F473762

General Info

Members Datasets Scaffolds Average Seq Length
666 268 1332 198

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100730486|Ga0068868_1007304861
Length 229
Sequence MACGYWLWVPRLARSDQPSAFSHQSSYPDMREAGIGRVLVASLHQGIADILPTRLAFYENWLNAEGLREGTIGLAPLYAVLSFLRQEGEAYTLITTRAGEYAAEWTVQSMTPVQRALIKAAPIWLRSRILLRLAQRLVHSSYRGSRAISRLSGGTARVDLRASVFCTVREKVPHPLCGFYAAAFTRLLALFDIGASTEVVACRGTGEATCVLNVSLTAAQPATPAAAAL

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
200 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.75
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 24.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100730486 3300005338 Unclassified 888
2 Ga0070658_10537115 3300005327 Bacteria 1011
3 Ga0070690_101016703 3300005330 Unclassified 654
4 Ga0070670_100187501 3300005331 Bacteria 1796
5 Ga0070670_101056565 3300005331 Bacteria 740
6 Ga0068869_100302951 3300005334 Bacteria 1291
7 Ga0070666_10008194 3300005335 Bacteria 6477
8 Ga0070666_10079410 3300005335 Bacteria 2241
9 Ga0070666_10203245 3300005335 Unclassified 1394
10 Ga0070666_10215638 3300005335 Bacteria 1353
11 Ga0070680_100013680 3300005336 Bacteria 6327
12 Ga0070680_100096736 3300005336 Bacteria 2448
13 Ga0070682_100553394 3300005337 Bacteria 901
14 Ga0068868_100061375 3300005338 Bacteria 2978
15 Ga0068868_100255417 3300005338 Bacteria 1476
16 Ga0068868_100558333 3300005338 Bacteria 1010
17 Ga0070660_100026226 3300005339 Bacteria 4337
18 Ga0070660_100086007 3300005339 Bacteria 2473
19 Ga0070660_100354712 3300005339 Bacteria 1208
20 Ga0070660_100923706 3300005339 Unclassified 736
21 Ga0070689_100105838 3300005340 Unclassified 2231
22 Ga0070689_100595287 3300005340 Unclassified 957
23 Ga0070691_10061582 3300005341 Unclassified 1805
24 Ga0070691_10325919 3300005341 Bacteria 846
25 Ga0070687_100099149 3300005343 Bacteria 1628
26 Ga0070687_100169623 3300005343 Bacteria 1298
27 Ga0070692_10134981 3300005345 Bacteria 1391
28 Ga0070668_100053122 3300005347 Bacteria 3125
29 Ga0070668_100244025 3300005347 Unclassified 1489
30 Ga0070668_100435563 3300005347 Unclassified 1124
31 Ga0070669_100009260 3300005353 Bacteria 7017
32 Ga0070669_100327502 3300005353 Bacteria 1238
33 Ga0070675_100002612 3300005354 Bacteria 13522
34 Ga0070675_100519150 3300005354 Unclassified 1075
35 Ga0070675_100676039 3300005354 Bacteria 939
36 Ga0070671_100013807 3300005355 Bacteria 6517
37 Ga0070671_100123896 3300005355 Bacteria 2176
38 Ga0070674_100000436 3300005356 Bacteria 21015
39 Ga0070674_100038556 3300005356 Bacteria 3221
40 Ga0070673_100020135 3300005364 Unclassified 4806
41 Ga0070673_100057227 3300005364 Unclassified 3080
42 Ga0070673_100223859 3300005364 Bacteria 1629
43 Ga0070688_100728491 3300005365 Bacteria 770
44 Ga0070659_100409936 3300005366 Bacteria 1145
45 Ga0070667_100029281 3300005367 Unclassified 4588
46 Ga0070667_100605392 3300005367 Bacteria 1010
47 Ga0070709_10010033 3300005434 Bacteria 5234
48 Ga0070709_10109267 3300005434 Unclassified 1856
49 Ga0070709_10136009 3300005434 Unclassified 1683
50 Ga0070714_100022100 3300005435 Bacteria 5212
51 Ga0070713_100014850 3300005436 Bacteria 5798
52 Ga0070710_10178654 3300005437 Unclassified 1327
53 Ga0070701_10047682 3300005438 Bacteria 2207
54 Ga0070711_100089828 3300005439 Unclassified 2211
55 Ga0070705_100030218 3300005440 Bacteria 2988
56 Ga0070705_100058830 3300005440 Bacteria 2273
57 Ga0070705_100116912 3300005440 Bacteria 1715
58 Ga0070705_100160843 3300005440 Unclassified 1501
59 Ga0070700_100011121 3300005441 Bacteria 4979
60 Ga0070700_100023553 3300005441 Bacteria 3602
61 Ga0070700_100124181 3300005441 Bacteria 1734
62 Ga0070694_100510891 3300005444 Bacteria 957
63 Ga0070694_100602750 3300005444 Bacteria 885
64 Ga0070708_100028202 3300005445 Bacteria 4829
65 Ga0070708_100077225 3300005445 Unclassified 3009
66 Ga0070708_100615159 3300005445 Bacteria 1024
67 Ga0070678_100052152 3300005456 Bacteria 2969
68 Ga0070678_100145186 3300005456 Bacteria 1904
69 Ga0070662_100120424 3300005457 Bacteria 2011
70 Ga0070662_100489104 3300005457 Unclassified 1025
71 Ga0070681_10127254 3300005458 Unclassified 2480
72 Ga0070681_10459039 3300005458 Bacteria 1186
73 Ga0068867_100034916 3300005459 Bacteria 3646
74 Ga0068867_100496399 3300005459 Bacteria 1048
75 Ga0068867_100766776 3300005459 Bacteria 857
76 Ga0070685_10228647 3300005466 Bacteria 1222
77 Ga0070706_100917297 3300005467 Bacteria 809
78 Ga0070706_101190927 3300005467 Bacteria 700
79 Ga0070707_100078350 3300005468 Bacteria 3188
80 Ga0070707_100123523 3300005468 Bacteria 2514
81 Ga0070707_100233090 3300005468 Unclassified 1792
82 Ga0070707_100572958 3300005468 Bacteria 1091
83 Ga0070698_100105741 3300005471 Bacteria 2784
84 Ga0070698_100240495 3300005471 Unclassified 1744
85 Ga0070699_100008257 3300005518 Bacteria 9031
86 Ga0070699_100210377 3300005518 Bacteria 1731
87 Ga0070699_100384869 3300005518 Unclassified 1267
88 Ga0070679_100246637 3300005530 Bacteria 1743
89 Ga0070679_100361560 3300005530 Bacteria 1399
90 Ga0070679_100539988 3300005530 Unclassified 1110
91 Ga0070684_100495081 3300005535 Bacteria 1132
92 Ga0070684_101034871 3300005535 Bacteria 771
93 Ga0070684_101497162 3300005535 Unclassified 636
94 Ga0070697_100019885 3300005536 Bacteria 5307
95 Ga0070697_100050935 3300005536 Bacteria 3363
96 Ga0070697_100160215 3300005536 Bacteria 1901
97 Ga0068853_100254641 3300005539 Unclassified 1612
98 Ga0068853_100804684 3300005539 Bacteria 900
99 Ga0070672_100054896 3300005543 Unclassified 3120
100 Ga0070672_100718051 3300005543 Bacteria 876
101 Ga0070686_100002768 3300005544 Bacteria 9659
102 Ga0070686_100106516 3300005544 Bacteria 1903
103 Ga0070686_100270044 3300005544 Unclassified 1250
104 Ga0070695_100001838 3300005545 Bacteria 11967
105 Ga0070695_100006527 3300005545 Bacteria 6894
106 Ga0070695_100113804 3300005545 Unclassified 1840
107 Ga0070695_100156249 3300005545 Bacteria 1596
108 Ga0070695_100567253 3300005545 Bacteria 887
109 Ga0070696_100025108 3300005546 Bacteria 4050
110 Ga0070696_100037619 3300005546 Bacteria 3339
111 Ga0070696_100200045 3300005546 Unclassified 1491
112 Ga0070696_100303623 3300005546 Unclassified 1223
113 Ga0070696_100558193 3300005546 Unclassified 918
114 Ga0070665_100003796 3300005548 Bacteria 15992
115 Ga0070665_100007748 3300005548 Bacteria 10901
116 Ga0070665_100049772 3300005548 Bacteria 4204
117 Ga0070665_101287962 3300005548 Bacteria 741
