300025933 Ga0207706_10000130 Ga0207706_1000013045 176
503 3300025933 Ga0207706_10027916 Ga0207706_100279162 176
504 3300025933 Ga0207706_10048352 Ga0207706_100483522 176
505 3300025933 Ga0207706_10416760 Ga0207706_104167601 176
506 3300025934 Ga0207686_10014173 Ga0207686_100141732 176
507 3300025934 Ga0207686_10092146 Ga0207686_100921462 176
508 3300025934 Ga0207686_10731288 Ga0207686_107312882 176
509 3300025935 Ga0207709_10281936 Ga0207709_102819361 176
510 3300025936 Ga0207670_10003459 Ga0207670_100034594 176
511 3300025936 Ga0207670_10374429 Ga0207670_103744292 176
512 3300025936 Ga0207670_10816103 Ga0207670_108161031 176
513 3300025937 Ga0207669_10047774 Ga0207669_100477742 176
514 3300025937 Ga0207669_10152218 Ga0207669_101522182 176
515 3300025937 Ga0207669_10418956 Ga0207669_104189562 176
516 3300025938 Ga0207704_10008470 Ga0207704_100084703 176
517 3300025938 Ga0207704_10095104 Ga0207704_100951043 176
518 3300025938 Ga0207704_10344365 Ga0207704_103443652 176
519 3300025938 Ga0207704_10584758 Ga0207704_105847582 176
520 3300025939 Ga0207665_10030987 Ga0207665_100309872 176
521 3300025939 Ga0207665_10083131 Ga0207665_100831311 176
522 3300025939 Ga0207665_10864263 Ga0207665_108642631 176
523 3300025940 Ga0207691_10005179 Ga0207691_100051794 176
524 3300025940 Ga0207691_10017119 Ga0207691_100171192 176
525 3300025941 Ga0207711_10000861 Ga0207711_1000086113 176
526 3300025941 Ga0207711_10004283 Ga0207711_100042836 176
527 3300025941 Ga0207711_10152720 Ga0207711_101527204 176
528 3300025942 Ga0207689_10000359 Ga0207689_1000035929 176
529 3300025942 Ga0207689_10003205 Ga0207689_100032055 176
530 3300025942 Ga0207689_10005656 Ga0207689_100056562 176
531 3300025942 Ga0207689_10008141 Ga0207689_100081414 176
532 3300025942 Ga0207689_10009652 Ga0207689_100096522 176
533 3300025942 Ga0207689_10011318 Ga0207689_100113185 176
534 3300025944 Ga0207661_10024017 Ga0207661_100240171 176
535 3300025944 Ga0207661_10699493 Ga0207661_106994931 176
536 3300025945 Ga0207679_10004667 Ga0207679_100046672 176
537 3300025945 Ga0207679_10008676 Ga0207679_100086764 176
538 3300025945 Ga0207679_10293350 Ga0207679_102933501 176
539 3300025945 Ga0207679_10483427 Ga0207679_104834272 176
540 3300025949 Ga0207667_10000213 Ga0207667_1000021310 176
541 3300025949 Ga0207667_10003075 Ga0207667_100030755 176
542 3300025949 Ga0207667_10010912 Ga0207667_100109124 176
543 3300025949 Ga0207667_10049664 Ga0207667_100496643 176
544 3300025949 Ga0207667_10147138 Ga0207667_101471382 176
545 3300025949 Ga0207667_10447248 Ga0207667_104472481 176
546 3300025949 Ga0207667_11065785 Ga0207667_110657851 176
547 3300025949 Ga0207667_11540263 Ga0207667_115402631 176
548 3300025960 Ga0207651_10067945 Ga0207651_100679452 176
549 3300025960 Ga0207651_10159386 Ga0207651_101593861 176
550 3300025960 Ga0207651_10284412 Ga0207651_102844122 176
551 3300025960 Ga0207651_10523003 Ga0207651_105230031 176
552 3300025961 Ga0207712_10128852 Ga0207712_101288522 176
553 3300025961 Ga0207712_10486123 Ga0207712_104861232 176
554 3300025961 Ga0207712_10501308 Ga0207712_105013082 176
555 3300025972 Ga0207668_10034689 Ga0207668_100346893 176
556 3300025972 Ga0207668_10553129 Ga0207668_105531291 176
557 3300025972 Ga0207668_11167262 Ga0207668_111672621 176
558 3300025981 Ga0207640_10003456 Ga0207640_100034565 176
559 3300025981 Ga0207640_10016573 Ga0207640_100165732 176
560 3300025981 Ga0207640_10032474 Ga0207640_100324744 176
561 3300025981 Ga0207640_10063766 Ga0207640_100637664 176
562 3300025981 Ga0207640_10437907 Ga0207640_104379072 176
