F475240

General Info

Members Datasets Scaffolds Average Seq Length
687 237 1374 568

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100011851|Ga0070699_1000118515
Length 568
Sequence MTEPRAPSPQSRVYDVCIVGSGAGGGMAAHALTRAGADVIVLEAGVPWDNLKDSAMLTWPYESPRRGRSTKDHPFGEFDGCIGGWEIEGEPYTRAPGTEFNWWRARMVGGRTNHWGRISLRFGPYDFKRKSRDGLGDDWPISYEEVAAFYDKIDRLIGVFGSKESLPNEPDGVFLPPPRPRCHELLVKQAADRLHITCIPSRLSILTRPLNGRAPCHYCGQCNRGCRVNANFTSTNVLIGPALTTGRLTLVTNAMAREVTVDKAGRASGVAYVDKTTGSDQHVRARVVVLAASALETARLLLNSKSSAFPSGLANGSGTVGKYITDTTGTDVGGFIPKMMDHVPHNHDGVGGMHLYMPWWLEDQKLDFPRGYHIEVWGGTQVPSYGFGGGIQRYPSGGGYGKQLKDDYRRYYGATVGFSGRGEMIPNDDTYCEIDPRTVDRWGIPVLRFHWKWSDHEYKQVKHMQETFRALIEAMGGEVFSPMPGPERGYGIAAGGVIIHELGGARMGDDPKTSVTNRWCQAHECKNLFLADGAPFVSQADKNPTWTILALSLRTSEHIADLMKRGEL