118 Ga0070704_100076003 3300005549 Bacteria 2455
119 Ga0070704_100690822 3300005549 Bacteria 904
120 Ga0068855_100108115 3300005563 Bacteria 3194
121 Ga0068855_100649508 3300005563 Bacteria 1133
122 Ga0068855_101457009 3300005563 Unclassified 704
123 Ga0070664_100029044 3300005564 Bacteria 4608
124 Ga0070664_100073151 3300005564 Bacteria 2940
125 Ga0070664_100379994 3300005564 Bacteria 1289
126 Ga0070664_100637440 3300005564 Unclassified 990
127 Ga0068857_100322061 3300005577 Bacteria 1428
128 Ga0068857_100465580 3300005577 Unclassified 1183
129 Ga0068854_100011475 3300005578 Bacteria 5771
130 Ga0068854_100024391 3300005578 Unclassified 4141
131 Ga0068854_100378170 3300005578 Bacteria 1166
132 Ga0068856_100048956 3300005614 Bacteria 4165
133 Ga0070702_100006595 3300005615 Bacteria 5506
134 Ga0070702_100157102 3300005615 Bacteria 1466
135 Ga0068859_100004898 3300005617 Bacteria 13639
136 Ga0068859_100055640 3300005617 Bacteria 3981
137 Ga0068859_100254902 3300005617 Bacteria 1845
138 Ga0068859_100327012 3300005617 Bacteria 1627
139 Ga0068859_100411452 3300005617 Bacteria 1448
140 Ga0068859_100522321 3300005617 Bacteria 1282
141 Ga0068859_100725470 3300005617 Unclassified 1084
142 Ga0068859_100861173 3300005617 Bacteria 992
143 Ga0068859_101005135 3300005617 Unclassified 916
144 Ga0068864_100029153 3300005618 Bacteria 4670
145 Ga0068864_100159919 3300005618 Bacteria 2047
146 Ga0068864_100182645 3300005618 Bacteria 1918
147 Ga0068864_100233011 3300005618 Bacteria 1704
148 Ga0068864_100265823 3300005618 Bacteria 1597
149 Ga0068861_100012374 3300005719 Bacteria 5950
150 Ga0068861_100062960 3300005719 Unclassified 2850
151 Ga0068861_100256996 3300005719 Bacteria 1493
152 Ga0068861_100531977 3300005719 Unclassified 1068
153 Ga0068870_10081152 3300005840 Unclassified 1793
154 Ga0068863_100015844 3300005841 Bacteria 7231
155 Ga0068863_100264895 3300005841 Unclassified 1662
156 Ga0068863_100630225 3300005841 Bacteria 1062
157 Ga0068858_100004715 3300005842 Bacteria 13353
158 Ga0068858_100090975 3300005842 Bacteria 2840
159 Ga0068858_100092605 3300005842 Unclassified 2813
160 Ga0068858_100297682 3300005842 Unclassified 1539
161 Ga0068858_100346438 3300005842 Bacteria 1423
162 Ga0068858_100612109 3300005842 Bacteria 1057
163 Ga0068860_100148741 3300005843 Bacteria 2254
164 Ga0068860_100900863 3300005843 Unclassified 900
165 Ga0068862_100022055 3300005844 Bacteria 5327
166 Ga0068862_100075128 3300005844 Bacteria 2922
167 Ga0068862_100538044 3300005844 Bacteria 1114
168 Ga0068862_100574073 3300005844 Unclassified 1079
169 Ga0068862_100708837 3300005844 Bacteria 975
170 Ga0068862_100745901 3300005844 Unclassified 952
171 Ga0081455_10084604 3300005937 Bacteria 2588
172 Ga0081455_10296327 3300005937 Unclassified 1162
173 Ga0081539_10010273 3300005985 Bacteria 7643
174 Ga0070717_10074849 3300006028 Bacteria 2831
175 Ga0070715_10177711 3300006163 Bacteria 1065
176 Ga0070716_100347917 3300006173 Bacteria 1048
177 Ga0070716_100732171 3300006173 Bacteria 759
178 Ga0097621_100000128 3300006237 Bacteria 44263
179 Ga0097621_100003783 3300006237 Bacteria 10482
180 Ga0097621_100117874 3300006237 Bacteria 2250
181 Ga0097621_100140274 3300006237 Bacteria 2065
182 Ga0097621_100144089 3300006237 Unclassified 2038
183 Ga0097621_100315353 3300006237 Bacteria 1384
184 Ga0068871_100002077 3300006358 Bacteria 13547
185 Ga0068871_100007193 3300006358 Bacteria 7940
186 Ga0068871_100105754 3300006358 Bacteria 2362
187 Ga0068871_100184627 3300006358 Unclassified 1794
188 Ga0068871_100196533 3300006358 Unclassified 1740
189 Ga0075428_100036277 3300006844 Bacteria 5431
190 Ga0075428_100555029 3300006844 Bacteria 1228
191 Ga0075428_100582311 3300006844 Bacteria 1196
192 Ga0075428_101197400 3300006844 Bacteria 801
193 Ga0075431_100068067 3300006847 Bacteria 3675
194 Ga0075431_100599815 3300006847 Bacteria 1085
195 Ga0075433_10032870 3300006852 Bacteria 4445
196 Ga0075433_10195871 3300006852 Bacteria 1797
197 Ga0075433_10278993 3300006852 Unclassified 1480
198 Ga0075433_10346887 3300006852 Unclassified 1312
199 Ga0075433_10748617 3300006852 Bacteria 855
200 Ga0075434_100001992 3300006871 Bacteria 17717
201 Ga0075434_100003625 3300006871 Bacteria 13785
202 Ga0075434_100023484 3300006871 Bacteria 6011
203 Ga0075434_100032332 3300006871 Bacteria 5160
204 Ga0075434_100056632 3300006871 Bacteria 3896
205 Ga0075434_100057865 3300006871 Bacteria 3852
206 Ga0075434_100137399 3300006871 Bacteria 2463
207 Ga0075434_100140781 3300006871 Bacteria 2432
208 Ga0075434_100157166 3300006871 Bacteria 2293
209 Ga0075434_100265915 3300006871 Bacteria 1734
210 Ga0075434_100548174 3300006871 Bacteria 1176
211 Ga0075429_100388385 3300006880 Bacteria 1222
212 Ga0075429_100399832 3300006880 Bacteria 1203
213 Ga0068865_100008189 3300006881 Bacteria 6453
214 Ga0068865_100114729 3300006881 Bacteria 1993
215 Ga0068865_100346291 3300006881 Unclassified 1202
216 Ga0068865_100350375 3300006881 Bacteria 1196
217 Ga0075436_100004609 3300006914 Bacteria 9447
218 Ga0075436_100005416 3300006914 Bacteria 8780
219 Ga0075436_100008159 3300006914 Bacteria 7169
220 Ga0075436_100021836 3300006914 Unclassified 4394
221 Ga0075436_100032286 3300006914 Bacteria 3608
222 Ga0097620_100004898 3300006931 Bacteria 13639
223 Ga0097620_100055640 3300006931 Bacteria 3981
224 Ga0097620_100254878 3300006931 Bacteria 1845
225 Ga0097620_100326984 3300006931 Bacteria 1627
226 Ga0097620_100411437 3300006931 Bacteria 1448
227 Ga0097620_100522281 3300006931 Bacteria 1282
228 Ga0097620_100725560 3300006931 Unclassified 1084
229 Ga0097620_100861086 3300006931 Bacteria 992
230 Ga0097620_101005001 3300006931 Unclassified 916
231 Ga0075435_100000084 3300007076 Bacteria 49470
232 Ga0075435_100002678 3300007076 Bacteria 11891
233 Ga0075435_100006862 3300007076 Bacteria 8081
234 Ga0075435_100009423 3300007076 Bacteria 7068
235 Ga0075435_100028111 3300007076 Bacteria 4408
236 Ga0075435_100046313 3300007076 Bacteria 3488
237 Ga0075435_100248135 3300007076 Unclassified 1515
238 Ga0075435_100692982 3300007076 Unclassified 885
239 Ga0105240_10096628 3300009093 Unclassified 3600
240 Ga0105240_10162987 3300009093 Bacteria 2647
241 Ga0105240_10228046 3300009093 Bacteria 2166
242 Ga0105240_10874606 3300009093 Unclassified 968
243 Ga0105240_11417588 3300009093 Unclassified 730
244 Ga0111539_10006401 3300009094 Bacteria 15188
