F473665

General Info

Members Datasets Scaffolds Average Seq Length
664 530 255 327

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|650716007|650739069
Length 394
Sequence AALRCDNGIAVPPTPDGPTCQHVNYQFLKFRSNLREAGFLATFSLYCPLGKVTLARIGRKMMTQSLSMSRRGLIGVAGASVLGAPLLMARTATAQTNQPQTSMEIKHAMPPETNRFKLGNFEVLVVKDGARAAPNPGETFGTDQSAETVGKLLEDNFLPKEQFVNSFSPVLVNTGTDLVLFDTGFGESGRGAGNGRLIEGMAAAGYSPDDVTVVVLTHMHGDHIGGLMEKGAPAFSKARYVFGQAEYDFWTDEKRVGTSAEGGQKGVIANVKPLAEKATFIGDGADVVSGITGIAAFGHSPGHMIFRVESEGKQLILTADTANHFVLSLQKPDWEVKFDMDKAAAAATRKKVYDMIATDRLPFLGYHMPFPAVGYAEKLDTGYRFVPKSYQFDI

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
13 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
18 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
19 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
20 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
21 2516143018 Ensifer sp. BR816 Isolate Nodule
22 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
23 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
24 2519899620 Rhizobium sp. Pop5 Isolate Nodule
25 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
26 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
27 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
28 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
29 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
30 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
31 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
32 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
33 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
34 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
35 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
36 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
37 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
38 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
39 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
40 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
41 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
42 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
43 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
44 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
45 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
46 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
47 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
48 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
49 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
50 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
51 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
52 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
53 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
54 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
55 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
56 2643221558 Rhizobium sp. Root149 Isolate Unclassified
57 2643221568 Rhizobium sp. Root564 Isolate Unclassified
58 2643221582 Rhizobium sp. Root651 Isolate Unclassified
59 2643221599 Rhizobium sp. Root708 Isolate Unclassified
60 2643221607 Rhizobium sp. Root73 Isolate Unclassified
61 2643221618 Ensifer sp. Root231 Isolate Unclassified
62 2643221626 Ensifer sp. Root31 Isolate Unclassified
63 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
64 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
65 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
66 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
67 2643221655 Ensifer sp. Root1252 Isolate Unclassified
68 2643221659 Ensifer sp. Root127 Isolate Unclassified
69 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
70 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
71 2643221693 Rhizobium sp. Root491 Isolate Unclassified
72 2643221698 Ensifer sp. Root142 Isolate Unclassified
73 2643221712 Ensifer sp. Root258 Isolate Unclassified
74 2643221718 Rhizobium sp. Root268 Isolate Unclassified
75 2643221719 Rhizobium sp. Root274 Isolate Unclassified
76 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
77 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
78 2718217882 Rhizobium sp. N741 Isolate Nodule
79 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
80 2718218009 Rhizobium sp. N561 Isolate Nodule
81 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
82 2718218363 Rhizobium sp. N113 Isolate Nodule
83 2718218365 Rhizobium sp. N731 Isolate Nodule
84 2718218366 Rhizobium sp. N621 Isolate Nodule
85 2721755514 Rhizobium sp. N6212 Isolate Nodule
86 2721755810 Rhizobium sp. N871 Isolate Nodule
87 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
88 2728369365 Rhizobium sp. N1341 Isolate Nodule
89 2728369397 Rhizobium sp. N1314 Isolate Nodule
90 2738541293 Rhizobium sp. GV031 Isolate Unclassified
91 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
92 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
93 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
94 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
95 2791355261 Rhizobium sp. J15 Isolate Nodule
96 2791355262 Rhizobium sp. M1 Isolate Nodule
97 2791355265 Rhizobium sp. H4 Isolate Nodule
98 2791355266 Rhizobium sp. L43 Isolate Nodule
99 2791355267 Rhizobium sp. L18 Isolate Nodule
100 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
101 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
102 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
103 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
104 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
105 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
106 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
107 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
108 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
109 2802429633 Rhizobium anhuiense J3 Isolate Nodule
110 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
111 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
112 2802429637 Rhizobium anhuiense C15 Isolate Nodule
113 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
114 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
115 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
116 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
117 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
118 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
119 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
120 2838048938 Rhizobium pisi 27/80 Isolate Nodule
121 2838061910 Rhizobium phaseoli L15 Isolate Nodule
122 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
123 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
124 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
125 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
126 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
127 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
128 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
129 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
130 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
131 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
132 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
133 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
134 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
135 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
136 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
137 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
138 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
139 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
140 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
141 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
142 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
143 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
144 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
145 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
146 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
147 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
148 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
149 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
150 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
151 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
152 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
153 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
154 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
155 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
156 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
157 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
158 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
159 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
160 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