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
171 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.51
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 8.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100011851 3300005518 Bacteria 7524
2 Ga0070658_10063868 3300005327 Bacteria 3002
3 Ga0070676_10027734 3300005328 Bacteria 3213
4 Ga0070683_100000496 3300005329 Bacteria 27786
5 Ga0070683_100001098 3300005329 Bacteria 20381
6 Ga0070683_100009054 3300005329 Bacteria 8497
7 Ga0070683_100013474 3300005329 Bacteria 7132
8 Ga0070683_100068690 3300005329 Bacteria 3302
9 Ga0070690_100009920 3300005330 Bacteria 5526
10 Ga0070670_100005903 3300005331 Bacteria 10351
11 Ga0070670_100010229 3300005331 Bacteria 8006
12 Ga0068869_100003211 3300005334 Bacteria 9993
13 Ga0068869_100011746 3300005334 Bacteria 5757
14 Ga0068869_100015327 3300005334 Bacteria 5138
15 Ga0068869_100032775 3300005334 Bacteria 3663
16 Ga0068869_100086524 3300005334 Bacteria 2349
17 Ga0070666_10002725 3300005335 Bacteria 10673
18 Ga0070680_100044939 3300005336 Bacteria 3590
19 Ga0070680_100053426 3300005336 Unclassified 3298
20 Ga0068868_100003471 3300005338 Bacteria 10979
21 Ga0068868_100005053 3300005338 Bacteria 9261
22 Ga0068868_100008104 3300005338 Bacteria 7514
23 Ga0068868_100044042 3300005338 Unclassified 3488
24 Ga0070660_100009323 3300005339 Bacteria 6897
25 Ga0070660_100068794 3300005339 Bacteria 2760
26 Ga0070689_100000550 3300005340 Bacteria 22415
27 Ga0070691_10036812 3300005341 Bacteria 2307
28 Ga0070687_100006094 3300005343 Bacteria 4922
29 Ga0070661_100002953 3300005344 Bacteria 11732
30 Ga0070661_100005979 3300005344 Bacteria 8378
31 Ga0070661_100006808 3300005344 Bacteria 7881
32 Ga0070661_100009772 3300005344 Bacteria 6654
33 Ga0070661_100068299 3300005344 Unclassified 2612
34 Ga0070668_100006081 3300005347 Bacteria 8952
35 Ga0070668_100012100 3300005347 Bacteria 6426
36 Ga0070669_100012871 3300005353 Bacteria 5942
37 Ga0070669_100022835 3300005353 Bacteria 4475
38 Ga0070675_100009201 3300005354 Bacteria 7673
39 Ga0070671_100045357 3300005355 Bacteria 3654
40 Ga0070671_100089295 3300005355 Bacteria 2580
41 Ga0070674_100003574 3300005356 Bacteria 8740
42 Ga0070673_100084581 3300005364 Bacteria 2580
43 Ga0070688_100000197 3300005365 Bacteria 32010
44 Ga0070659_100006718 3300005366 Bacteria 8316
45 Ga0070659_100011058 3300005366 Bacteria 6666
46 Ga0070667_100005223 3300005367 Bacteria 10853
47 Ga0070709_10000899 3300005434 Bacteria 16569
48 Ga0070709_10031441 3300005434 Unclassified 3192
49 Ga0070714_100001358 3300005435 Bacteria 17707
50 Ga0070714_100006555 3300005435 Bacteria 9004
51 Ga0070714_100029396 3300005435 Bacteria 4569
52 Ga0070714_100042616 3300005435 Unclassified 3835
53 Ga0070714_100051489 3300005435 Bacteria 3510
54 Ga0070713_100000134 3300005436 Bacteria 48639
55 Ga0070713_100001365 3300005436 Bacteria 15613
56 Ga0070713_100002354 3300005436 Bacteria 12338
57 Ga0070713_100036781 3300005436 Unclassified 3954
58 Ga0070713_100041168 3300005436 Unclassified 3762
59 Ga0070713_100058279 3300005436 Archaea 3220
60 Ga0070713_100065399 3300005436 Unclassified 3055
61 Ga0070713_100111355 3300005436 Unclassified 2387
62 Ga0070710_10035394 3300005437 Unclassified 2722
63 Ga0070711_100000814 3300005439 Bacteria 16335
64 Ga0070711_100001063 3300005439 Bacteria 14659
65 Ga0070711_100002531 3300005439 Bacteria 10457
66 Ga0070711_100084603 3300005439 Unclassified 2269
67 Ga0070705_100008919 3300005440 Bacteria 4973
68 Ga0070694_100004167 3300005444 Bacteria 8686
69 Ga0070694_100047874 3300005444 Bacteria 2874
70 Ga0070708_100000598 3300005445 Bacteria 27157
71 Ga0070708_100001014 3300005445 Bacteria 21388
72 Ga0070708_100004228 3300005445 Bacteria 11275
73 Ga0070708_100013577 3300005445 Bacteria 6675
74 Ga0070708_100015179 3300005445 Bacteria 6351
75 Ga0070708_100015797 3300005445 Bacteria 6242
76 Ga0070708_100030590 3300005445 Bacteria 4654
77 Ga0070708_100048646 3300005445 Bacteria 3749
78 Ga0070708_100074323 3300005445 Bacteria 3065
79 Ga0070708_100151173 3300005445 Bacteria 2159
80 Ga0070663_100003084 3300005455 Bacteria 9526
81 Ga0070663_100007437 3300005455 Bacteria 6663
82 Ga0070678_100006234 3300005456 Bacteria 6977
83 Ga0070662_100001005 3300005457 Bacteria 17236
84 Ga0070662_100007919 3300005457 Bacteria 6909
85 Ga0070681_10002963 3300005458 Bacteria 15761
86 Ga0070681_10005375 3300005458 Bacteria 12370
87 Ga0068867_100001846 3300005459 Bacteria 14738
88 Ga0068867_100028245 3300005459 Bacteria 4038
89 Ga0070685_10003176 3300005466 Bacteria 8357
90 Ga0070706_100000980 3300005467 Bacteria 31089
91 Ga0070706_100050660 3300005467 Bacteria 3832
92 Ga0070706_100059978 3300005467 Unclassified 3512
93 Ga0070707_100000915 3300005468 Bacteria 29244
94 Ga0070707_100009766 3300005468 Bacteria 8921
95 Ga0070707_100125811 3300005468 Bacteria 2490
96 Ga0070698_100000140 3300005471 Bacteria 65074
97 Ga0070698_100043123 3300005471 Unclassified 4627
98 Ga0070698_100047025 3300005471 Unclassified 4411
99 Ga0070699_100006667 3300005518 Bacteria 10040
100 Ga0070699_100006913 3300005518 Bacteria 9865
101 Ga0070699_100010792 3300005518 Bacteria 7906
102 Ga0070699_100029973 3300005518 Bacteria 4694
103 Ga0070699_100035282 3300005518 Unclassified 4323
104 Ga0070679_100003801 3300005530 Bacteria 13856
105 Ga0070679_100022913 3300005530 Bacteria 6108
106 Ga0070679_100069245 3300005530 Bacteria 3520
107 Ga0070684_100002526 3300005535 Bacteria 13497
108 Ga0070684_100004956 3300005535 Bacteria 10161
109 Ga0070684_100011109 3300005535 Bacteria 7164
110 Ga0070684_100033759 3300005535 Bacteria 4372
111 Ga0070684_100053708 3300005535 Bacteria 3509
112 Ga0070684_100101805 3300005535 Bacteria 2567
113 Ga0070697_100000015 3300005536 Bacteria 143397
114 Ga0070697_100000518 3300005536 Bacteria 29110
115 Ga0070697_100001215 3300005536 Bacteria 19429
116 Ga0070697_100008196 3300005536 Bacteria 8157
117 Ga0070697_100012341 3300005536 Bacteria 6693
118 Ga0070697_100051952 3300005536 Bacteria 3330
119 Ga0070697_100067374 3300005536 Unclassified 2928
120 Ga0068853_100000179 3300005539 Bacteria 44192
121 Ga0068853_100083325 3300005539 Bacteria 2802
122 Ga0068853_100100201 3300005539 Bacteria 2560
123 Ga0070672_100000810 3300005543 Bacteria 18654
124 Ga0070686_100003853 3300005544 Bacteria 8251
125 Ga0070695_100000210 3300005545 Bacteria 28472
126 Ga0070695_100004421 3300005545 Bacteria 8249
127 Ga0070695_100095390 3300005545 Bacteria 1993
128 Ga0070696_100002816 3300005546 Bacteria 11551
129 Ga0070696_100064741 3300005546 Bacteria 2562
130 Ga0070693_100000105 3300005547 Bacteria 37510
131 Ga0070693_100053715 3300005547 Bacteria 2314
132 Ga0070665_100010236 3300005548 Bacteria 9487
133 Ga0070704_100097476 3300005549 Bacteria 2206
134 Ga0068855_100001050 3300005563 Bacteria 34270
135 Ga0068855_100002077 3300005563 Bacteria 24799
136 Ga0068855_100002180 3300005563 Bacteria 24210
137 Ga0068855_100003268 3300005563 Bacteria 19840
138 Ga0068855_100007466 3300005563 Bacteria 13242
139 Ga0068855_100031181 3300005563 Bacteria 6367
140 Ga0068855_100049055 3300005563 Unclassified 4981
141 Ga0068855_100066847 3300005563 Unclassified 4190
142 Ga0068855_100080770 3300005563 Bacteria 3770
143 Ga0070664_100000457 3300005564 Bacteria 30953
144 Ga0070664_100010450 3300005564 Bacteria 7525
145 Ga0070664_100115180 3300005564 Bacteria 2349
146 Ga0068857_100002167 3300005577 Bacteria 15964
147 Ga0068857_100018225 3300005577 Bacteria 6157
148 Ga0068857_100112505 3300005577 Bacteria 2447
149 Ga0068854_100021010 3300005578 Bacteria 4425
150 Ga0068856_100000072 3300005614 Bacteria 95094
151 Ga0068856_100000346 3300005614 Bacteria 50548
152 Ga0068856_100003709 3300005614 Bacteria 15327
153 Ga0068856_100006056 3300005614 Bacteria 11886
154 Ga0068856_100007392 3300005614 Bacteria 10721
155 Ga0068856_100008986 3300005614 Bacteria 9721
156 Ga0068856_100009251 3300005614 Bacteria 9575
157 Ga0068856_100014582 3300005614 Bacteria 7594
158 Ga0068856_100034026 3300005614 Bacteria 4991
159 Ga0068856_100036579 3300005614 Bacteria 4813
160 Ga0068856_100038592 3300005614 Bacteria 4688
161 Ga0068856_100061482 3300005614 Bacteria 3710
162 Ga0068856_100075097 3300005614 Bacteria 3348
163 Ga0068856_100176545 3300005614 Bacteria 2149
164 Ga0070702_100000146 3300005615 Bacteria 22142
165 Ga0068852_100000009 3300005616 Bacteria 149600
166 Ga0068852_100000406 3300005616 Bacteria 28743