245 Ga0111539_10096438 3300009094 Bacteria 3473
246 Ga0111539_10370338 3300009094 Bacteria 1667
247 Ga0111539_10593083 3300009094 Unclassified 1290
248 Ga0111539_11590723 3300009094 Unclassified 758
249 Ga0111539_11917455 3300009094 Unclassified 687
250 Ga0105245_10011018 3300009098 Bacteria 7869
251 Ga0105245_10086010 3300009098 Bacteria 2883
252 Ga0105245_10420838 3300009098 Unclassified 1339
253 Ga0105245_11370710 3300009098 Unclassified 757
254 Ga0105247_10006561 3300009101 Bacteria 7195
255 Ga0105247_10017391 3300009101 Bacteria 4317
256 Ga0114129_10000192 3300009147 Bacteria 68551
257 Ga0114129_10001078 3300009147 Bacteria 35880
258 Ga0114129_10003659 3300009147 Bacteria 21614
259 Ga0114129_10016512 3300009147 Bacteria 10513
260 Ga0114129_10017742 3300009147 Bacteria 10135
261 Ga0114129_10018372 3300009147 Bacteria 9960
262 Ga0114129_10026225 3300009147 Bacteria 8253
263 Ga0114129_10032428 3300009147 Bacteria 7384
264 Ga0114129_10057382 3300009147 Bacteria 5448
265 Ga0114129_10082500 3300009147 Bacteria 4467
266 Ga0114129_10332076 3300009147 Unclassified 2018
267 Ga0114129_10904631 3300009147 Unclassified 1118
268 Ga0114129_11183581 3300009147 Unclassified 953
269 Ga0105243_10019472 3300009148 Bacteria 5146
270 Ga0105243_10031220 3300009148 Bacteria 4106
271 Ga0105243_10752905 3300009148 Unclassified 955
272 Ga0105241_10192645 3300009174 Unclassified 1698
273 Ga0105242_10004280 3300009176 Bacteria 11124
274 Ga0105242_10019040 3300009176 Bacteria 5378
275 Ga0105242_10716613 3300009176 Bacteria 981
276 Ga0105248_10012848 3300009177 Bacteria 9237
277 Ga0105248_10021940 3300009177 Bacteria 7075
278 Ga0105248_10056077 3300009177 Unclassified 4420
279 Ga0105248_10101437 3300009177 Unclassified 3244
280 Ga0105248_10103135 3300009177 Bacteria 3215
281 Ga0105248_10139967 3300009177 Bacteria 2730
282 Ga0105248_10168496 3300009177 Unclassified 2469
283 Ga0105248_10231938 3300009177 Bacteria 2078
284 Ga0105248_10319893 3300009177 Bacteria 1748
285 Ga0105248_10636706 3300009177 Bacteria 1203
286 Ga0105248_10645580 3300009177 Unclassified 1194
287 Ga0105248_10920951 3300009177 Bacteria 987
288 Ga0105248_11257095 3300009177 Bacteria 837
289 Ga0105237_10211663 3300009545 Bacteria 1939
290 Ga0105238_10283394 3300009551 Bacteria 1638
291 Ga0105238_10519666 3300009551 Bacteria 1193
292 Ga0105249_10140522 3300009553 Bacteria 2315
293 Ga0105249_10169052 3300009553 Bacteria 2119
294 Ga0105249_10238653 3300009553 Bacteria 1796
295 Ga0105249_10259705 3300009553 Bacteria 1725
296 Ga0105246_10153162 3300011119 Bacteria 1747
297 Ga0157370_10558300 3300013104 Unclassified 1049
298 Ga0157374_10003571 3300013296 Bacteria 13092
299 Ga0157378_10041116 3300013297 Bacteria 4100
300 Ga0157378_10287020 3300013297 Bacteria 1588
301 Ga0157378_10397509 3300013297 Bacteria 1357
302 Ga0163162_10105810 3300013306 Bacteria 2908
303 Ga0163162_10711036 3300013306 Bacteria 1126
304 Ga0157375_11595159 3300013308 Bacteria 771
305 Ga0163163_10010023 3300014325 Bacteria 8498
306 Ga0163163_10038409 3300014325 Bacteria 4666
307 Ga0163163_10431142 3300014325 Bacteria 1377
308 Ga0157380_10099339 3300014326 Bacteria 2420
309 Ga0157380_10143258 3300014326 Bacteria 2056
310 Ga0157380_10168021 3300014326 Bacteria 1913
311 Ga0157380_10318310 3300014326 Unclassified 1441
312 Ga0157380_11418716 3300014326 Bacteria 745
313 Ga0157377_10034325 3300014745 Unclassified 2775
314 Ga0157377_10174096 3300014745 Bacteria 1348
315 Ga0157379_10024001 3300014968 Bacteria 5412
316 Ga0157379_10065761 3300014968 Bacteria 3241
317 Ga0157379_10110330 3300014968 Bacteria 2471
318 Ga0157379_10115331 3300014968 Bacteria 2415
319 Ga0157376_10006642 3300014969 Bacteria 8189
320 Ga0157376_10101571 3300014969 Unclassified 2514
321 Ga0157376_10382023 3300014969 Bacteria 1357
322 Ga0157376_11352538 3300014969 Bacteria 743
323 Ga0163161_10200198 3300017792 Bacteria 1539
324 Ga0207692_10121925 3300025898 Unclassified 1461
325 Ga0207710_10021753 3300025900 Bacteria 2751
326 Ga0207688_10080760 3300025901 Bacteria 1856
327 Ga0207680_10041676 3300025903 Bacteria 2681
328 Ga0207680_10136821 3300025903 Bacteria 1620
329 Ga0207680_10208230 3300025903 Bacteria 1336
330 Ga0207685_10115030 3300025905 Bacteria 1172
331 Ga0207699_10062855 3300025906 Unclassified 2240
332 Ga0207645_10101649 3300025907 Bacteria 1855
333 Ga0207645_10160529 3300025907 Bacteria 1470
334 Ga0207705_10051174 3300025909 Bacteria 2973
335 Ga0207684_10208463 3300025910 Bacteria 1686
336 Ga0207684_10311291 3300025910 Unclassified 1357
337 Ga0207684_10820007 3300025910 Bacteria 786
338 Ga0207654_10093838 3300025911 Unclassified 1835
339 Ga0207707_10416350 3300025912 Unclassified 1153
340 Ga0207707_10494944 3300025912 Bacteria 1043
341 Ga0207707_10524755 3300025912 Bacteria 1008
342 Ga0207695_10044293 3300025913 Bacteria 4734
343 Ga0207671_10180776 3300025914 Bacteria 1641
344 Ga0207693_10500152 3300025915 Unclassified 949
345 Ga0207663_10043643 3300025916 Unclassified 2747
346 Ga0207663_11096300 3300025916 Bacteria 640
347 Ga0207660_10075966 3300025917 Bacteria 2456
348 Ga0207660_10137955 3300025917 Unclassified 1862
349 Ga0207660_10221011 3300025917 Bacteria 1487
350 Ga0207662_10046601 3300025918 Bacteria 2564
351 Ga0207662_10415727 3300025918 Bacteria 914
352 Ga0207657_10008780 3300025919 Bacteria 10228
353 Ga0207657_10043966 3300025919 Unclassified 3931
354 Ga0207657_10497756 3300025919 Bacteria 955
355 Ga0207649_10243105 3300025920 Bacteria 1293
356 Ga0207652_10118162 3300025921 Unclassified 2356
357 Ga0207646_10036388 3300025922 Bacteria 4444
358 Ga0207646_10161842 3300025922 Unclassified 2020
359 Ga0207681_10005228 3300025923 Bacteria 7972
360 Ga0207681_10025352 3300025923 Bacteria 3813
361 Ga0207681_10027825 3300025923 Bacteria 3659
362 Ga0207681_10115835 3300025923 Bacteria 1957
363 Ga0207681_10471291 3300025923 Bacteria 1024
364 Ga0207650_10022084 3300025925 Unclassified 4504
365 Ga0207650_10831337 3300025925 Bacteria 783
366 Ga0207659_10000250 3300025926 Bacteria 32723
367 Ga0207659_10016742 3300025926 Bacteria 4777
368 Ga0207659_10239152 3300025926 Bacteria 1468
369 Ga0207659_10603767 3300025926 Unclassified 936
370 Ga0207687_10114886 3300025927 Bacteria 2004
371 Ga0207700_10016804 3300025928 Unclassified 4872
372 Ga0207700_10557704 3300025928 Bacteria 1017
373 Ga0207644_10006107 3300025931 Bacteria 7854
374 Ga0207690_10427348 3300025932 Bacteria 1061