161 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
162 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
163 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
164 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
165 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
166 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
167 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
168 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
169 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
170 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
171 2844163670 Ensifer sp. 1H6 Isolate Unclassified
172 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
173 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
174 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
175 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
176 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
177 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
178 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
179 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
180 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
181 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
182 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
183 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
184 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
185 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
186 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
187 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
188 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
189 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
190 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
191 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
192 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
193 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
194 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
195 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
196 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
197 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
198 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
199 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
200 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
201 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
202 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
203 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
204 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
205 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
206 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
207 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
208 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
209 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
210 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
211 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
212 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
213 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
214 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
215 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
216 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
217 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
218 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
219 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
220 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
221 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
222 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
223 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
224 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
225 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
226 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
227 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
228 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
229 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
230 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
231 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
232 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
233 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
234 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
235 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
236 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
237 2933599457 Rhizobium phaseoli M3 Isolate Nodule
238 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
239 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
240 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
241 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
242 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
243 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
244 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
245 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
246 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
247 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
248 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
249 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
250 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
251 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
252 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
253 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
254 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
255 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
256 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
257 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
258 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
259 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
260 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
261 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
262 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
263 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
264 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
265 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
266 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
267 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
268 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
269 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
270 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
271 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
272 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
273 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
274 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
275 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
276 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
277 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
278 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
279 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
280 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
281 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
282 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
283 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
284 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
285 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
286 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
287 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
288 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
289 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
290 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
291 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
292 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
293 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
294 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
295 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
296 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
297 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
298 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
299 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
300 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
301 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
302 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
303 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
304 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
305 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
306 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
307 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
308 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
309 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
310 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
311 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