167 Ga0068852_100031868 3300005616 Bacteria 4358
168 Ga0068852_100052101 3300005616 Bacteria 3516
169 Ga0068852_100149109 3300005616 Bacteria 2173
170 Ga0068859_100006285 3300005617 Bacteria 12052
171 Ga0068859_100029749 3300005617 Bacteria 5480
172 Ga0068859_100109075 3300005617 Bacteria 2829
173 Ga0068864_100023233 3300005618 Bacteria 5205
174 Ga0068864_100033090 3300005618 Bacteria 4394
175 Ga0068864_100087397 3300005618 Bacteria 2744
176 Ga0068864_100094924 3300005618 Bacteria 2637
177 Ga0068864_100109283 3300005618 Bacteria 2462
178 Ga0068866_10001182 3300005718 Bacteria 11415
179 Ga0068861_100018868 3300005719 Bacteria 4917
180 Ga0068861_100057885 3300005719 Bacteria 2962
181 Ga0068851_10003049 3300005834 Bacteria 7409
182 Ga0068851_10007212 3300005834 Bacteria 5095
183 Ga0068870_10001323 3300005840 Bacteria 9974
184 Ga0068863_100010773 3300005841 Bacteria 8870
185 Ga0068863_100011177 3300005841 Bacteria 8702
186 Ga0068863_100012533 3300005841 Bacteria 8180
187 Ga0068863_100028831 3300005841 Bacteria 5301
188 Ga0068863_100030584 3300005841 Bacteria 5141
189 Ga0068863_100070880 3300005841 Unclassified 3297
190 Ga0068863_100167871 3300005841 Bacteria 2105
191 Ga0068858_100008509 3300005842 Bacteria 9860
192 Ga0068858_100011944 3300005842 Bacteria 8184
193 Ga0068858_100025578 3300005842 Bacteria 5492
194 Ga0068858_100036498 3300005842 Bacteria 4558
195 Ga0068858_100116252 3300005842 Bacteria 2500
196 Ga0068860_100005600 3300005843 Bacteria 12691
197 Ga0068860_100023618 3300005843 Bacteria 5942
198 Ga0068862_100003922 3300005844 Bacteria 12654
199 Ga0068862_100036976 3300005844 Bacteria 4137
200 Ga0070717_10001053 3300006028 Bacteria 18508
201 Ga0070717_10001280 3300006028 Bacteria 17207
202 Ga0070717_10001842 3300006028 Bacteria 14813
203 Ga0070717_10004636 3300006028 Bacteria 9964
204 Ga0070717_10006455 3300006028 Bacteria 8629
205 Ga0070717_10009698 3300006028 Bacteria 7246
206 Ga0070717_10013661 3300006028 Bacteria 6229
207 Ga0070717_10037695 3300006028 Bacteria 3927
208 Ga0070717_10083480 3300006028 Bacteria 2687
209 Ga0070717_10092915 3300006028 Bacteria 2549
210 Ga0070715_10001337 3300006163 Bacteria 7105
211 Ga0070715_10003622 3300006163 Bacteria 4954
212 Ga0070715_10007950 3300006163 Unclassified 3675
213 Ga0070716_100000114 3300006173 Bacteria 31714
214 Ga0070716_100002526 3300006173 Bacteria 8474
215 Ga0070716_100006521 3300006173 Bacteria 5705
216 Ga0070716_100006812 3300006173 Bacteria 5600
217 Ga0070712_100000100 3300006175 Bacteria 43745
218 Ga0070712_100000389 3300006175 Bacteria 25090
219 Ga0070712_100001533 3300006175 Bacteria 14105
220 Ga0070712_100001556 3300006175 Bacteria 14028
221 Ga0070712_100001951 3300006175 Bacteria 12648
222 Ga0070712_100056545 3300006175 Bacteria 2752
223 Ga0097621_100000117 3300006237 Bacteria 45470
224 Ga0097621_100000329 3300006237 Bacteria 32168
225 Ga0097621_100005597 3300006237 Bacteria 8858
226 Ga0097621_100005791 3300006237 Bacteria 8727
227 Ga0097621_100007474 3300006237 Bacteria 7818
228 Ga0097621_100014299 3300006237 Bacteria 5936
229 Ga0097621_100022905 3300006237 Bacteria 4854
230 Ga0097621_100025801 3300006237 Bacteria 4601
231 Ga0097621_100043365 3300006237 Unclassified 3626
232 Ga0097621_100085583 3300006237 Bacteria 2630
233 Ga0068871_100000971 3300006358 Bacteria 19186
234 Ga0068871_100014897 3300006358 Bacteria 5811
235 Ga0068871_100082202 3300006358 Bacteria 2670
236 Ga0068871_100096975 3300006358 Bacteria 2464
237 Ga0068871_100102961 3300006358 Bacteria 2393
238 Ga0075433_10000213 3300006852 Bacteria 32853
239 Ga0075433_10053871 3300006852 Unclassified 3509
240 Ga0075434_100000122 3300006871 Bacteria 45781
241 Ga0075434_100000564 3300006871 Bacteria 28515
242 Ga0075434_100001669 3300006871 Bacteria 18928
243 Ga0075434_100009940 3300006871 Bacteria 8901
244 Ga0075434_100015193 3300006871 Bacteria 7376
245 Ga0075434_100042690 3300006871 Bacteria 4496
246 Ga0068865_100002421 3300006881 Bacteria 11021
247 Ga0068865_100004633 3300006881 Bacteria 8304
248 Ga0068865_100005168 3300006881 Bacteria 7897
249 Ga0075436_100002250 3300006914 Bacteria 13326
250 Ga0075436_100014222 3300006914 Bacteria 5449
251 Ga0075436_100017147 3300006914 Bacteria 4956
252 Ga0075436_100050586 3300006914 Unclassified 2868
253 Ga0097620_100006285 3300006931 Bacteria 12052
254 Ga0097620_100029749 3300006931 Bacteria 5480
255 Ga0097620_100109078 3300006931 Bacteria 2829
256 Ga0075435_100000038 3300007076 Bacteria 67821
257 Ga0075435_100075816 3300007076 Bacteria 2755
258 Ga0075435_100081819 3300007076 Unclassified 2653
259 Ga0099794_10003075 3300007265 Bacteria 6303
260 Ga0099794_10007517 3300007265 Bacteria 4482
261 Ga0099794_10019157 3300007265 Bacteria 3078
262 Ga0099794_10023702 3300007265 Bacteria 2811
263 Ga0099795_10004867 3300007788 Bacteria 3511
264 Ga0105240_10000148 3300009093 Bacteria 142265
265 Ga0105240_10002085 3300009093 Bacteria 32732
266 Ga0105240_10003334 3300009093 Bacteria 24999
267 Ga0105240_10003778 3300009093 Bacteria 23384
268 Ga0105240_10016695 3300009093 Bacteria 9929
269 Ga0105240_10022638 3300009093 Bacteria 8325
270 Ga0105240_10039166 3300009093 Bacteria 6072
271 Ga0105240_10041000 3300009093 Bacteria 5914
272 Ga0105240_10062894 3300009093 Bacteria 4619
273 Ga0105240_10086421 3300009093 Unclassified 3841
274 Ga0105240_10137558 3300009093 Bacteria 2924
275 Ga0105240_10200390 3300009093 Bacteria 2339
276 Ga0105245_10002835 3300009098 Bacteria 15579
277 Ga0105245_10023408 3300009098 Bacteria 5421
278 Ga0105245_10034473 3300009098 Bacteria 4490
279 Ga0105245_10076732 3300009098 Bacteria 3045
280 Ga0105245_10157031 3300009098 Bacteria 2155
281 Ga0105247_10003343 3300009101 Bacteria 10499
282 Ga0114129_10094507 3300009147 Bacteria 4141
283 Ga0114129_10109743 3300009147 Bacteria 3808
284 Ga0105243_10056060 3300009148 Bacteria 3132
285 Ga0105241_10000034 3300009174 Bacteria 115663
286 Ga0105241_10000157 3300009174 Bacteria 49365
287 Ga0105241_10001200 3300009174 Bacteria 19826
288 Ga0105241_10007492 3300009174 Bacteria 8033
289 Ga0105241_10018950 3300009174 Bacteria 5072
290 Ga0105241_10028405 3300009174 Bacteria 4169
291 Ga0105242_10081172 3300009176 Bacteria 2711
292 Ga0105248_10000003 3300009177 Bacteria 1019601
293 Ga0105248_10009349 3300009177 Bacteria 10790
294 Ga0105248_10010236 3300009177 Bacteria 10325
295 Ga0105248_10129135 3300009177 Bacteria 2851
296 Ga0105237_10001511 3300009545 Bacteria 30572
297 Ga0105237_10005226 3300009545 Bacteria 14688
298 Ga0105237_10010821 3300009545 Bacteria 9682
299 Ga0105237_10014822 3300009545 Bacteria 8135
300 Ga0105237_10081703 3300009545 Unclassified 3222
301 Ga0105237_10155290 3300009545 Bacteria 2285
302 Ga0105238_10000121 3300009551 Bacteria 85582
303 Ga0105238_10007714 3300009551 Bacteria 10758
304 Ga0105238_10007802 3300009551 Bacteria 10706
305 Ga0105238_10018538 3300009551 Bacteria 7084
306 Ga0105238_10048974 3300009551 Bacteria 4257
307 Ga0105238_10112641 3300009551 Unclassified 2700
308 Ga0105249_10026101 3300009553 Bacteria 5262
309 Ga0099796_10002143 3300010159 Bacteria 4252
310 Ga0105239_10002108 3300010375 Bacteria 25691
311 Ga0105239_10007899 3300010375 Bacteria 12162
312 Ga0105239_10013560 3300010375 Bacteria 9048
313 Ga0105239_10032944 3300010375 Bacteria 5693
314 Ga0105239_10034893 3300010375 Bacteria 5525
315 Ga0105239_10206745 3300010375 Unclassified 2200
316 Ga0105246_10007094 3300011119 Bacteria 6857
317 Ga0105246_10041358 3300011119 Bacteria 3115
318 Ga0157373_10001145 3300013100 Bacteria 20351
319 Ga0157373_10011714 3300013100 Bacteria 6441
320 Ga0157373_10039559 3300013100 Bacteria 3376
321 Ga0157373_10107230 3300013100 Bacteria 1964
322 Ga0157371_10006441 3300013102 Bacteria 9685
323 Ga0157371_10031814 3300013102 Bacteria 3799
324 Ga0157370_10000059 3300013104 Bacteria 116740
325 Ga0157369_10000035 3300013105 Bacteria 191300
326 Ga0157369_10000468 3300013105 Bacteria 53588
327 Ga0157369_10000617 3300013105 Bacteria 46260
328 Ga0157369_10001957 3300013105 Bacteria 24813
329 Ga0157369_10007147 3300013105 Bacteria 12867
330 Ga0157369_10007485 3300013105 Bacteria 12567
331 Ga0157369_10007497 3300013105 Bacteria 12555
332 Ga0157369_10007988 3300013105 Bacteria 12155
333 Ga0157369_10018975 3300013105 Bacteria 7703
334 Ga0157369_10019328 3300013105 Bacteria 7622
335 Ga0157369_10028070 3300013105 Bacteria 6232
336 Ga0157369_10056407 3300013105 Unclassified 4239
337 Ga0157369_10075426 3300013105 Bacteria 3616