375 Ga0207706_10045500 3300025933 Bacteria 3888
376 Ga0207706_10068849 3300025933 Bacteria 3113
377 Ga0207706_10658452 3300025933 Unclassified 896
378 Ga0207686_10005023 3300025934 Bacteria 7123
379 Ga0207686_10032164 3300025934 Unclassified 3120
380 Ga0207686_10717925 3300025934 Unclassified 796
381 Ga0207709_10035333 3300025935 Bacteria 2954
382 Ga0207709_10062798 3300025935 Bacteria 2326
383 Ga0207670_10074707 3300025936 Bacteria 2354
384 Ga0207670_10805131 3300025936 Unclassified 783
385 Ga0207669_10005444 3300025937 Bacteria 5711
386 Ga0207669_10007443 3300025937 Bacteria 5063
387 Ga0207669_10104394 3300025937 Bacteria 1882
388 Ga0207704_10004753 3300025938 Bacteria 6232
389 Ga0207704_10061352 3300025938 Bacteria 2332
390 Ga0207704_10107958 3300025938 Bacteria 1874
391 Ga0207665_10018044 3300025939 Bacteria 4637
392 Ga0207665_10353811 3300025939 Bacteria 1109
393 Ga0207691_10053609 3300025940 Unclassified 3682
394 Ga0207691_10132015 3300025940 Bacteria 2205
395 Ga0207711_10026109 3300025941 Bacteria 4899
396 Ga0207711_10030615 3300025941 Bacteria 4540
397 Ga0207711_10035782 3300025941 Bacteria 4211
398 Ga0207711_10166557 3300025941 Bacteria 1998
399 Ga0207711_10683702 3300025941 Bacteria 957
400 Ga0207711_10712927 3300025941 Bacteria 936
401 Ga0207689_10114827 3300025942 Bacteria 2213
402 Ga0207689_10457889 3300025942 Bacteria 1066
403 Ga0207689_10517333 3300025942 Bacteria 1001
404 Ga0207679_10494293 3300025945 Unclassified 1091
405 Ga0207679_10604911 3300025945 Unclassified 988
406 Ga0207667_10024831 3300025949 Bacteria 6571
407 Ga0207667_11297184 3300025949 Unclassified 705
408 Ga0207651_10017510 3300025960 Unclassified 4236
409 Ga0207651_10044363 3300025960 Bacteria 2975
410 Ga0207651_10051926 3300025960 Bacteria 2793
411 Ga0207651_10394887 3300025960 Bacteria 1175
412 Ga0207712_10122170 3300025961 Bacteria 1972
413 Ga0207712_10342657 3300025961 Bacteria 1240
414 Ga0207668_10062189 3300025972 Bacteria 2628
415 Ga0207668_10317256 3300025972 Unclassified 1292
416 Ga0207640_10098253 3300025981 Unclassified 2046
417 Ga0207658_10809142 3300025986 Bacteria 851
418 Ga0207677_10032388 3300026023 Bacteria 3360
419 Ga0207677_10066274 3300026023 Bacteria 2524
420 Ga0207677_10351069 3300026023 Bacteria 1236
421 Ga0207677_10624490 3300026023 Bacteria 948
422 Ga0207703_10016554 3300026035 Bacteria 5749
423 Ga0207703_10017649 3300026035 Bacteria 5570
424 Ga0207703_10137919 3300026035 Unclassified 2114
425 Ga0207703_10230247 3300026035 Bacteria 1661
426 Ga0207703_10469845 3300026035 Bacteria 1177
427 Ga0207703_10655497 3300026035 Bacteria 996
428 Ga0207703_10678805 3300026035 Bacteria 979
429 Ga0207703_10792336 3300026035 Bacteria 904
430 Ga0207639_10308119 3300026041 Unclassified 1402
431 Ga0207639_11195435 3300026041 Unclassified 714
432 Ga0207678_10655192 3300026067 Unclassified 923
433 Ga0207708_10000748 3300026075 Bacteria 24397
434 Ga0207708_10086998 3300026075 Bacteria 2405
435 Ga0207708_10258921 3300026075 Bacteria 1404
436 Ga0207708_10325894 3300026075 Bacteria 1254
437 Ga0207702_10034829 3300026078 Bacteria 4212
438 Ga0207641_10004149 3300026088 Bacteria 12628
439 Ga0207641_10546437 3300026088 Unclassified 1129
440 Ga0207641_10796233 3300026088 Bacteria 935
441 Ga0207641_11026165 3300026088 Bacteria 822
442 Ga0207648_10026080 3300026089 Bacteria 5196
443 Ga0207648_10103074 3300026089 Unclassified 2502
444 Ga0207648_10368109 3300026089 Archaea 1298
445 Ga0207648_10912750 3300026089 Bacteria 821
446 Ga0207676_10022293 3300026095 Bacteria 4657
447 Ga0207676_10188475 3300026095 Bacteria 1813
448 Ga0207676_10216596 3300026095 Bacteria 1702
449 Ga0207675_100006273 3300026118 Bacteria 11284
450 Ga0207675_100028572 3300026118 Bacteria 5193
451 Ga0207675_100099676 3300026118 Bacteria 2736
452 Ga0207675_100119143 3300026118 Bacteria 2497
453 Ga0207683_10033222 3300026121 Bacteria 4481
454 Ga0207683_10143348 3300026121 Bacteria 2153
455 Ga0207698_10743775 3300026142 Bacteria 979
456 Ga0207428_10034708 3300027907 Bacteria 4129
457 Ga0207428_10198828 3300027907 Bacteria 1509
458 Ga0268266_10006779 3300028379 Bacteria 10440
459 Ga0268266_10015100 3300028379 Bacteria 6632
460 Ga0268265_10006942 3300028380 Bacteria 7660
461 Ga0268265_10063585 3300028380 Bacteria 2839
462 Ga0268265_10540921 3300028380 Unclassified 1104
463 Ga0268264_10212065 3300028381 Bacteria 1778
464 Ga0268264_10450929 3300028381 Bacteria 1246
465 Ga0268264_11140238 3300028381 Unclassified 789
466 Ga0373948_0002047 3300034817 Unclassified 2918
467 Ga0373950_0029654 3300034818 Unclassified 1007
468 Ga0373958_0003999 3300034819 Unclassified 2159
469 Ga0373959_0002342 3300034820 Bacteria 3015
470 Ga0373938_0088678 3300034957 Unclassified 762
471 Ga0373928_0001235 3300035084 Bacteria 5020
472 Ga0373929_0000161 3300035085 Bacteria 11652
473 Ga0373940_0000138 3300035088 Bacteria 9328
474 Ga0373940_0129657 3300035088 Bacteria 789
475 Ga0373944_0022103 3300035089 Bacteria 1847
476 Ga0373949_0005450 3300035090 Unclassified 2836
477 Ga0373951_0003174 3300035091 Bacteria 4034
478 Ga0373952_0022264 3300035092 Unclassified 1344
479 Ga0373932_0008617 3300035112 Unclassified 2438
480 Ga0373936_0359714 3300035113 Unclassified 664
481 Ga0373939_0001319 3300035114 Bacteria 6027
482 Ga0373941_0001837 3300035115 Bacteria 4575
483 Ga0373941_0055311 3300035115 Bacteria 1275
484 Ga0373945_0026208 3300035116 Bacteria 2030
485 Ga0373954_0061210 3300035118 Unclassified 1777
486 Ga0373954_0209051 3300035118 Unclassified 959
487 Ga0373954_0298648 3300035118 Bacteria 794
488 Ga0373956_0401498 3300035119 Bacteria 654
489 Ga0373960_0000993 3300035121 Bacteria 6102
490 Ga0373946_0009789 3300035171 Bacteria 3538
491 Ga0373955_0011147 3300035172 Bacteria 4272
492 Ga0373955_0161398 3300035172 Bacteria 1323
493 Ga0373955_0378090 3300035172 Bacteria 859
494 Ga0373942_0000021 3300035207 Bacteria 30804
495 Ga0373962_0011409 3300035242 Unclassified 2228
496 Ga0373924_0002603 3300035410 Bacteria 6086
497 Ga0373931_0324117 3300035691 Unclassified 958
498 Ga0373931_0736098 3300035691 Unclassified 654
499 Ga0373931_0741840 3300035691 Unclassified 651
500 Ga0373935_0012997 3300035692 Bacteria 5018
501 Ga0373927_0363757 3300035695 Unclassified 954
502 Ga0373927_0403542 3300035695 Bacteria 902
503 Ga0373947_0015985 3300035725 Bacteria 4312
504 Ga0373937_0010946 3300036401 Bacteria 7945
505 Ga0373937_0057178 3300036401 Bacteria 3583