563 3300025981 Ga0207640_10481123 Ga0207640_104811232 176
564 3300025986 Ga0207658_10072424 Ga0207658_100724242 176
565 3300026023 Ga0207677_10010698 Ga0207677_100106985 176
566 3300026023 Ga0207677_10040352 Ga0207677_100403522 176
567 3300026023 Ga0207677_10054814 Ga0207677_100548142 176
568 3300026023 Ga0207677_10064273 Ga0207677_100642734 176
569 3300026023 Ga0207677_10088538 Ga0207677_100885383 176
570 3300026023 Ga0207677_10090022 Ga0207677_100900222 176
571 3300026023 Ga0207677_10112481 Ga0207677_101124812 176
572 3300026023 Ga0207677_10184758 Ga0207677_101847582 176
573 3300026035 Ga0207703_10028509 Ga0207703_100285092 176
574 3300026035 Ga0207703_10135891 Ga0207703_101358911 176
575 3300026035 Ga0207703_10179676 Ga0207703_101796763 176
576 3300026035 Ga0207703_10421016 Ga0207703_104210161 176
577 3300026041 Ga0207639_10001622 Ga0207639_100016226 176
578 3300026041 Ga0207639_10037672 Ga0207639_100376724 176
579 3300026041 Ga0207639_10104297 Ga0207639_101042972 176
580 3300026041 Ga0207639_10477092 Ga0207639_104770922 176
581 3300026041 Ga0207639_10680959 Ga0207639_106809591 176
582 3300026041 Ga0207639_10962130 Ga0207639_109621302 176
583 3300026041 Ga0207639_10975205 Ga0207639_109752051 176
584 3300026067 Ga0207678_10000169 Ga0207678_1000016916 176
585 3300026067 Ga0207678_10215040 Ga0207678_102150403 176
586 3300026067 Ga0207678_10950858 Ga0207678_109508581 176
587 3300026078 Ga0207702_10000114 Ga0207702_1000011422 176
588 3300026078 Ga0207702_10001495 Ga0207702_100014956 176
589 3300026078 Ga0207702_10007437 Ga0207702_100074377 176
590 3300026078 Ga0207702_10090167 Ga0207702_100901672 176
591 3300026078 Ga0207702_10151691 Ga0207702_101516911 176
592 3300026078 Ga0207702_10184342 Ga0207702_101843421 176
593 3300026078 Ga0207702_10520069 Ga0207702_105200692 176
594 3300026088 Ga0207641_10210909 Ga0207641_102109093 176
595 3300026089 Ga0207648_10000215 Ga0207648_1000021539 176
596 3300026089 Ga0207648_10016987 Ga0207648_100169874 176
597 3300026089 Ga0207648_10026158 Ga0207648_100261585 176
598 3300026089 Ga0207648_10037810 Ga0207648_100378102 176
599 3300026089 Ga0207648_10040178 Ga0207648_100401782 176
600 3300026089 Ga0207648_10160347 Ga0207648_101603472 176
601 3300026095 Ga0207676_10002123 Ga0207676_100021238 176
602 3300026095 Ga0207676_10011474 Ga0207676_100114745 176
603 3300026095 Ga0207676_10036414 Ga0207676_100364145 176
604 3300026095 Ga0207676_10072642 Ga0207676_100726422 176
605 3300026095 Ga0207676_10147703 Ga0207676_101477031 176
606 3300026095 Ga0207676_10622601 Ga0207676_106226012 176
607 3300026116 Ga0207674_10000860 Ga0207674_100008608 176
608 3300026116 Ga0207674_10001389 Ga0207674_1000138926 176
609 3300026116 Ga0207674_10005344 Ga0207674_100053444 176
610 3300026116 Ga0207674_10007882 Ga0207674_1000788210 176
611 3300026116 Ga0207674_10231091 Ga0207674_102310912 176
612 3300026118 Ga0207675_100009538 Ga0207675_1000095384 176
613 3300026118 Ga0207675_100010295 Ga0207675_1000102955 176
614 3300026118 Ga0207675_100014105 Ga0207675_1000141055 176
615 3300026118 Ga0207675_100871895 Ga0207675_1008718951 176
616 3300026118 Ga0207675_101245471 Ga0207675_1012454712 176
617 3300026121 Ga0207683_10001515 Ga0207683_100015157 176
618 3300026121 Ga0207683_10054140 Ga0207683_100541402 176
619 3300026142 Ga0207698_10007054 Ga0207698_100070542 176
620 3300026142 Ga0207698_10070942 Ga0207698_100709422 176
621 3300026142 Ga0207698_10115980 Ga0207698_101159802 176
622 3300026142 Ga0207698_10570894 Ga0207698_105708942 176
623 3300028379 Ga0268266_10009490 Ga0268266_100094904 176