338 Ga0157369_10100117 3300013105 Bacteria 3089
339 Ga0157374_10000294 3300013296 Bacteria 46093
340 Ga0157374_10003048 3300013296 Bacteria 14047
341 Ga0157374_10003917 3300013296 Bacteria 12506
342 Ga0157374_10009405 3300013296 Bacteria 8389
343 Ga0157374_10015000 3300013296 Bacteria 6791
344 Ga0157374_10075570 3300013296 Bacteria 3183
345 Ga0157378_10000217 3300013297 Bacteria 55710
346 Ga0157378_10000250 3300013297 Bacteria 52510
347 Ga0157378_10002396 3300013297 Bacteria 16655
348 Ga0157378_10004037 3300013297 Bacteria 12960
349 Ga0157378_10028879 3300013297 Bacteria 4896
350 Ga0157378_10031278 3300013297 Bacteria 4701
351 Ga0157378_10040910 3300013297 Bacteria 4111
352 Ga0157378_10053830 3300013297 Bacteria 3583
353 Ga0157378_10069112 3300013297 Bacteria 3168
354 Ga0163162_10005493 3300013306 Bacteria 12250
355 Ga0163162_10021857 3300013306 Bacteria 6303
356 Ga0157372_10000049 3300013307 Bacteria 142350
357 Ga0157372_10000504 3300013307 Bacteria 42933
358 Ga0157372_10000951 3300013307 Bacteria 31615
359 Ga0157372_10001326 3300013307 Bacteria 26787
360 Ga0157372_10001767 3300013307 Bacteria 23440
361 Ga0157372_10002380 3300013307 Bacteria 20348
362 Ga0157372_10005533 3300013307 Bacteria 13430
363 Ga0157372_10026556 3300013307 Bacteria 6302
364 Ga0157372_10034155 3300013307 Bacteria 5590
365 Ga0157372_10085623 3300013307 Bacteria 3575
366 Ga0157372_10131718 3300013307 Unclassified 2877
367 Ga0157372_10143191 3300013307 Bacteria 2756
368 Ga0157372_10249514 3300013307 Bacteria 2060
369 Ga0157375_10015850 3300013308 Bacteria 6754
370 Ga0157375_10022219 3300013308 Bacteria 5837
371 Ga0157375_10117734 3300013308 Unclassified 2762
372 Ga0157375_10135046 3300013308 Bacteria 2590
373 Ga0163163_10012152 3300014325 Bacteria 7834
374 Ga0163163_10016663 3300014325 Bacteria 6834
375 Ga0182008_10004291 3300014497 Bacteria 8350
376 Ga0157377_10006030 3300014745 Bacteria 5748
377 Ga0157379_10011316 3300014968 Bacteria 7778
378 Ga0157379_10021319 3300014968 Bacteria 5734
379 Ga0157376_10000023 3300014969 Bacteria 223978
380 Ga0157376_10000828 3300014969 Bacteria 20258
381 Ga0157376_10007328 3300014969 Bacteria 7862
382 Ga0157376_10019767 3300014969 Bacteria 5197
383 Ga0157376_10051629 3300014969 Bacteria 3416
384 Ga0157376_10057382 3300014969 Bacteria 3256
385 Ga0157376_10063234 3300014969 Bacteria 3117
386 Ga0163161_10014818 3300017792 Bacteria 5431
387 Ga0207697_10015086 3300025315 Bacteria 3197
388 Ga0207656_10017038 3300025321 Bacteria 2840
389 Ga0207692_10005505 3300025898 Bacteria 5078
390 Ga0207692_10031103 3300025898 Bacteria 2553
391 Ga0207642_10023834 3300025899 Bacteria 2451
392 Ga0207647_10016743 3300025904 Bacteria 4995
393 Ga0207685_10001246 3300025905 Bacteria 5189
394 Ga0207699_10000496 3300025906 Bacteria 19714
395 Ga0207645_10000471 3300025907 Bacteria 33296
396 Ga0207645_10003288 3300025907 Bacteria 12327
397 Ga0207643_10000375 3300025908 Bacteria 30034
398 Ga0207705_10044818 3300025909 Unclassified 3179
399 Ga0207705_10057727 3300025909 Bacteria 2799
400 Ga0207684_10001117 3300025910 Bacteria 29965
401 Ga0207684_10007311 3300025910 Bacteria 9962
402 Ga0207684_10007842 3300025910 Bacteria 9548
403 Ga0207684_10110009 3300025910 Unclassified 2359
404 Ga0207684_10145399 3300025910 Bacteria 2039
405 Ga0207654_10000029 3300025911 Bacteria 123429
406 Ga0207654_10000097 3300025911 Bacteria 59168
407 Ga0207654_10013372 3300025911 Bacteria 4223
408 Ga0207707_10003501 3300025912 Bacteria 13896
409 Ga0207707_10038050 3300025912 Unclassified 4204
410 Ga0207695_10000096 3300025913 Bacteria 265048
411 Ga0207695_10000105 3300025913 Bacteria 254764
412 Ga0207695_10000461 3300025913 Bacteria 88337
413 Ga0207695_10006004 3300025913 Bacteria 15875
414 Ga0207695_10015608 3300025913 Bacteria 8933
415 Ga0207695_10023604 3300025913 Bacteria 6941
416 Ga0207695_10035449 3300025913 Bacteria 5410
417 Ga0207695_10043213 3300025913 Bacteria 4804
418 Ga0207695_10069900 3300025913 Bacteria 3592
419 Ga0207671_10000390 3300025914 Bacteria 61349
420 Ga0207671_10001421 3300025914 Bacteria 27820
421 Ga0207671_10010795 3300025914 Bacteria 7495
422 Ga0207671_10061085 3300025914 Bacteria 2796
423 Ga0207693_10000034 3300025915 Bacteria 113763
424 Ga0207693_10000164 3300025915 Bacteria 59739
425 Ga0207693_10000275 3300025915 Bacteria 47590
426 Ga0207693_10003136 3300025915 Bacteria 14213
427 Ga0207693_10011260 3300025915 Bacteria 7240
428 Ga0207693_10023128 3300025915 Unclassified 4935
429 Ga0207693_10042748 3300025915 Bacteria 3567
430 Ga0207693_10047262 3300025915 Bacteria 3381
431 Ga0207663_10025097 3300025916 Unclassified 3441
432 Ga0207663_10075238 3300025916 Bacteria 2191
433 Ga0207660_10018437 3300025917 Bacteria 4652
434 Ga0207660_10030633 3300025917 Bacteria 3699
435 Ga0207662_10002575 3300025918 Bacteria 9138
436 Ga0207657_10000254 3300025919 Bacteria 56893
437 Ga0207657_10002735 3300025919 Bacteria 18996
438 Ga0207657_10005257 3300025919 Bacteria 13559
439 Ga0207649_10000233 3300025920 Bacteria 45406
440 Ga0207649_10016237 3300025920 Bacteria 4194
441 Ga0207649_10018077 3300025920 Bacteria 4002
442 Ga0207649_10028858 3300025920 Bacteria 3271
443 Ga0207649_10051043 3300025920 Bacteria 2560
444 Ga0207649_10052436 3300025920 Bacteria 2530
445 Ga0207649_10096657 3300025920 Bacteria 1946
446 Ga0207652_10006558 3300025921 Bacteria 9380
447 Ga0207652_10021150 3300025921 Bacteria 5368
448 Ga0207646_10000471 3300025922 Bacteria 53728
449 Ga0207646_10010305 3300025922 Bacteria 9142
450 Ga0207646_10032934 3300025922 Unclassified 4687
451 Ga0207681_10053553 3300025923 Bacteria 2740
452 Ga0207694_10000104 3300025924 Bacteria 91561
453 Ga0207694_10005650 3300025924 Bacteria 9595
454 Ga0207650_10000107 3300025925 Bacteria 109863
455 Ga0207650_10008720 3300025925 Bacteria 6924
456 Ga0207650_10030113 3300025925 Bacteria 3907
457 Ga0207687_10004264 3300025927 Bacteria 9564
458 Ga0207700_10000111 3300025928 Bacteria 48784
459 Ga0207700_10032088 3300025928 Unclassified 3741
460 Ga0207700_10098057 3300025928 Bacteria 2330
461 Ga0207700_10138713 3300025928 Unclassified 1995
462 Ga0207664_10025215 3300025929 Bacteria 4476
463 Ga0207664_10035263 3300025929 Bacteria 3859
464 Ga0207664_10148565 3300025929 Bacteria 1989
465 Ga0207644_10004657 3300025931 Bacteria 8914
466 Ga0207706_10000238 3300025933 Bacteria 60595
467 Ga0207706_10003488 3300025933 Bacteria 15016
468 Ga0207706_10005861 3300025933 Bacteria 11429
469 Ga0207706_10033194 3300025933 Bacteria 4594
470 Ga0207669_10039321 3300025937 Bacteria 2732
471 Ga0207704_10006270 3300025938 Bacteria 5531
472 Ga0207704_10014847 3300025938 Unclassified 3948
473 Ga0207665_10000040 3300025939 Bacteria 84223
474 Ga0207665_10003529 3300025939 Bacteria 10445
475 Ga0207665_10006116 3300025939 Bacteria 7992
476 Ga0207665_10009881 3300025939 Bacteria 6262
477 Ga0207665_10011614 3300025939 Bacteria 5788
478 Ga0207665_10011903 3300025939 Bacteria 5713
479 Ga0207665_10011970 3300025939 Bacteria 5698
480 Ga0207665_10019746 3300025939 Bacteria 4429
481 Ga0207691_10000751 3300025940 Bacteria 32082
482 Ga0207691_10081386 3300025940 Bacteria 2911
483 Ga0207711_10000013 3300025941 Bacteria 514850
484 Ga0207711_10000708 3300025941 Bacteria 32770
485 Ga0207711_10072624 3300025941 Bacteria 2989
486 Ga0207689_10000105 3300025942 Bacteria 68595
487 Ga0207689_10000713 3300025942 Bacteria 31792
488 Ga0207689_10003153 3300025942 Bacteria 15125
489 Ga0207689_10024883 3300025942 Bacteria 5019
490 Ga0207689_10047852 3300025942 Bacteria 3528
491 Ga0207661_10000138 3300025944 Bacteria 46093
492 Ga0207661_10014752 3300025944 Bacteria 5732
493 Ga0207661_10023158 3300025944 Bacteria 4690
494 Ga0207661_10049937 3300025944 Bacteria 3332
495 Ga0207661_10149111 3300025944 Bacteria 2020
496 Ga0207679_10000058 3300025945 Bacteria 101602
497 Ga0207679_10016880 3300025945 Unclassified 4854
498 Ga0207667_10001323 3300025949 Bacteria 31111
499 Ga0207667_10004082 3300025949 Bacteria 17933
500 Ga0207667_10005768 3300025949 Bacteria 15107
501 Ga0207667_10005835 3300025949 Bacteria 15004
502 Ga0207667_10028895 3300025949 Bacteria 6019
503 Ga0207667_10031572 3300025949 Bacteria 5716
504 Ga0207667_10038955 3300025949 Bacteria 5068
505 Ga0207667_10050227 3300025949 Bacteria 4401
506 Ga0207667_10089642 3300025949 Bacteria 3178
507 Ga0207712_10006914 3300025961 Bacteria 7158
508 Ga0207668_10003703 3300025972 Bacteria 8999
509 Ga0207640_10013067 3300025981 Bacteria 4748