506 Ga0373937_0178848 3300036401 Unclassified 1992
507 Ga0373925_0149020 3300037068 Bacteria 1836
508 Ga0373925_0455109 3300037068 Bacteria 1048
509 Ga0373925_0783984 3300037068 Bacteria 786
510 Ga0436363_0281947 3300039450 Unclassified 737
511 Ga0439435_0040319 3300042436 Bacteria 1304
512 Ga0450916_001660 3300042530 Unclassified 2249
513 Ga0450916_036896 3300042530 Bacteria 731
514 Ga0451576_0006662 3300045051 Bacteria 14096
515 Ga0451576_0580578 3300045051 Bacteria 1178
516 Ga0451576_0588415 3300045051 Bacteria 1169
517 Ga0451576_0999079 3300045051 Bacteria 877
518 Ga0495592_0012087 3300046454 Bacteria 6547
519 Ga0495592_0082761 3300046454 Bacteria 2319
520 Ga0495603_0069595 3300046455 Unclassified 2070
521 Ga0495629_0177877 3300046459 Bacteria 1475
522 Ga0495651_0116553 3300046462 Bacteria 1968
523 Ga0495653_0533573 3300046463 Bacteria 728
524 Ga0495580_0184280 3300046472 Bacteria 1441
525 Ga0495580_0215591 3300046472 Bacteria 1320
526 Ga0495662_0172216 3300046476 Bacteria 1067
527 Ga0495664_0192874 3300046477 Bacteria 1235
528 Ga0495608_0014437 3300046511 Bacteria 5479
529 Ga0495618_0069859 3300046514 Bacteria 2233
530 Ga0495618_0483855 3300046514 Bacteria 748
531 Ga0495628_0287041 3300046516 Bacteria 1221
532 Ga0495630_0002043 3300046517 Bacteria 14037
533 Ga0495630_0511604 3300046517 Bacteria 921
534 Ga0495644_0190321 3300046523 Unclassified 790
535 Ga0495652_0219800 3300046529 Bacteria 1428
536 Ga0495640_0059156 3300046533 Bacteria 2611
537 Ga0495586_0369967 3300046535 Unclassified 824
538 Ga0495645_0006134 3300046543 Bacteria 8318
539 Ga0495645_0078688 3300046543 Bacteria 2369
540 Ga0495667_0088371 3300046559 Bacteria 2009
541 Ga0495656_0141916 3300046615 Bacteria 1153
542 Ga0495656_0327111 3300046615 Bacteria 791
543 Ga0495634_0071222 3300046642 Bacteria 2289
544 Ga0495634_0132895 3300046642 Bacteria 1585
545 Ga0495635_0084620 3300046663 Bacteria 2170
546 Ga0495635_0376487 3300046663 Bacteria 945
547 Ga0495657_0446773 3300046675 Bacteria 757
548 Ga0495657_0564979 3300046675 Bacteria 660
549 Ga0495599_0466485 3300046678 Bacteria 746
550 Ga0495647_0051429 3300046681 Bacteria 1601
551 Ga0495658_0008932 3300046683 Bacteria 4984
552 Ga0495658_0090069 3300046683 Bacteria 1815
553 Ga0495669_0048474 3300046684 Bacteria 1900
554 Ga0495613_0001062 3300046689 Bacteria 20990
555 Ga0495613_0207794 3300046689 Unclassified 1378
556 Ga0495670_0219933 3300046691 Bacteria 1009
557 Ga0495600_0087638 3300046809 Bacteria 2031
558 Ga0495604_0008404 3300047317 Bacteria 8159
559 Ga0495674_0053011 3300047319 Bacteria 3568
560 Ga0495674_0095551 3300047319 Bacteria 2534
561 Ga0495675_0115873 3300047444 Unclassified 1671
562 Ga0495684_0000515 3300047471 Bacteria 31395
563 Ga0495684_0051602 3300047471 Bacteria 3139
564 Ga0495593_0150831 3300047673 Unclassified 1176
565 Ga0495602_0183554 3300048088 Unclassified 1611
566 Ga0496102_0035106 3300048905 Unclassified 4513
567 Ga0496104_0076819 3300048907 Bacteria 3181
568 Ga0496104_0433782 3300048907 Bacteria 1226
569 Ga0496106_0099374 3300048909 Bacteria 2256
570 Ga0496106_0130195 3300048909 Bacteria 1973
571 Ga0496106_0402109 3300048909 Bacteria 1101
572 Ga0496107_0176146 3300048910 Bacteria 1588
573 Ga0496107_0177673 3300048910 Bacteria 1581
574 Ga0496108_0164113 3300048911 Bacteria 1921
575 Ga0496108_0297517 3300048911 Bacteria 1406
576 Ga0496109_0175359 3300048912 Bacteria 2012
577 Ga0496109_0468563 3300048912 Unclassified 1190
578 Ga0496109_1110442 3300048912 Unclassified 728
579 Ga0496110_0167953 3300048913 Bacteria 1990
580 Ga0496110_0251912 3300048913 Bacteria 1607
581 Ga0496111_0208060 3300048914 Bacteria 1454
582 Ga0496112_0010798 3300048915 Bacteria 8306
583 Ga0496112_0024060 3300048915 Bacteria 5829
584 Ga0496112_0151290 3300048915 Bacteria 2288
585 Ga0496112_0239400 3300048915 Bacteria 1768
586 Ga0496112_0291007 3300048915 Unclassified 1579
587 Ga0496113_0235680 3300048916 Bacteria 1460
588 Ga0496114_0023510 3300048917 Bacteria 5030
589 Ga0496114_0124171 3300048917 Bacteria 2223
590 Ga0496114_0883701 3300048917 Unclassified 774
591 Ga0501039_0257514 3300049575 Bacteria 1372
592 Ga0501042_0684431 3300049578 Bacteria 746
593 Ga0501043_0119190 3300049579 Bacteria 2070
594 Ga0501047_0003505 3300049581 Bacteria 14821
595 Ga0501068_0119434 3300049584 Unclassified 1643
596 Ga0501070_0213353 3300049586 Bacteria 1584
597 Ga0501071_0442147 3300049587 Bacteria 995
598 Ga0501071_0560364 3300049587 Unclassified 878
599 Ga0501075_0142192 3300049591 Bacteria 1829
600 Ga0501044_0002518 3300049823 Bacteria 20880
601 nmdc:mga05p37_14261_c1 3300050507 Bacteria 9543
602 nmdc:mga05p37_18959_c1 3300050507 Bacteria 8320
603 nmdc:mga05p37_32176_c1 3300050507 Bacteria 6413
604 nmdc:mga05p37_335976_c1 3300050507 Bacteria 1783
605 nmdc:mga05p37_35431_c1 3300050507 Bacteria 6119
606 nmdc:mga05p37_464076_c1 3300050507 Bacteria 1462
607 nmdc:mga05p37_68567_c1 3300050507 Bacteria 4362
608 nmdc:mga05p37_78658_c1 3300050507 Bacteria 4061
609 nmdc:mga09592_142220_c1 3300050508 Bacteria 2068
610 nmdc:mga09592_761747_c1 3300050508 Bacteria 821
611 nmdc:mga0qj67_651646_c1 3300050509 Unclassified 840
612 nmdc:mga06r32_207163_c1 3300050510 Bacteria 1949
613 nmdc:mga06r32_22036_c1 3300050510 Bacteria 5884
614 nmdc:mga08y16_1130650_c1 3300050511 Bacteria 757
615 nmdc:mga08y16_11800_c1 3300050511 Bacteria 9179
616 nmdc:mga08y16_125979_c1 3300050511 Unclassified 2131
617 nmdc:mga08y16_188218_c1 3300050511 Bacteria 2142
618 nmdc:mga08y16_408382_c1 3300050511 Bacteria 1389
619 nmdc:mga08y16_536205_c1 3300050511 Unclassified 1186
620 nmdc:mga08y16_5939_c1 3300050511 Bacteria 12799
621 nmdc:mga0n895_1167736_c1 3300050512 Unclassified 745
622 nmdc:mga0n895_145757_c1 3300050512 Bacteria 2397
623 nmdc:mga0n895_145844_c1 3300050512 Bacteria 2397
624 nmdc:mga0n895_233985_c1 3300050512 Unclassified 1865
625 nmdc:mga0n895_399_c1 3300050512 Bacteria 29189
626 nmdc:mga0n895_509831_c1 3300050512 Unclassified 1211
627 nmdc:mga0n895_529053_c1 3300050512 Bacteria 1186
628 nmdc:mga0n895_5669_c1 3300050512 Bacteria 10464
629 nmdc:mga0n895_657045_c1 3300050512 Unclassified 1047
630 nmdc:mga0n895_777562_c1 3300050512 Unclassified 949
631 nmdc:mga0n895_80730_c1 3300050512 Bacteria 3241
632 nmdc:mga0n895_86139_c1 3300050512 Bacteria 3138
633 nmdc:mga0rr50_1083642_c1 3300050513 Unclassified 682
634 nmdc:mga0rr50_17399_c1 3300050513 Bacteria 4799