312 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
313 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
314 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
315 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
316 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
317 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
318 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
319 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
320 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
321 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
322 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
323 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
324 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
325 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
326 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
327 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
328 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
329 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
330 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
331 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
332 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
333 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
334 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
335 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
336 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
337 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
338 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
339 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
340 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
341 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
342 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
343 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
344 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
345 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
346 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
347 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
348 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
349 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
350 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
351 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
352 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
353 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
354 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
355 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
356 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
357 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
358 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
359 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
360 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
361 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
362 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
363 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
364 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
365 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
366 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
367 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
368 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
369 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
370 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
371 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
372 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
373 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
374 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
375 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
376 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
377 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
378 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
379 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
380 2996893221 Rhizobium sp. R635 Isolate Nodule
381 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
382 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
383 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
384 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
385 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
386 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
387 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
388 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
389 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
390 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
391 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
392 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
393 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
394 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
395 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
396 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
397 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
398 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
399 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
400 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
401 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
402 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
403 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
404 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
405 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
406 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
407 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
408 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
409 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
410 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
411 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
412 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
413 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
414 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
415 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
416 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
417 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
418 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
419 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
420 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
421 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
422 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
423 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
424 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
425 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
426 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
427 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
428 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
429 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
430 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
432 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
435 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
436 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
437 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
438 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
439 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
440 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
441 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
442 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
443 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
444 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
445 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
446 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
447 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
448 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
449 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
450 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
451 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
452 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
453 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
454 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
455 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
456 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
457 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
458 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
459 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
460 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
463 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
464 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
465 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
466 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
467 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