510 Ga0207640_10031274 3300025981 Bacteria 3287
511 Ga0207658_10034607 3300025986 Bacteria 3611
512 Ga0207677_10001114 3300026023 Bacteria 14641
513 Ga0207677_10003786 3300026023 Bacteria 8038
514 Ga0207677_10004408 3300026023 Bacteria 7548
515 Ga0207677_10018639 3300026023 Bacteria 4170
516 Ga0207677_10025030 3300026023 Bacteria 3718
517 Ga0207703_10002099 3300026035 Bacteria 17533
518 Ga0207703_10002661 3300026035 Bacteria 15360
519 Ga0207703_10042648 3300026035 Bacteria 3640
520 Ga0207703_10097565 3300026035 Bacteria 2483
521 Ga0207703_10129058 3300026035 Bacteria 2181
522 Ga0207639_10000147 3300026041 Bacteria 52732
523 Ga0207639_10042714 3300026041 Bacteria 3399
524 Ga0207639_10056976 3300026041 Bacteria 2998
525 Ga0207678_10000256 3300026067 Bacteria 48140
526 Ga0207678_10001492 3300026067 Bacteria 21439
527 Ga0207702_10000436 3300026078 Bacteria 47578
528 Ga0207702_10000679 3300026078 Bacteria 36920
529 Ga0207702_10000860 3300026078 Bacteria 31725
530 Ga0207702_10012416 3300026078 Bacteria 7092
531 Ga0207702_10017930 3300026078 Bacteria 5856
532 Ga0207702_10020318 3300026078 Bacteria 5501
533 Ga0207702_10025887 3300026078 Unclassified 4870
534 Ga0207702_10037829 3300026078 Bacteria 4040
535 Ga0207702_10128335 3300026078 Bacteria 2279
536 Ga0207641_10000163 3300026088 Bacteria 94033
537 Ga0207641_10003212 3300026088 Bacteria 14628
538 Ga0207641_10013835 3300026088 Bacteria 6618
539 Ga0207641_10060386 3300026088 Unclassified 3231
540 Ga0207641_10066043 3300026088 Bacteria 3096
541 Ga0207648_10000604 3300026089 Bacteria 40445
542 Ga0207648_10006028 3300026089 Bacteria 12087
543 Ga0207648_10017106 3300026089 Bacteria 6608
544 Ga0207676_10000142 3300026095 Bacteria 62851
545 Ga0207676_10001489 3300026095 Bacteria 17325
546 Ga0207676_10027492 3300026095 Bacteria 4237
547 Ga0207676_10091999 3300026095 Bacteria 2493
548 Ga0207674_10000336 3300026116 Bacteria 60214
549 Ga0207674_10006617 3300026116 Bacteria 13618
550 Ga0207674_10013044 3300026116 Bacteria 9256
551 Ga0207674_10028182 3300026116 Bacteria 5931
552 Ga0207674_10074895 3300026116 Bacteria 3396
553 Ga0207675_100033596 3300026118 Bacteria 4779
554 Ga0207675_100082153 3300026118 Bacteria 3022
555 Ga0207683_10000078 3300026121 Bacteria 77219
556 Ga0207683_10001600 3300026121 Bacteria 20352
557 Ga0207683_10006753 3300026121 Bacteria 9816
558 Ga0207698_10000020 3300026142 Bacteria 139630
559 Ga0207698_10000316 3300026142 Bacteria 28798
560 Ga0207698_10010630 3300026142 Bacteria 5931
561 Ga0207698_10093894 3300026142 Unclassified 2465
562 Ga0209588_1003163 3300027671 Bacteria 4540
563 Ga0209588_1008523 3300027671 Unclassified 3043
564 Ga0265354_1000067 3300028016 Bacteria 17414
565 Ga0265356_1000027 3300028017 Bacteria 22799
566 Ga0268266_10000276 3300028379 Bacteria 84981
567 Ga0268266_10022928 3300028379 Bacteria 5312
568 Ga0268266_10049729 3300028379 Bacteria 3596
569 Ga0268265_10018167 3300028380 Bacteria 4870
570 Ga0268264_10003435 3300028381 Bacteria 13665
571 Ga0268264_10005525 3300028381 Bacteria 10721
572 Ga0268264_10028085 3300028381 Bacteria 4602
573 Ga0265338_10000633 3300028800 Bacteria 61054
574 Ga0265762_1000402 3300030760 Bacteria 7440
575 Ga0265762_1000913 3300030760 Bacteria 5265
576 Ga0265770_1001056 3300030878 Bacteria 3822
577 Ga0265760_10009661 3300031090 Bacteria 2755
578 Ga0265339_10004676 3300031249 Bacteria 9294
579 Ga0265316_10026823 3300031344 Bacteria 4784
580 Ga0265314_10039621 3300031711 Bacteria 3391
581 Ga0373959_0000161 3300034820 Bacteria 15201
582 Ga0373932_0004078 3300035112 Bacteria 3471
583 Ga0373936_0020305 3300035113 Unclassified 2580
584 Ga0373960_0009799 3300035121 Bacteria 2329
585 Ga0373946_0000567 3300035171 Bacteria 12201
586 Ga0373946_0021182 3300035171 Unclassified 2519
587 Ga0373931_0032592 3300035691 Bacteria 2697
588 Ga0373935_0001647 3300035692 Bacteria 12486
589 Ga0373935_0064068 3300035692 Unclassified 2356
590 Ga0373927_0000203 3300035695 Bacteria 47593
591 Ga0373927_0020898 3300035695 Unclassified 4290
592 Ga0373927_0075539 3300035695 Bacteria 2182
593 Ga0373933_0058870 3300035724 Unclassified 2312
594 Ga0373947_0005482 3300035725 Bacteria 7404
595 Ga0373937_0094651 3300036401 Bacteria 2770
596 Ga0373925_0000172 3300037068 Bacteria 70000
597 Ga0373925_0009682 3300037068 Bacteria 7010
598 Ga0373925_0012233 3300037068 Bacteria 6210
599 Ga0373925_0061770 3300037068 Bacteria 2815
600 Ga0373925_0063691 3300037068 Bacteria 2775
601 Ga0436365_1656802 3300039437 Bacteria 9654
602 Ga0466963_0005652 3300044694 Bacteria 7344
603 Ga0466963_0082063 3300044694 Bacteria 2185
604 Ga0466967_0018480 3300045976 Bacteria 5573
605 Ga0495603_0022592 3300046455 Bacteria 3807
606 Ga0495629_0045788 3300046459 Bacteria 3069
607 Ga0495641_0028581 3300046461 Bacteria 2697
608 Ga0495580_0003809 3300046472 Bacteria 12776
609 Ga0495580_0004417 3300046472 Bacteria 11814
610 Ga0495580_0013349 3300046472 Bacteria 6274
611 Ga0495580_0021204 3300046472 Bacteria 4797
612 Ga0495580_0023451 3300046472 Unclassified 4531
613 Ga0495580_0043095 3300046472 Bacteria 3213
614 Ga0495580_0047984 3300046472 Bacteria 3026
615 Ga0495580_0083390 3300046472 Unclassified 2227
616 Ga0495582_0000277 3300046473 Bacteria 28667
617 Ga0495582_0002058 3300046473 Bacteria 11248
618 Ga0495664_0107868 3300046477 Unclassified 1680
619 Ga0495630_0005254 3300046517 Bacteria 9133
620 Ga0495665_0004469 3300046531 Bacteria 7546
621 Ga0495640_0040545 3300046533 Bacteria 3260
622 Ga0495634_0079352 3300046642 Bacteria 2150
623 Ga0495647_0002757 3300046681 Bacteria 5575
624 Ga0495658_0005438 3300046683 Bacteria 6262
625 Ga0495658_0021957 3300046683 Bacteria 3370
626 Ga0495669_0008161 3300046684 Unclassified 4394
627 Ga0495613_0010773 3300046689 Bacteria 6783
628 Ga0495624_0063174 3300046690 Bacteria 2315
629 Ga0495581_0022292 3300047315 Bacteria 3670
630 Ga0495674_0165823 3300047319 Unclassified 1846
631 Ga0495676_0018164 3300047321 Bacteria 6203
632 Ga0495593_0010495 3300047673 Bacteria 5347
633 Ga0495602_0042183 3300048088 Bacteria 4160
634 Ga0495602_0104809 3300048088 Bacteria 2313
635 Ga0496100_0000958 3300048903 Bacteria 13809
636 Ga0496101_0019396 3300048904 Bacteria 4642
637 Ga0496102_0001575 3300048905 Bacteria 20118
638 Ga0496102_0242480 3300048905 Bacteria 1699
639 Ga0496103_0013534 3300048906 Bacteria 4838
640 Ga0496104_0028148 3300048907 Bacteria 5208
641 Ga0496104_0139053 3300048907 Bacteria 2334
642 Ga0496104_0147163 3300048907 Bacteria 2262
643 Ga0496106_0031226 3300048909 Bacteria 3969
644 Ga0496106_0045641 3300048909 Bacteria 3292
645 Ga0496108_0000082 3300048911 Bacteria 101998
646 Ga0496109_0000148 3300048912 Bacteria 69299
647 Ga0496110_0002311 3300048913 Bacteria 14249
648 Ga0496110_0029670 3300048913 Bacteria 4710
649 Ga0496111_0010400 3300048914 Bacteria 6243
650 Ga0496111_0040939 3300048914 Bacteria 3324
651 Ga0496112_0000093 3300048915 Bacteria 58124
652 Ga0496112_0015242 3300048915 Bacteria 7166
653 Ga0496112_0052940 3300048915 Bacteria 3985
654 Ga0496112_0103558 3300048915 Bacteria 2816
655 Ga0496113_0003134 3300048916 Bacteria 9841
656 Ga0496113_0016718 3300048916 Bacteria 5073
657 Ga0496114_0013547 3300048917 Bacteria 6541
658 Ga0496114_0015725 3300048917 Bacteria 6089
659 Ga0496114_0036562 3300048917 Bacteria 4059
660 Ga0496114_0165154 3300048917 Bacteria 1927
661 Ga0496115_0003600 3300048918 Bacteria 11135
662 Ga0496115_0006608 3300048918 Bacteria 8500
663 Ga0496115_0007549 3300048918 Bacteria 8008
664 Ga0496115_0085588 3300048918 Bacteria 2571
665 Ga0496115_0164938 3300048918 Bacteria 1832
666 Ga0496126_0001121 3300048929 Bacteria 44841
667 nmdc:mga05p37_78294_c1 3300050507 Unclassified 4070
668 nmdc:mga0n895_102_c1 3300050512 Bacteria 50003
669 nmdc:mga0n895_11535_c1 3300050512 Bacteria 7891
670 nmdc:mga0n895_30546_c1 3300050512 Bacteria 5151
671 nmdc:mga0n895_325_c1 3300050512 Bacteria 30724
672 nmdc:mga0n895_44202_c1 3300050512 Bacteria 4344
673 nmdc:mga0n895_8777_c1 3300050512 Bacteria 8790
674 nmdc:mga0rr50_109473_c1 3300050513 Bacteria 2184
675 nmdc:mga0rr50_110_c1 3300050513 Bacteria 20297
676 nmdc:mga0rr50_199197_c1 3300050513 Bacteria 1645
677 nmdc:mga0rr50_87451_c1 3300050513 Unclassified 2419
678 nmdc:mga08x19_1121_c1 3300050514 Bacteria 16708
679 nmdc:mga08x19_23657_c1 3300050514 Unclassified 3812
680 nmdc:mga08x19_27595_c1 3300050514 Unclassified 3551
681 nmdc:mga08x19_29357_c1 3300050514 Bacteria 3449