635 nmdc:mga0rr50_1949_c1 3300050513 Bacteria 11453
636 nmdc:mga0rr50_26864_c1 3300050513 Bacteria 4024
637 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
638 nmdc:mga0rr50_42308_c1 3300050513 Bacteria 3326
639 nmdc:mga0rr50_48146_c1 3300050513 Bacteria 3150
640 nmdc:mga0rr50_6226_c1 3300050513 Bacteria 7234
641 nmdc:mga0rr50_81109_c1 3300050513 Bacteria 2503
642 nmdc:mga0rr50_86108_c1 3300050513 Unclassified 2436
643 nmdc:mga08x19_230_c1 3300050514 Bacteria 42633
644 nmdc:mga08x19_246452_c1 3300050514 Unclassified 1233
645 nmdc:mga08x19_276202_c1 3300050514 Bacteria 1164
646 nmdc:mga08x19_333201_c1 3300050514 Bacteria 1058
647 nmdc:mga08x19_343321_c1 3300050514 Unclassified 1042
648 nmdc:mga08x19_97136_c1 3300050514 Bacteria 1950
649 nmdc:mga0a205_27996_c1 3300050515 Bacteria 5384
650 nmdc:mga0a205_341689_c1 3300050515 Unclassified 1365
651 nmdc:mga0a205_371177_c1 3300050515 Bacteria 1297
652 nmdc:mga0a205_519876_c1 3300050515 Unclassified 1047
653 nmdc:mga0a205_738065_c1 3300050515 Unclassified 834
654 nmdc:mga0a205_940416_c1 3300050515 Unclassified 711
655 Ga0495601_0027353 3300053077 Bacteria 3526
656 Ga0495601_0035415 3300053077 Bacteria 3116
657 Ga0495601_0079250 3300053077 Bacteria 2106
658 Ga0495601_0160886 3300053077 Bacteria 1467
659 Ga0495601_0269881 3300053077 Bacteria 1110
660 Ga0495595_0034172 3300053084 Bacteria 2299
661 Ga0495595_0037265 3300053084 Bacteria 2210
662 Ga0495595_0108204 3300053084 Bacteria 1346
663 Ga0495619_0000690 3300053085 Bacteria 22103
664 Ga0495619_0014491 3300053085 Bacteria 4980
665 Ga0495619_0284709 3300053085 Bacteria 1145
666 Ga0495619_0378350 3300053085 Unclassified 978
667 Ga0068868_100730486
668 Ga0070658_10537115
669 Ga0070690_101016703
670 Ga0070670_100187501
671 Ga0070670_101056565
672 Ga0068869_100302951
673 Ga0070666_10008194
674 Ga0070666_10079410
675 Ga0070666_10203245
676 Ga0070666_10215638
677 Ga0070680_100013680
678 Ga0070680_100096736
679 Ga0070682_100553394
680 Ga0068868_100061375
681 Ga0068868_100255417
682 Ga0068868_100558333
683 Ga0070660_100026226
684 Ga0070660_100086007
685 Ga0070660_100354712
686 Ga0070660_100923706
687 Ga0070689_100105838
688 Ga0070689_100595287
689 Ga0070691_10061582
690 Ga0070691_10325919
691 Ga0070687_100099149
692 Ga0070687_100169623
693 Ga0070692_10134981
694 Ga0070668_100053122
695 Ga0070668_100244025
696 Ga0070668_100435563
697 Ga0070669_100009260
698 Ga0070669_100327502
699 Ga0070675_100002612
700 Ga0070675_100519150
701 Ga0070675_100676039
702 Ga0070671_100013807
703 Ga0070671_100123896
704 Ga0070674_100000436
705 Ga0070674_100038556
706 Ga0070673_100020135
707 Ga0070673_100057227
708 Ga0070673_100223859
709 Ga0070688_100728491
710 Ga0070659_100409936
711 Ga0070667_100029281
712 Ga0070667_100605392
713 Ga0070709_10010033
714 Ga0070709_10109267
715 Ga0070709_10136009
716 Ga0070714_100022100
717 Ga0070713_100014850
718 Ga0070710_10178654
719 Ga0070701_10047682
720 Ga0070711_100089828
721 Ga0070705_100030218
722 Ga0070705_100058830
723 Ga0070705_100116912
724 Ga0070705_100160843
725 Ga0070700_100011121
726 Ga0070700_100023553
727 Ga0070700_100124181
728 Ga0070694_100510891
729 Ga0070694_100602750
730 Ga0070708_100028202
731 Ga0070708_100077225
732 Ga0070708_100615159
733 Ga0070678_100052152
734 Ga0070678_100145186
735 Ga0070662_100120424
736 Ga0070662_100489104
737 Ga0070681_10127254
738 Ga0070681_10459039
739 Ga0068867_100034916
740 Ga0068867_100496399
741 Ga0068867_100766776
742 Ga0070685_10228647
743 Ga0070706_100917297
744 Ga0070706_101190927
745 Ga0070707_100078350
746 Ga0070707_100123523
747 Ga0070707_100233090
748 Ga0070707_100572958
749 Ga0070698_100105741
750 Ga0070698_100240495
751 Ga0070699_100008257
752 Ga0070699_100210377
753 Ga0070699_100384869
754 Ga0070679_100246637
755 Ga0070679_100361560
756 Ga0070679_100539988
757 Ga0070684_100495081
758 Ga0070684_101034871
759 Ga0070684_101497162
760 Ga0070697_100019885
761 Ga0070697_100050935
762 Ga0070697_100160215
763 Ga0068853_100254641
764 Ga0068853_100804684
765 Ga0070672_100054896
766 Ga0070672_100718051
767 Ga0070686_100002768
768 Ga0070686_100106516
769 Ga0070686_100270044
770 Ga0070695_100001838
771 Ga0070695_100006527
772 Ga0070695_100113804
773 Ga0070695_100156249
774 Ga0070695_100567253
775 Ga0070696_100025108
776 Ga0070696_100037619
777 Ga0070696_100200045
778 Ga0070696_100303623
779 Ga0070696_100558193
780 Ga0070665_100003796
781 Ga0070665_100007748
782 Ga0070665_100049772
783 Ga0070665_101287962
784 Ga0070704_100076003
785 Ga0070704_100690822
786 Ga0068855_100108115
787 Ga0068855_100649508
788 Ga0068855_101457009
789 Ga0070664_100029044
790 Ga0070664_100073151
791 Ga0070664_100379994
792 Ga0070664_100637440
793 Ga0068857_100322061
794 Ga0068857_100465580
795 Ga0068854_100011475
796 Ga0068854_100024391
797 Ga0068854_100378170
798 Ga0068856_100048956
799 Ga0070702_100006595
800 Ga0070702_100157102
801 Ga0068859_100004898
802 Ga0068859_100055640
803 Ga0068859_100254902
804 Ga0068859_100327012
805 Ga0068859_100411452
806 Ga0068859_100522321
807 Ga0068859_100725470
808 Ga0068859_100861173
809 Ga0068859_101005135
810 Ga0068864_100029153
811 Ga0068864_100159919
812 Ga0068864_100182645
813 Ga0068864_100233011
814 Ga0068864_100265823
815 Ga0068861_100012374
816 Ga0068861_100062960
817 Ga0068861_100256996
818 Ga0068861_100531977
819 Ga0068870_10081152
820 Ga0068863_100015844
821 Ga0068863_100264895
822 Ga0068863_100630225
823 Ga0068858_100004715
824 Ga0068858_100090975
825 Ga0068858_100092605
826 Ga0068858_100297682
827 Ga0068858_100346438
828 Ga0068858_100612109
829 Ga0068860_100148741
830 Ga0068860_100900863
831 Ga0068862_100022055
832 Ga0068862_100075128
833 Ga0068862_100538044
834 Ga0068862_100574073
835 Ga0068862_100708837
836 Ga0068862_100745901
837 Ga0081455_10084604
838 Ga0081455_10296327
839 Ga0081539_10010273
840 Ga0070717_10074849
841 Ga0070715_10177711
842 Ga0070716_100347917
843 Ga0070716_100732171
844 Ga0097621_100000128
845 Ga0097621_100003783
846 Ga0097621_100117874
847 Ga0097621_100140274
848 Ga0097621_100144089
849 Ga0097621_100315353
850 Ga0068871_100002077
851 Ga0068871_100007193
852 Ga0068871_100105754
853 Ga0068871_100184627
854 Ga0068871_100196533
855 Ga0075428_100036277
856 Ga0075428_100555029
857 Ga0075428_100582311
858 Ga0075428_101197400
859 Ga0075431_100068067
860 Ga0075431_100599815
861 Ga0075433_10032870
862 Ga0075433_10195871