624 3300028379 Ga0268266_10049630 Ga0268266_100496302 176
625 3300028379 Ga0268266_10656520 Ga0268266_106565202 176
626 3300028380 Ga0268265_10463515 Ga0268265_104635152 176
627 3300028380 Ga0268265_11013948 Ga0268265_110139481 176
628 3300028381 Ga0268264_10054667 Ga0268264_100546675 176
629 3300028381 Ga0268264_10099321 Ga0268264_100993211 176
630 3300028381 Ga0268264_10155474 Ga0268264_101554742 176
631 3300034816 Ga0373930_0010220 Ga0373930_0010220_474_1007 176
632 3300034816 Ga0373930_0061177 Ga0373930_0061177_211_756 176
633 3300034817 Ga0373948_0023368 Ga0373948_0023368_243_776 176
634 3300034818 Ga0373950_0029163 Ga0373950_0029163_440_973 176
635 3300035085 Ga0373929_0072675 Ga0373929_0072675_77_610 176
636 3300035090 Ga0373949_0057033 Ga0373949_0057033_327_860 176
637 3300035091 Ga0373951_0137356 Ga0373951_0137356_115_648 176
638 3300035113 Ga0373936_0071568 Ga0373936_0071568_370_903 176
639 3300035114 Ga0373939_0048312 Ga0373939_0048312_261_794 176
640 3300035114 Ga0373939_0191839 Ga0373939_0191839_95_628 176
641 3300035115 Ga0373941_0306336 Ga0373941_0306336_83_616 176
642 3300035121 Ga0373960_0009147 Ga0373960_0009147_115_648 176
643 3300035170 Ga0373943_0020134 Ga0373943_0020134_1010_1543 176
644 3300035170 Ga0373943_0082225 Ga0373943_0082225_143_676 176
645 3300035241 Ga0373961_0078557 Ga0373961_0078557_78_611 176
646 3300035242 Ga0373962_0117228 Ga0373962_0117228_254_787 176
647 3300035691 Ga0373931_0051116 Ga0373931_0051116_1490_2023 176
648 3300035691 Ga0373931_0195897 Ga0373931_0195897_431_1000 176
649 3300035692 Ga0373935_0407815 Ga0373935_0407815_165_698 176
650 3300035692 Ga0373935_0436448 Ga0373935_0436448_227_760 176
651 3300035695 Ga0373927_0066421 Ga0373927_0066421_21_560 176
652 3300035695 Ga0373927_0103828 Ga0373927_0103828_153_686 176
653 3300035695 Ga0373927_0109300 Ga0373927_0109300_28_561 176
654 3300035695 Ga0373927_0233802 Ga0373927_0233802_263_796 176
655 3300035725 Ga0373947_0004931 Ga0373947_0004931_1020_1553 176
656 3300036401 Ga0373937_0019513 Ga0373937_0019513_2724_3269 176
657 3300036401 Ga0373937_0064885 Ga0373937_0064885_100_633 176
658 3300037068 Ga0373925_0002528 Ga0373925_0002528_1266_1799 176
659 3300037068 Ga0373925_0003931 Ga0373925_0003931_4126_4659 176
660 3300038996 Ga0242420_032641 Ga0242420_032641_126_659 176
661 3300039450 Ga0436363_0138485 Ga0436363_0138485_104_640 176
662 3300039450 Ga0436363_0452538 Ga0436363_0452538_469_1050 176
663 3300042876 Ga0451577_0865583 Ga0451577_0865583_149_682 176
664 3300045051 Ga0451576_0448547 Ga0451576_0448547_541_1137 176
665 3300045976 Ga0466967_0440923 Ga0466967_0440923_539_1072 176
666 3300046471 Ga0495650_0017412 Ga0495650_0017412_1919_2449 176
667 3300046472 Ga0495580_0000068 Ga0495580_0000068_27347_27886 176
668 3300046472 Ga0495580_0016338 Ga0495580_0016338_4666_5199 176
669 3300046472 Ga0495580_0765153 Ga0495580_0765153_55_597 176
670 3300046473 Ga0495582_0000291 Ga0495582_0000291_16777_17310 176
671 3300046524 Ga0495648_0161115 Ga0495648_0161115_251_826 176
672 3300046526 Ga0495666_0081374 Ga0495666_0081374_987_1520 176
673 3300046665 Ga0495661_0018438 Ga0495661_0018438_3847_4422 176
674 3300046674 Ga0495588_0085859 Ga0495588_0085859_445_978 176
675 3300047315 Ga0495581_0144563 Ga0495581_0144563_101_634 176
676 3300047317 Ga0495604_0347772 Ga0495604_0347772_427_960 176
677 3300047317 Ga0495604_0641971 Ga0495604_0641971_67_612 176
678 3300047319 Ga0495674_0103640 Ga0495674_0103640_247_780 176
679 3300047444 Ga0495675_0424266 Ga0495675_0424266_158_703 176