682 nmdc:mga08x19_3025_c1 3300050514 Bacteria 10111
683 nmdc:mga08x19_90137_c1 3300050514 Bacteria 2023
684 nmdc:mga08x19_9881_c1 3300050514 Bacteria 5721
685 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
686 nmdc:mga0a205_2453_c1 3300050515 Bacteria 16370
687 Ga0495601_0034117 3300053077 Bacteria 3173
688 Ga0070699_100011851
689 Ga0070658_10063868
690 Ga0070676_10027734
691 Ga0070683_100000496
692 Ga0070683_100001098
693 Ga0070683_100009054
694 Ga0070683_100013474
695 Ga0070683_100068690
696 Ga0070690_100009920
697 Ga0070670_100005903
698 Ga0070670_100010229
699 Ga0068869_100003211
700 Ga0068869_100011746
701 Ga0068869_100015327
702 Ga0068869_100032775
703 Ga0068869_100086524
704 Ga0070666_10002725
705 Ga0070680_100044939
706 Ga0070680_100053426
707 Ga0068868_100003471
708 Ga0068868_100005053
709 Ga0068868_100008104
710 Ga0068868_100044042
711 Ga0070660_100009323
712 Ga0070660_100068794
713 Ga0070689_100000550
714 Ga0070691_10036812
715 Ga0070687_100006094
716 Ga0070661_100002953
717 Ga0070661_100005979
718 Ga0070661_100006808
719 Ga0070661_100009772
720 Ga0070661_100068299
721 Ga0070668_100006081
722 Ga0070668_100012100
723 Ga0070669_100012871
724 Ga0070669_100022835
725 Ga0070675_100009201
726 Ga0070671_100045357
727 Ga0070671_100089295
728 Ga0070674_100003574
729 Ga0070673_100084581
730 Ga0070688_100000197
731 Ga0070659_100006718
732 Ga0070659_100011058
733 Ga0070667_100005223
734 Ga0070709_10000899
735 Ga0070709_10031441
736 Ga0070714_100001358
737 Ga0070714_100006555
738 Ga0070714_100029396
739 Ga0070714_100042616
740 Ga0070714_100051489
741 Ga0070713_100000134
742 Ga0070713_100001365
743 Ga0070713_100002354
744 Ga0070713_100036781
745 Ga0070713_100041168
746 Ga0070713_100058279
747 Ga0070713_100065399
748 Ga0070713_100111355
749 Ga0070710_10035394
750 Ga0070711_100000814
751 Ga0070711_100001063
752 Ga0070711_100002531
753 Ga0070711_100084603
754 Ga0070705_100008919
755 Ga0070694_100004167
756 Ga0070694_100047874
757 Ga0070708_100000598
758 Ga0070708_100001014
759 Ga0070708_100004228
760 Ga0070708_100013577
761 Ga0070708_100015179
762 Ga0070708_100015797
763 Ga0070708_100030590
764 Ga0070708_100048646
765 Ga0070708_100074323
766 Ga0070708_100151173
767 Ga0070663_100003084
768 Ga0070663_100007437
769 Ga0070678_100006234
770 Ga0070662_100001005
771 Ga0070662_100007919
772 Ga0070681_10002963
773 Ga0070681_10005375
774 Ga0068867_100001846
775 Ga0068867_100028245
776 Ga0070685_10003176
777 Ga0070706_100000980
778 Ga0070706_100050660
779 Ga0070706_100059978
780 Ga0070707_100000915
781 Ga0070707_100009766
782 Ga0070707_100125811
783 Ga0070698_100000140
784 Ga0070698_100043123
785 Ga0070698_100047025
786 Ga0070699_100006667
787 Ga0070699_100006913
788 Ga0070699_100010792
789 Ga0070699_100029973
790 Ga0070699_100035282
791 Ga0070679_100003801
792 Ga0070679_100022913
793 Ga0070679_100069245
794 Ga0070684_100002526
795 Ga0070684_100004956
796 Ga0070684_100011109
797 Ga0070684_100033759
798 Ga0070684_100053708
799 Ga0070684_100101805
800 Ga0070697_100000015
801 Ga0070697_100000518
802 Ga0070697_100001215
803 Ga0070697_100008196
804 Ga0070697_100012341
805 Ga0070697_100051952
806 Ga0070697_100067374
807 Ga0068853_100000179
808 Ga0068853_100083325
809 Ga0068853_100100201
810 Ga0070672_100000810
811 Ga0070686_100003853
812 Ga0070695_100000210
813 Ga0070695_100004421
814 Ga0070695_100095390
815 Ga0070696_100002816
816 Ga0070696_100064741
817 Ga0070693_100000105
818 Ga0070693_100053715
819 Ga0070665_100010236
820 Ga0070704_100097476
821 Ga0068855_100001050
822 Ga0068855_100002077
823 Ga0068855_100002180
824 Ga0068855_100003268
825 Ga0068855_100007466
826 Ga0068855_100031181
827 Ga0068855_100049055
828 Ga0068855_100066847
829 Ga0068855_100080770
830 Ga0070664_100000457
831 Ga0070664_100010450
832 Ga0070664_100115180
833 Ga0068857_100002167
834 Ga0068857_100018225
835 Ga0068857_100112505
836 Ga0068854_100021010
837 Ga0068856_100000072
838 Ga0068856_100000346
839 Ga0068856_100003709
840 Ga0068856_100006056
841 Ga0068856_100007392
842 Ga0068856_100008986
843 Ga0068856_100009251
844 Ga0068856_100014582
845 Ga0068856_100034026
846 Ga0068856_100036579
847 Ga0068856_100038592
848 Ga0068856_100061482
849 Ga0068856_100075097
850 Ga0068856_100176545
851 Ga0070702_100000146
852 Ga0068852_100000009
853 Ga0068852_100000406
854 Ga0068852_100031868
855 Ga0068852_100052101
856 Ga0068852_100149109
857 Ga0068859_100006285
858 Ga0068859_100029749
859 Ga0068859_100109075
860 Ga0068864_100023233
861 Ga0068864_100033090
862 Ga0068864_100087397
863 Ga0068864_100094924
864 Ga0068864_100109283
865 Ga0068866_10001182
866 Ga0068861_100018868
867 Ga0068861_100057885
868 Ga0068851_10003049
869 Ga0068851_10007212
870 Ga0068870_10001323
871 Ga0068863_100010773
872 Ga0068863_100011177
873 Ga0068863_100012533
874 Ga0068863_100028831
875 Ga0068863_100030584
876 Ga0068863_100070880
877 Ga0068863_100167871
878 Ga0068858_100008509
879 Ga0068858_100011944
880 Ga0068858_100025578
881 Ga0068858_100036498
882 Ga0068858_100116252
883 Ga0068860_100005600
884 Ga0068860_100023618
885 Ga0068862_100003922
886 Ga0068862_100036976
887 Ga0070717_10001053
888 Ga0070717_10001280
889 Ga0070717_10001842
890 Ga0070717_10004636
891 Ga0070717_10006455
892 Ga0070717_10009698
893 Ga0070717_10013661
894 Ga0070717_10037695
895 Ga0070717_10083480
896 Ga0070717_10092915
897 Ga0070715_10001337
898 Ga0070715_10003622
899 Ga0070715_10007950
900 Ga0070716_100000114
901 Ga0070716_100002526
902 Ga0070716_100006521
903 Ga0070716_100006812
904 Ga0070712_100000100
905 Ga0070712_100000389
906 Ga0070712_100001533
907 Ga0070712_100001556
908 Ga0070712_100001951
909 Ga0070712_100056545
910 Ga0097621_100000117
911 Ga0097621_100000329
912 Ga0097621_100005597
913 Ga0097621_100005791
914 Ga0097621_100007474
915 Ga0097621_100014299
916 Ga0097621_100022905
917 Ga0097621_100025801
918 Ga0097621_100043365
919 Ga0097621_100085583
920 Ga0068871_100000971
921 Ga0068871_100014897
922 Ga0068871_100082202
923 Ga0068871_100096975
924 Ga0068871_100102961
925 Ga0075433_10000213
926 Ga0075433_10053871
927 Ga0075434_100000122
928 Ga0075434_100000564
929 Ga0075434_100001669
930 Ga0075434_100009940
931 Ga0075434_100015193
932 Ga0075434_100042690
933 Ga0068865_100002421
934 Ga0068865_100004633
935 Ga0068865_100005168
936 Ga0075436_100002250
937 Ga0075436_100014222
938 Ga0075436_100017147
939 Ga0075436_100050586
940 Ga0097620_100006285
941 Ga0097620_100029749
942 Ga0097620_100109078
943 Ga0075435_100000038
944 Ga0075435_100075816
945 Ga0075435_100081819
946 Ga0099794_10003075
947 Ga0099794_10007517
948 Ga0099794_10019157
949 Ga0099794_10023702
950 Ga0099795_10004867
951 Ga0105240_10000148
952 Ga0105240_10002085
953 Ga0105240_10003334
954 Ga0105240_10003778
955 Ga0105240_10016695
956 Ga0105240_10022638
957 Ga0105240_10039166
958 Ga0105240_10041000
959 Ga0105240_10062894
960 Ga0105240_10086421
961 Ga0105240_10137558
962 Ga0105240_10200390
963 Ga0105245_10002835
964 Ga0105245_10023408
965 Ga0105245_10034473
966 Ga0105245_10076732
967 Ga0105245_10157031
968 Ga0105247_10003343
969 Ga0114129_10094507
970 Ga0114129_10109743
971 Ga0105243_10056060
972 Ga0105241_10000034
973 Ga0105241_10000157
974 Ga0105241_10001200
975 Ga0105241_10007492
976 Ga0105241_10018950
977 Ga0105241_10028405
978 Ga0105242_10081172
979 Ga0105248_10000003
980 Ga0105248_10009349
981 Ga0105248_10010236
982 Ga0105248_10129135
983 Ga0105237_10001511
984 Ga0105237_10005226
985 Ga0105237_10010821
986 Ga0105237_10014822
987 Ga0105237_10081703
988 Ga0105237_10155290
989 Ga0105238_10000121
990 Ga0105238_10007714
991 Ga0105238_10007802
992 Ga0105238_10018538
993 Ga0105238_10048974
994 Ga0105238_10112641
995 Ga0105249_10026101
996 Ga0099796_10002143
997 Ga0105239_10002108
998 Ga0105239_10007899
999 Ga0105239_10013560
1000 Ga0105239_10032944
1001 Ga0105239_10034893
1002 Ga0105239_10206745
1003 Ga0105246_10007094
1004 Ga0105246_10041358
1005 Ga0157373_10001145
1006 Ga0157373_10011714
1007 Ga0157373_10039559
1008 Ga0157373_10107230
1009 Ga0157371_10006441
1010 Ga0157371_10031814
1011 Ga0157370_10000059
1012 Ga0157369_10000035
1013 Ga0157369_10000468
1014 Ga0157369_10000617
1015 Ga0157369_10001957
1016 Ga0157369_10007147
1017 Ga0157369_10007485
1018 Ga0157369_10007497
1019 Ga0157369_10007988
1020 Ga0157369_10018975
1021 Ga0157369_10019328
1022 Ga0157369_10028070
1023 Ga0157369_10056407
1024 Ga0157369_10075426
1025 Ga0157369_10100117
1026 Ga0157374_10000294
1027 Ga0157374_10003048