863 Ga0075433_10278993
864 Ga0075433_10346887
865 Ga0075433_10748617
866 Ga0075434_100001992
867 Ga0075434_100003625
868 Ga0075434_100023484
869 Ga0075434_100032332
870 Ga0075434_100056632
871 Ga0075434_100057865
872 Ga0075434_100137399
873 Ga0075434_100140781
874 Ga0075434_100157166
875 Ga0075434_100265915
876 Ga0075434_100548174
877 Ga0075429_100388385
878 Ga0075429_100399832
879 Ga0068865_100008189
880 Ga0068865_100114729
881 Ga0068865_100346291
882 Ga0068865_100350375
883 Ga0075436_100004609
884 Ga0075436_100005416
885 Ga0075436_100008159
886 Ga0075436_100021836
887 Ga0075436_100032286
888 Ga0097620_100004898
889 Ga0097620_100055640
890 Ga0097620_100254878
891 Ga0097620_100326984
892 Ga0097620_100411437
893 Ga0097620_100522281
894 Ga0097620_100725560
895 Ga0097620_100861086
896 Ga0097620_101005001
897 Ga0075435_100000084
898 Ga0075435_100002678
899 Ga0075435_100006862
900 Ga0075435_100009423
901 Ga0075435_100028111
902 Ga0075435_100046313
903 Ga0075435_100248135
904 Ga0075435_100692982
905 Ga0105240_10096628
906 Ga0105240_10162987
907 Ga0105240_10228046
908 Ga0105240_10874606
909 Ga0105240_11417588
910 Ga0111539_10006401
911 Ga0111539_10096438
912 Ga0111539_10370338
913 Ga0111539_10593083
914 Ga0111539_11590723
915 Ga0111539_11917455
916 Ga0105245_10011018
917 Ga0105245_10086010
918 Ga0105245_10420838
919 Ga0105245_11370710
920 Ga0105247_10006561
921 Ga0105247_10017391
922 Ga0114129_10000192
923 Ga0114129_10001078
924 Ga0114129_10003659
925 Ga0114129_10016512
926 Ga0114129_10017742
927 Ga0114129_10018372
928 Ga0114129_10026225
929 Ga0114129_10032428
930 Ga0114129_10057382
931 Ga0114129_10082500
932 Ga0114129_10332076
933 Ga0114129_10904631
934 Ga0114129_11183581
935 Ga0105243_10019472
936 Ga0105243_10031220
937 Ga0105243_10752905
938 Ga0105241_10192645
939 Ga0105242_10004280
940 Ga0105242_10019040
941 Ga0105242_10716613
942 Ga0105248_10012848
943 Ga0105248_10021940
944 Ga0105248_10056077
945 Ga0105248_10101437
946 Ga0105248_10103135
947 Ga0105248_10139967
948 Ga0105248_10168496
949 Ga0105248_10231938
950 Ga0105248_10319893
951 Ga0105248_10636706
952 Ga0105248_10645580
953 Ga0105248_10920951
954 Ga0105248_11257095
955 Ga0105237_10211663
956 Ga0105238_10283394
957 Ga0105238_10519666
958 Ga0105249_10140522
959 Ga0105249_10169052
960 Ga0105249_10238653
961 Ga0105249_10259705
962 Ga0105246_10153162
963 Ga0157370_10558300
964 Ga0157374_10003571
965 Ga0157378_10041116
966 Ga0157378_10287020
967 Ga0157378_10397509
968 Ga0163162_10105810
969 Ga0163162_10711036
970 Ga0157375_11595159
971 Ga0163163_10010023
972 Ga0163163_10038409
973 Ga0163163_10431142
974 Ga0157380_10099339
975 Ga0157380_10143258
976 Ga0157380_10168021
977 Ga0157380_10318310
978 Ga0157380_11418716
979 Ga0157377_10034325
980 Ga0157377_10174096
981 Ga0157379_10024001
982 Ga0157379_10065761
983 Ga0157379_10110330
984 Ga0157379_10115331
985 Ga0157376_10006642
986 Ga0157376_10101571
987 Ga0157376_10382023
988 Ga0157376_11352538
989 Ga0163161_10200198
990 Ga0207692_10121925
991 Ga0207710_10021753
992 Ga0207688_10080760
993 Ga0207680_10041676
994 Ga0207680_10136821
995 Ga0207680_10208230
996 Ga0207685_10115030
997 Ga0207699_10062855
998 Ga0207645_10101649
999 Ga0207645_10160529
1000 Ga0207705_10051174
1001 Ga0207684_10208463
1002 Ga0207684_10311291
1003 Ga0207684_10820007
1004 Ga0207654_10093838
1005 Ga0207707_10416350
1006 Ga0207707_10494944
1007 Ga0207707_10524755
1008 Ga0207695_10044293
1009 Ga0207671_10180776
1010 Ga0207693_10500152
1011 Ga0207663_10043643
1012 Ga0207663_11096300
1013 Ga0207660_10075966
1014 Ga0207660_10137955
1015 Ga0207660_10221011
1016 Ga0207662_10046601
1017 Ga0207662_10415727
1018 Ga0207657_10008780
1019 Ga0207657_10043966
1020 Ga0207657_10497756
1021 Ga0207649_10243105
1022 Ga0207652_10118162
1023 Ga0207646_10036388
1024 Ga0207646_10161842
1025 Ga0207681_10005228
1026 Ga0207681_10025352
1027 Ga0207681_10027825
1028 Ga0207681_10115835
1029 Ga0207681_10471291
1030 Ga0207650_10022084
1031 Ga0207650_10831337
1032 Ga0207659_10000250
1033 Ga0207659_10016742
1034 Ga0207659_10239152
1035 Ga0207659_10603767
1036 Ga0207687_10114886
1037 Ga0207700_10016804
1038 Ga0207700_10557704
1039 Ga0207644_10006107
1040 Ga0207690_10427348
1041 Ga0207706_10045500
1042 Ga0207706_10068849
1043 Ga0207706_10658452
1044 Ga0207686_10005023
1045 Ga0207686_10032164
1046 Ga0207686_10717925
1047 Ga0207709_10035333
1048 Ga0207709_10062798
1049 Ga0207670_10074707
1050 Ga0207670_10805131
1051 Ga0207669_10005444
1052 Ga0207669_10007443
1053 Ga0207669_10104394
1054 Ga0207704_10004753
1055 Ga0207704_10061352
1056 Ga0207704_10107958
1057 Ga0207665_10018044
1058 Ga0207665_10353811
1059 Ga0207691_10053609
1060 Ga0207691_10132015
1061 Ga0207711_10026109
1062 Ga0207711_10030615
1063 Ga0207711_10035782
1064 Ga0207711_10166557
1065 Ga0207711_10683702
1066 Ga0207711_10712927
1067 Ga0207689_10114827
1068 Ga0207689_10457889
1069 Ga0207689_10517333
1070 Ga0207679_10494293
1071 Ga0207679_10604911
1072 Ga0207667_10024831
1073 Ga0207667_11297184
1074 Ga0207651_10017510
1075 Ga0207651_10044363
1076 Ga0207651_10051926
1077 Ga0207651_10394887
1078 Ga0207712_10122170
1079 Ga0207712_10342657
1080 Ga0207668_10062189
1081 Ga0207668_10317256
1082 Ga0207640_10098253
1083 Ga0207658_10809142
1084 Ga0207677_10032388
1085 Ga0207677_10066274
1086 Ga0207677_10351069
1087 Ga0207677_10624490
1088 Ga0207703_10016554
1089 Ga0207703_10017649
1090 Ga0207703_10137919
1091 Ga0207703_10230247
1092 Ga0207703_10469845
1093 Ga0207703_10655497
1094 Ga0207703_10678805
1095 Ga0207703_10792336
1096 Ga0207639_10308119
1097 Ga0207639_11195435
1098 Ga0207678_10655192
1099 Ga0207708_10000748
1100 Ga0207708_10086998
1101 Ga0207708_10258921
1102 Ga0207708_10325894
1103 Ga0207702_10034829
1104 Ga0207641_10004149
1105 Ga0207641_10546437
1106 Ga0207641_10796233
1107 Ga0207641_11026165
1108 Ga0207648_10026080
1109 Ga0207648_10103074
1110 Ga0207648_10368109
1111 Ga0207648_10912750
1112 Ga0207676_10022293
1113 Ga0207676_10188475
1114 Ga0207676_10216596
1115 Ga0207675_100006273
1116 Ga0207675_100028572
1117 Ga0207675_100099676
1118 Ga0207675_100119143
1119 Ga0207683_10033222
1120 Ga0207683_10143348
1121 Ga0207698_10743775
1122 Ga0207428_10034708
1123 Ga0207428_10198828
1124 Ga0268266_10006779
1125 Ga0268266_10015100
1126 Ga0268265_10006942
1127 Ga0268265_10063585
1128 Ga0268265_10540921
1129 Ga0268264_10212065
1130 Ga0268264_10450929
1131 Ga0268264_11140238