680 3300047469 Ga0495673_0027796 Ga0495673_0027796_1785_2360 176
681 3300048088 Ga0495602_0090848 Ga0495602_0090848_447_992 176
682 3300048903 Ga0496100_0013016 Ga0496100_0013016_3911_4453 176
683 3300048905 Ga0496102_0055044 Ga0496102_0055044_209_751 176
684 3300048905 Ga0496102_0082857 Ga0496102_0082857_198_731 176
685 3300048907 Ga0496104_0175175 Ga0496104_0175175_1145_1738 176
686 3300048907 Ga0496104_0310504 Ga0496104_0310504_786_1319 176
687 3300048907 Ga0496104_0387683 Ga0496104_0387683_50_592 176
688 3300048908 Ga0496105_0123282 Ga0496105_0123282_863_1405 176
689 3300048908 Ga0496105_0686701 Ga0496105_0686701_208_741 176
690 3300048908 Ga0496105_0757091 Ga0496105_0757091_22_615 176
691 3300048909 Ga0496106_0171922 Ga0496106_0171922_912_1454 176
692 3300048909 Ga0496106_0324021 Ga0496106_0324021_330_863 176
693 3300048910 Ga0496107_0445557 Ga0496107_0445557_53_586 176
694 3300048912 Ga0496109_1044853 Ga0496109_1044853_83_616 176
695 3300048913 Ga0496110_0013298 Ga0496110_0013298_4396_4926 176
696 3300048913 Ga0496110_0059899 Ga0496110_0059899_1235_1777 176
697 3300048914 Ga0496111_0721866 Ga0496111_0721866_54_584 176
698 3300048915 Ga0496112_0010933 Ga0496112_0010933_1980_2513 176
699 3300048915 Ga0496112_0011133 Ga0496112_0011133_4750_5343 176
700 3300048915 Ga0496112_0093619 Ga0496112_0093619_2413_2946 176
701 3300048915 Ga0496112_0333281 Ga0496112_0333281_790_1335 176
702 3300048915 Ga0496112_0348878 Ga0496112_0348878_721_1263 176
703 3300048915 Ga0496112_0795584 Ga0496112_0795584_72_605 176
704 3300048918 Ga0496115_0144082 Ga0496115_0144082_802_1395 176
705 3300048918 Ga0496115_0170915 Ga0496115_0170915_973_1506 176
706 3300048918 Ga0496115_0216962 Ga0496115_0216962_776_1309 176
707 3300050512 nmdc:mga0n895_123205_c1 nmdc:mga0n895_123205_c1_425_958 176
708 3300050513 nmdc:mga0rr50_124073_c2 nmdc:mga0rr50_124073_c2_736_1269 176
709 3300050513 nmdc:mga0rr50_32577_c1 nmdc:mga0rr50_32577_c1_2468_3007 176
710 3300050513 nmdc:mga0rr50_4897_c1 nmdc:mga0rr50_4897_c1_5876_6409 176
711 3300050514 nmdc:mga08x19_859_c1 nmdc:mga08x19_859_c1_1848_2381 176
712 3300050514 nmdc:mga08x19_9722_c1 nmdc:mga08x19_9722_c1_1328_1867 176
713 3300053077 Ga0495601_0264188 Ga0495601_0264188_461_994 176
714 3300053093 Ga0500651_0000007 Ga0500651_0000007_246341_246916 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

72

183

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.7078 21 170
6o6m-assembly1.cif.gz_C the structure of egtb (cabther) 0.6897 27 165
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.6816 23 164
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6816 26 162
6o6l-assembly1.cif.gz_C the structure of egtb(cabther) in complex with hercynine 0.6757 27 165
ID Description Score Start End Superfamily
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.706 27 159 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6975 21 170 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6791 23 159 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6743 30 162 1.20.120.450
5civA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6706 23 166 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1Q7V3R7-F1-model_v4 DinB-like domain-containing protein 0.9869 20 176
AF-A0A3D5KL48-F1-model_v4 DinB-like domain-containing protein 0.9768 21 176
AF-A0A847RJ41-F1-model_v4 DinB family protein 0.9717 20 176
AF-A0A358G9T4-F1-model_v4 deleted 0.9707 26 170
AF-A0A7Y4VIN9-F1-model_v4 DinB family protein 0.9613 24 175

Feature Viewer

pLDDT pTM Quality
91.08 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map