1028 Ga0157374_10003917
1029 Ga0157374_10009405
1030 Ga0157374_10015000
1031 Ga0157374_10075570
1032 Ga0157378_10000217
1033 Ga0157378_10000250
1034 Ga0157378_10002396
1035 Ga0157378_10004037
1036 Ga0157378_10028879
1037 Ga0157378_10031278
1038 Ga0157378_10040910
1039 Ga0157378_10053830
1040 Ga0157378_10069112
1041 Ga0163162_10005493
1042 Ga0163162_10021857
1043 Ga0157372_10000049
1044 Ga0157372_10000504
1045 Ga0157372_10000951
1046 Ga0157372_10001326
1047 Ga0157372_10001767
1048 Ga0157372_10002380
1049 Ga0157372_10005533
1050 Ga0157372_10026556
1051 Ga0157372_10034155
1052 Ga0157372_10085623
1053 Ga0157372_10131718
1054 Ga0157372_10143191
1055 Ga0157372_10249514
1056 Ga0157375_10015850
1057 Ga0157375_10022219
1058 Ga0157375_10117734
1059 Ga0157375_10135046
1060 Ga0163163_10012152
1061 Ga0163163_10016663
1062 Ga0182008_10004291
1063 Ga0157377_10006030
1064 Ga0157379_10011316
1065 Ga0157379_10021319
1066 Ga0157376_10000023
1067 Ga0157376_10000828
1068 Ga0157376_10007328
1069 Ga0157376_10019767
1070 Ga0157376_10051629
1071 Ga0157376_10057382
1072 Ga0157376_10063234
1073 Ga0163161_10014818
1074 Ga0207697_10015086
1075 Ga0207656_10017038
1076 Ga0207692_10005505
1077 Ga0207692_10031103
1078 Ga0207642_10023834
1079 Ga0207647_10016743
1080 Ga0207685_10001246
1081 Ga0207699_10000496
1082 Ga0207645_10000471
1083 Ga0207645_10003288
1084 Ga0207643_10000375
1085 Ga0207705_10044818
1086 Ga0207705_10057727
1087 Ga0207684_10001117
1088 Ga0207684_10007311
1089 Ga0207684_10007842
1090 Ga0207684_10110009
1091 Ga0207684_10145399
1092 Ga0207654_10000029
1093 Ga0207654_10000097
1094 Ga0207654_10013372
1095 Ga0207707_10003501
1096 Ga0207707_10038050
1097 Ga0207695_10000096
1098 Ga0207695_10000105
1099 Ga0207695_10000461
1100 Ga0207695_10006004
1101 Ga0207695_10015608
1102 Ga0207695_10023604
1103 Ga0207695_10035449
1104 Ga0207695_10043213
1105 Ga0207695_10069900
1106 Ga0207671_10000390
1107 Ga0207671_10001421
1108 Ga0207671_10010795
1109 Ga0207671_10061085
1110 Ga0207693_10000034
1111 Ga0207693_10000164
1112 Ga0207693_10000275
1113 Ga0207693_10003136
1114 Ga0207693_10011260
1115 Ga0207693_10023128
1116 Ga0207693_10042748
1117 Ga0207693_10047262
1118 Ga0207663_10025097
1119 Ga0207663_10075238
1120 Ga0207660_10018437
1121 Ga0207660_10030633
1122 Ga0207662_10002575
1123 Ga0207657_10000254
1124 Ga0207657_10002735
1125 Ga0207657_10005257
1126 Ga0207649_10000233
1127 Ga0207649_10016237
1128 Ga0207649_10018077
1129 Ga0207649_10028858
1130 Ga0207649_10051043
1131 Ga0207649_10052436
1132 Ga0207649_10096657
1133 Ga0207652_10006558
1134 Ga0207652_10021150
1135 Ga0207646_10000471
1136 Ga0207646_10010305
1137 Ga0207646_10032934
1138 Ga0207681_10053553
1139 Ga0207694_10000104
1140 Ga0207694_10005650
1141 Ga0207650_10000107
1142 Ga0207650_10008720
1143 Ga0207650_10030113
1144 Ga0207687_10004264
1145 Ga0207700_10000111
1146 Ga0207700_10032088
1147 Ga0207700_10098057
1148 Ga0207700_10138713
1149 Ga0207664_10025215
1150 Ga0207664_10035263
1151 Ga0207664_10148565
1152 Ga0207644_10004657
1153 Ga0207706_10000238
1154 Ga0207706_10003488
1155 Ga0207706_10005861
1156 Ga0207706_10033194
1157 Ga0207669_10039321
1158 Ga0207704_10006270
1159 Ga0207704_10014847
1160 Ga0207665_10000040
1161 Ga0207665_10003529
1162 Ga0207665_10006116
1163 Ga0207665_10009881
1164 Ga0207665_10011614
1165 Ga0207665_10011903
1166 Ga0207665_10011970
1167 Ga0207665_10019746
1168 Ga0207691_10000751
1169 Ga0207691_10081386
1170 Ga0207711_10000013
1171 Ga0207711_10000708
1172 Ga0207711_10072624
1173 Ga0207689_10000105
1174 Ga0207689_10000713
1175 Ga0207689_10003153
1176 Ga0207689_10024883
1177 Ga0207689_10047852
1178 Ga0207661_10000138
1179 Ga0207661_10014752
1180 Ga0207661_10023158
1181 Ga0207661_10049937
1182 Ga0207661_10149111
1183 Ga0207679_10000058
1184 Ga0207679_10016880
1185 Ga0207667_10001323
1186 Ga0207667_10004082
1187 Ga0207667_10005768
1188 Ga0207667_10005835
1189 Ga0207667_10028895
1190 Ga0207667_10031572
1191 Ga0207667_10038955
1192 Ga0207667_10050227
1193 Ga0207667_10089642
1194 Ga0207712_10006914
1195 Ga0207668_10003703
1196 Ga0207640_10013067
1197 Ga0207640_10031274
1198 Ga0207658_10034607
1199 Ga0207677_10001114
1200 Ga0207677_10003786
1201 Ga0207677_10004408
1202 Ga0207677_10018639
1203 Ga0207677_10025030
1204 Ga0207703_10002099
1205 Ga0207703_10002661
1206 Ga0207703_10042648
1207 Ga0207703_10097565
1208 Ga0207703_10129058
1209 Ga0207639_10000147
1210 Ga0207639_10042714
1211 Ga0207639_10056976
1212 Ga0207678_10000256
1213 Ga0207678_10001492
1214 Ga0207702_10000436
1215 Ga0207702_10000679
1216 Ga0207702_10000860
1217 Ga0207702_10012416
1218 Ga0207702_10017930
1219 Ga0207702_10020318
1220 Ga0207702_10025887
1221 Ga0207702_10037829
1222 Ga0207702_10128335
1223 Ga0207641_10000163
1224 Ga0207641_10003212
1225 Ga0207641_10013835
1226 Ga0207641_10060386
1227 Ga0207641_10066043
1228 Ga0207648_10000604
1229 Ga0207648_10006028
1230 Ga0207648_10017106
1231 Ga0207676_10000142
1232 Ga0207676_10001489
1233 Ga0207676_10027492
1234 Ga0207676_10091999
1235 Ga0207674_10000336
1236 Ga0207674_10006617
1237 Ga0207674_10013044
1238 Ga0207674_10028182
1239 Ga0207674_10074895
1240 Ga0207675_100033596
1241 Ga0207675_100082153
1242 Ga0207683_10000078
1243 Ga0207683_10001600
1244 Ga0207683_10006753
1245 Ga0207698_10000020
1246 Ga0207698_10000316
1247 Ga0207698_10010630
1248 Ga0207698_10093894
1249 Ga0209588_1003163
1250 Ga0209588_1008523
1251 Ga0265354_1000067
1252 Ga0265356_1000027
1253 Ga0268266_10000276
1254 Ga0268266_10022928
1255 Ga0268266_10049729
1256 Ga0268265_10018167
1257 Ga0268264_10003435
1258 Ga0268264_10005525
1259 Ga0268264_10028085
1260 Ga0265338_10000633
1261 Ga0265762_1000402
1262 Ga0265762_1000913
1263 Ga0265770_1001056
1264 Ga0265760_10009661
1265 Ga0265339_10004676
1266 Ga0265316_10026823
1267 Ga0265314_10039621
1268 Ga0373959_0000161
1269 Ga0373932_0004078
1270 Ga0373936_0020305
1271 Ga0373960_0009799
1272 Ga0373946_0000567
1273 Ga0373946_0021182
1274 Ga0373931_0032592
1275 Ga0373935_0001647
1276 Ga0373935_0064068
1277 Ga0373927_0000203
1278 Ga0373927_0020898
1279 Ga0373927_0075539
1280 Ga0373933_0058870
1281 Ga0373947_0005482
1282 Ga0373937_0094651
1283 Ga0373925_0000172
1284 Ga0373925_0009682
1285 Ga0373925_0012233
1286 Ga0373925_0061770
1287 Ga0373925_0063691
1288 Ga0436365_1656802
1289 Ga0466963_0005652
1290 Ga0466963_0082063
1291 Ga0466967_0018480
1292 Ga0495603_0022592
1293 Ga0495629_0045788
1294 Ga0495641_0028581
1295 Ga0495580_0003809
1296 Ga0495580_0004417
1297 Ga0495580_0013349
1298 Ga0495580_0021204
1299 Ga0495580_0023451
1300 Ga0495580_0043095
1301 Ga0495580_0047984
1302 Ga0495580_0083390
1303 Ga0495582_0000277
1304 Ga0495582_0002058
1305 Ga0495664_0107868
1306 Ga0495630_0005254
1307 Ga0495665_0004469
1308 Ga0495640_0040545
1309 Ga0495634_0079352
1310 Ga0495647_0002757
1311 Ga0495658_0005438
1312 Ga0495658_0021957
1313 Ga0495669_0008161
1314 Ga0495613_0010773
1315 Ga0495624_0063174
1316 Ga0495581_0022292
1317 Ga0495674_0165823
1318 Ga0495676_0018164
1319 Ga0495593_0010495
1320 Ga0495602_0042183
1321 Ga0495602_0104809
1322 Ga0496100_0000958
1323 Ga0496101_0019396
1324 Ga0496102_0001575
1325 Ga0496102_0242480
1326 Ga0496103_0013534
1327 Ga0496104_0028148
1328 Ga0496104_0139053
1329 Ga0496104_0147163
1330 Ga0496106_0031226
1331 Ga0496106_0045641
1332 Ga0496108_0000082
1333 Ga0496109_0000148
1334 Ga0496110_0002311
1335 Ga0496110_0029670
1336 Ga0496111_0010400
1337 Ga0496111_0040939
1338 Ga0496112_0000093
1339 Ga0496112_0015242
1340 Ga0496112_0052940
1341 Ga0496112_0103558
1342 Ga0496113_0003134
1343 Ga0496113_0016718
1344 Ga0496114_0013547
1345 Ga0496114_0015725
1346 Ga0496114_0036562
1347 Ga0496114_0165154
1348 Ga0496115_0003600
1349 Ga0496115_0006608
1350 Ga0496115_0007549
1351 Ga0496115_0085588
1352 Ga0496115_0164938
1353 Ga0496126_0001121
1354 nmdc:mga05p37_78294_c1
1355 nmdc:mga0n895_102_c1
1356 nmdc:mga0n895_11535_c1
1357 nmdc:mga0n895_30546_c1
1358 nmdc:mga0n895_325_c1
1359 nmdc:mga0n895_44202_c1
1360 nmdc:mga0n895_8777_c1
1361 nmdc:mga0rr50_109473_c1
1362 nmdc:mga0rr50_110_c1
1363 nmdc:mga0rr50_199197_c1
1364 nmdc:mga0rr50_87451_c1
1365 nmdc:mga08x19_1121_c1
1366 nmdc:mga08x19_23657_c1
1367 nmdc:mga08x19_27595_c1
1368 nmdc:mga08x19_29357_c1
1369 nmdc:mga08x19_3025_c1
1370 nmdc:mga08x19_90137_c1
1371 nmdc:mga08x19_9881_c1
1372 nmdc:mga0a205_131_c1
1373 nmdc:mga0a205_2453_c1
1374 Ga0495601_0034117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