1132 Ga0373948_0002047
1133 Ga0373950_0029654
1134 Ga0373958_0003999
1135 Ga0373959_0002342
1136 Ga0373938_0088678
1137 Ga0373928_0001235
1138 Ga0373929_0000161
1139 Ga0373940_0000138
1140 Ga0373940_0129657
1141 Ga0373944_0022103
1142 Ga0373949_0005450
1143 Ga0373951_0003174
1144 Ga0373952_0022264
1145 Ga0373932_0008617
1146 Ga0373936_0359714
1147 Ga0373939_0001319
1148 Ga0373941_0001837
1149 Ga0373941_0055311
1150 Ga0373945_0026208
1151 Ga0373954_0061210
1152 Ga0373954_0209051
1153 Ga0373954_0298648
1154 Ga0373956_0401498
1155 Ga0373960_0000993
1156 Ga0373946_0009789
1157 Ga0373955_0011147
1158 Ga0373955_0161398
1159 Ga0373955_0378090
1160 Ga0373942_0000021
1161 Ga0373962_0011409
1162 Ga0373924_0002603
1163 Ga0373931_0324117
1164 Ga0373931_0736098
1165 Ga0373931_0741840
1166 Ga0373935_0012997
1167 Ga0373927_0363757
1168 Ga0373927_0403542
1169 Ga0373947_0015985
1170 Ga0373937_0010946
1171 Ga0373937_0057178
1172 Ga0373937_0178848
1173 Ga0373925_0149020
1174 Ga0373925_0455109
1175 Ga0373925_0783984
1176 Ga0436363_0281947
1177 Ga0439435_0040319
1178 Ga0450916_001660
1179 Ga0450916_036896
1180 Ga0451576_0006662
1181 Ga0451576_0580578
1182 Ga0451576_0588415
1183 Ga0451576_0999079
1184 Ga0495592_0012087
1185 Ga0495592_0082761
1186 Ga0495603_0069595
1187 Ga0495629_0177877
1188 Ga0495651_0116553
1189 Ga0495653_0533573
1190 Ga0495580_0184280
1191 Ga0495580_0215591
1192 Ga0495662_0172216
1193 Ga0495664_0192874
1194 Ga0495608_0014437
1195 Ga0495618_0069859
1196 Ga0495618_0483855
1197 Ga0495628_0287041
1198 Ga0495630_0002043
1199 Ga0495630_0511604
1200 Ga0495644_0190321
1201 Ga0495652_0219800
1202 Ga0495640_0059156
1203 Ga0495586_0369967
1204 Ga0495645_0006134
1205 Ga0495645_0078688
1206 Ga0495667_0088371
1207 Ga0495656_0141916
1208 Ga0495656_0327111
1209 Ga0495634_0071222
1210 Ga0495634_0132895
1211 Ga0495635_0084620
1212 Ga0495635_0376487
1213 Ga0495657_0446773
1214 Ga0495657_0564979
1215 Ga0495599_0466485
1216 Ga0495647_0051429
1217 Ga0495658_0008932
1218 Ga0495658_0090069
1219 Ga0495669_0048474
1220 Ga0495613_0001062
1221 Ga0495613_0207794
1222 Ga0495670_0219933
1223 Ga0495600_0087638
1224 Ga0495604_0008404
1225 Ga0495674_0053011
1226 Ga0495674_0095551
1227 Ga0495675_0115873
1228 Ga0495684_0000515
1229 Ga0495684_0051602
1230 Ga0495593_0150831
1231 Ga0495602_0183554
1232 Ga0496102_0035106
1233 Ga0496104_0076819
1234 Ga0496104_0433782
1235 Ga0496106_0099374
1236 Ga0496106_0130195
1237 Ga0496106_0402109
1238 Ga0496107_0176146
1239 Ga0496107_0177673
1240 Ga0496108_0164113
1241 Ga0496108_0297517
1242 Ga0496109_0175359
1243 Ga0496109_0468563
1244 Ga0496109_1110442
1245 Ga0496110_0167953
1246 Ga0496110_0251912
1247 Ga0496111_0208060
1248 Ga0496112_0010798
1249 Ga0496112_0024060
1250 Ga0496112_0151290
1251 Ga0496112_0239400
1252 Ga0496112_0291007
1253 Ga0496113_0235680
1254 Ga0496114_0023510
1255 Ga0496114_0124171
1256 Ga0496114_0883701
1257 Ga0501039_0257514
1258 Ga0501042_0684431
1259 Ga0501043_0119190
1260 Ga0501047_0003505
1261 Ga0501068_0119434
1262 Ga0501070_0213353
1263 Ga0501071_0442147
1264 Ga0501071_0560364
1265 Ga0501075_0142192
1266 Ga0501044_0002518
1267 nmdc:mga05p37_14261_c1
1268 nmdc:mga05p37_18959_c1
1269 nmdc:mga05p37_32176_c1
1270 nmdc:mga05p37_335976_c1
1271 nmdc:mga05p37_35431_c1
1272 nmdc:mga05p37_464076_c1
1273 nmdc:mga05p37_68567_c1
1274 nmdc:mga05p37_78658_c1
1275 nmdc:mga09592_142220_c1
1276 nmdc:mga09592_761747_c1
1277 nmdc:mga0qj67_651646_c1
1278 nmdc:mga06r32_207163_c1
1279 nmdc:mga06r32_22036_c1
1280 nmdc:mga08y16_1130650_c1
1281 nmdc:mga08y16_11800_c1
1282 nmdc:mga08y16_125979_c1
1283 nmdc:mga08y16_188218_c1
1284 nmdc:mga08y16_408382_c1
1285 nmdc:mga08y16_536205_c1
1286 nmdc:mga08y16_5939_c1
1287 nmdc:mga0n895_1167736_c1
1288 nmdc:mga0n895_145757_c1
1289 nmdc:mga0n895_145844_c1
1290 nmdc:mga0n895_233985_c1
1291 nmdc:mga0n895_399_c1
1292 nmdc:mga0n895_509831_c1
1293 nmdc:mga0n895_529053_c1
1294 nmdc:mga0n895_5669_c1
1295 nmdc:mga0n895_657045_c1
1296 nmdc:mga0n895_777562_c1
1297 nmdc:mga0n895_80730_c1
1298 nmdc:mga0n895_86139_c1
1299 nmdc:mga0rr50_1083642_c1
1300 nmdc:mga0rr50_17399_c1
1301 nmdc:mga0rr50_1949_c1
1302 nmdc:mga0rr50_26864_c1
1303 nmdc:mga0rr50_2_c1
1304 nmdc:mga0rr50_42308_c1
1305 nmdc:mga0rr50_48146_c1
1306 nmdc:mga0rr50_6226_c1
1307 nmdc:mga0rr50_81109_c1
1308 nmdc:mga0rr50_86108_c1
1309 nmdc:mga08x19_230_c1
1310 nmdc:mga08x19_246452_c1
1311 nmdc:mga08x19_276202_c1
1312 nmdc:mga08x19_333201_c1
1313 nmdc:mga08x19_343321_c1
1314 nmdc:mga08x19_97136_c1
1315 nmdc:mga0a205_27996_c1
1316 nmdc:mga0a205_341689_c1
1317 nmdc:mga0a205_371177_c1
1318 nmdc:mga0a205_519876_c1
1319 nmdc:mga0a205_738065_c1
1320 nmdc:mga0a205_940416_c1
1321 Ga0495601_0027353
1322 Ga0495601_0035415
1323 Ga0495601_0079250
1324 Ga0495601_0160886
1325 Ga0495601_0269881
1326 Ga0495595_0034172
1327 Ga0495595_0037265
1328 Ga0495595_0108204
1329 Ga0495619_0000690
1330 Ga0495619_0014491
1331 Ga0495619_0284709
1332 Ga0495619_0378350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mvh-assembly1.cif.gz_C crystal structure of fmn-binding beta-glucuronidase from roseburia hominis 0.7302 115 131
2c0j-assembly1.cif.gz_B crystal structure of the bet3-trs33 heterodimer 0.7245 45 188
7yh3-assembly1.cif.gz_C trappc3 from thorarchaeota smtz1-45 0.7159 48 188
1wc8-assembly1.cif.gz_A-2 the crystal structure of mouse bet3p 0.7089 48 188
2c0j-assembly1.cif.gz_B crystal structure of the bet3-trs33 heterodimer 0.7078 45 188
ID Description Score Start End Superfamily
af_Q57614_9_172_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.8083 43 189 3.30.1380.20
af_P08372_33_104_3.30.1300.30 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.7855 116 131 3.30.1300.30
af_Q58265_65_225_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.748 49 188 3.30.1380.20
af_A0A0R4IAL7_30_231_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7316 116 134 2.60.40.10
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7115 114 132 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1F2T674-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9675 1 188
AF-A0A3N5P6U0-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9598 10 191
AF-A0A1F2T674-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9575 1 188
AF-A0A2V8G466-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9524 52 193
AF-A0A3D1ILF5-F1-model_v4 Uncharacterized protein 0.9522 1 152

Map