15

52

0.95

PF00732

GMC_oxred_N

GMC oxidoreductase

200

326

0.91

PF05199

GMC_oxred_C

GMC oxidoreductase

426

552

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9885 31 63
6gnd-assembly1.cif.gz_G crystal structure of the complex of a ferredoxin-flavin thioredoxin reductase and a thioredoxin from clostridium acetobutylicum at 2.9 a resolution 0.9784 30 60
3f8d-assembly2.cif.gz_D structure of sulfolobus solfataricus thioredoxin reductase mutant c147a 0.9712 32 60
3f8r-assembly2.cif.gz_D crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9677 32 60
6gnd-assembly2.cif.gz_E-2 crystal structure of the complex of a ferredoxin-flavin thioredoxin reductase and a thioredoxin from clostridium acetobutylicum at 2.9 a resolution 0.9663 30 60
ID Description Score Start End Superfamily
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9872 34 63 3.50.50.60
2x3nA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9831 30 63 3.50.50.60
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9811 33 62 3.40.50.720
4zn0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9788 31 61 3.50.50.60
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9786 33 63 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3D6R3-F1-model_v4 GMC family oxidoreductase 0.9464 136 471 GO:0016614
GO:0050660
AF-A0A2V9XAK7-F1-model_v4 GMC family oxidoreductase 0.9438 208 363 GO:0016614
GO:0050660
AF-A0A2V7EGS5-F1-model_v4 GMC family oxidoreductase 0.939 148 302 GO:0016614
GO:0050660
AF-A0A2V9GLD4-F1-model_v4 Glucose-methanol-choline oxidoreductase N-terminal domain-containing protein 0.9383 30 352 GO:0016614
GO:0050660
AF-A0A1Q7ZHG1-F1-model_v4 GMC family oxidoreductase 0.9357 98 527 GO:0016614
GO:0050660

Map