468 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
469 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
470 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
471 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
472 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
473 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
474 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
475 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
476 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
477 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
478 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
479 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
480 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
481 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
482 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
483 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
486 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
487 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
488 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
489 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
490 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
493 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
494 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
495 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
496 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
497 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
498 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
499 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
500 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
501 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
502 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
503 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
504 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
505 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
506 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
507 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
508 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
509 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
510 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
511 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
512 8005382845 Rhizobium sp. R634 Isolate Nodule
513 8005395548 Rhizobium sp. R339 Isolate Nodule
514 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
515 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
516 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
517 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
518 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
519 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
520 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
521 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
522 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
523 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
524 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
525 8018176218 Rhizobium sp. N122 Isolate Nodule
526 8024501048 Rhizobium sp. H4 Isolate Nodule
527 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
528 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
529 8056382006 Rhizobium croatiense 13T Isolate Nodule
530 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 38.4
Metatranscriptomes 0
Isolates 61.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 15.66
Nodule 48.95
Rhizoplane 2.26
Rhizosphere 11.6
Stem 0
Stem Tuber 0
Unclassified 20.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C3453 2010549000 Bacteria 1313
2 JGI25158J39367_1000091 3300002739 Bacteria 21033
3 JGI25152J39213_1001312 3300002773 Bacteria 11110
4 JGI25152J39213_1003296 3300002773 Bacteria 5580
5 JGI25152J39213_1005777 3300002773 Bacteria 3519
6 JGI25150J39212_1000012 3300002774 Bacteria 182468
7 JGI25159J45721_1000452 3300002987 Bacteria 18938
8 JGI25151J46595_10000025 3300003187 Bacteria 213302
9 JGI25151J46595_10000250 3300003187 Bacteria 62876
10 JGI25151J46595_10003372 3300003187 Bacteria 8844
11 JGI25151J46595_10003625 3300003187 Bacteria 8443
12 JGI25153J46596_10000232 3300003215 Bacteria 47116
13 JGI25153J46596_10013500 3300003215 Bacteria 3447
14 rootL2_10161986 3300003322 Bacteria 1598
15 rootH1_10196940 3300003323 Bacteria 1372
16 JGI25160J50197_1005755 3300003354 Bacteria 5111
17 JGI25161J50226_1000074 3300003374 Bacteria 85547
18 JGI25161J50226_1001359 3300003374 Bacteria 7523
19 Ga0055526_1002214 3300003771 Bacteria 13327
20 Ga0055526_1005759 3300003771 Bacteria 6988
21 Ga0055526_1030776 3300003771 Bacteria 1557
22 Ga0055524_1004019 3300003775 Bacteria 6935
23 Ga0055528_1002867 3300003790 Bacteria 8972
24 Ga0055528_1018107 3300003790 Bacteria 2404
25 Ga0055528_1024591 3300003790 Bacteria 1801
26 Ga0055528_1033589 3300003790 Bacteria 1282
27 Ga0055530_10014572 3300003791 Bacteria 2611
28 Ga0055540_1000111 3300003792 Bacteria 88263
29 Ga0055540_1010213 3300003792 Bacteria 3142
30 Ga0058692_1002656 3300003856 Bacteria 5887
31 Ga0058692_1002911 3300003856 Bacteria 5528
32 Ga0055543_1000188 3300004625 Bacteria 50290
33 Ga0055543_1002371 3300004625 Bacteria 6290
34 Ga0065165_1012507 3300005262 Bacteria 3452
35 Ga0065165_1027683 3300005262 Bacteria 1842
36 Ga0070671_100016028 3300005355 Bacteria 6056
37 Ga0070659_100183812 3300005366 Bacteria 1716
38 Ga0075368_10069955 3300006042 Bacteria 1416
39 Ga0075364_10003332 3300006051 Bacteria 9116
40 Ga0075367_10092128 3300006178 Bacteria 1845
41 Ga0075369_10060632 3300006186 Bacteria 1650
42 Ga0079104_1000069 3300006946 Bacteria 153993
43 Ga0099826_10018831 3300006948 Bacteria 5198
44 Ga0105244_10052971 3300009036 Bacteria 2064
45 Ga0105248_10008945 3300009177 Bacteria 11014
46 Ga0123340_1035040 3300009763 Bacteria 2712
47 Ga0123341_1000175 3300009765 Bacteria 32159
48 Ga0123341_1044799 3300009765 Bacteria 2712
49 Ga0163163_10182980 3300014325 Bacteria 2143
50 Ga0183363_1147 3300015690 Bacteria 17691
51 Ga0214542_1000011 3300021321 Bacteria 238260
52 Ga0214543_1000003 3300021327 Bacteria 692327
53 Ga0214543_1000004 3300021327 Bacteria 527190
54 Ga0228711_1001272 3300022739 Bacteria 36396
55 Ga0228710_1001367 3300022740 Bacteria 36396
56 Ga0209436_100650 3300025208 Bacteria 14804
57 Ga0207425_1000012 3300025245 Bacteria 528324
58 Ga0209129_1000086 3300025258 Bacteria 181543
59 Ga0209129_1000123 3300025258 Bacteria 133661
60 Ga0209129_1000261 3300025258 Bacteria 53485
61 Ga0209129_1000316 3300025258 Bacteria 42919
62 Ga0209129_1004270 3300025258 Bacteria 5704
63 Ga0209673_1000015 3300025273 Bacteria 530618
64 Ga0209673_1000091 3300025273 Bacteria 201875
65 Ga0209673_1000919 3300025273 Bacteria 37355
66 Ga0209673_1002894 3300025273 Bacteria 10885
67 Ga0209673_1003237 3300025273 Bacteria 9842
68 Ga0209130_1000002 3300025284 Bacteria 722648
69 Ga0209130_1012451 3300025284 Bacteria 2224
70 Ga0209676_1015012 3300025292 Bacteria 2875
71 Ga0209676_1023395 3300025292 Bacteria 2024
72 Ga0209025_1000024 3300025294 Bacteria 528324
73 Ga0209025_1000407 3300025294 Bacteria 87041
74 Ga0209025_1000441 3300025294 Bacteria 81951
75 Ga0209025_1000469 3300025294 Bacteria 78737
76 Ga0209025_1003038 3300025294 Bacteria 16550
77 Ga0209025_1006436 3300025294 Bacteria 9112
78 Ga0209025_1008383 3300025294 Bacteria 7449
79 Ga0209564_1000845 3300025295 Bacteria 41202
80 Ga0209564_1001820 3300025295 Bacteria 19586
81 Ga0209564_1006326 3300025295 Bacteria 6434
82 Ga0209758_1000046 3300025297 Bacteria 364931
83 Ga0209758_1000336 3300025297 Bacteria 87439
84 Ga0209758_1000602 3300025297 Bacteria 55848
85 Ga0209758_1000877 3300025297 Bacteria 41329
86 Ga0209758_1033753 3300025297 Bacteria 2049
87 Ga0209256_1000180 3300025299 Bacteria 123687
88 Ga0209256_1002068 3300025299 Bacteria 17685
89 Ga0209256_1002341 3300025299 Bacteria 15796
90 Ga0209256_1006061 3300025299 Bacteria 6594
91 Ga0209256_1007494 3300025299 Bacteria 5362
92 Ga0209256_1025746 3300025299 Bacteria 1708
93 Ga0207426_1000013 3300025302 Bacteria 721897
94 Ga0207426_1000172 3300025302 Bacteria 163690
95 Ga0207426_1001284 3300025302 Bacteria 21757
96 Ga0209051_1000084 3300025303 Bacteria 190324
97 Ga0209051_1001391 3300025303 Bacteria 20798
98 Ga0209051_1009000 3300025303 Bacteria 5200
99 Ga0209257_1002244 3300025304 Bacteria 19810
100 Ga0209257_1005200 3300025304 Bacteria 9345
101 Ga0207647_10076193 3300025904 Bacteria 2017
102 Ga0207668_10277893 3300025972 Bacteria 1372
103 Ga0209281_1000192 3300027111 Bacteria 140252
104 Ga0209281_1000629 3300027111 Bacteria 39061
105 Ga0209281_1000665 3300027111 Bacteria 36397
106 Ga0209371_1000009 3300027312 Bacteria 963030
107 Ga0209371_1000547 3300027312 Bacteria 35249
108 Ga0209282_1000172 3300027666 Bacteria 36305
109 Ga0209282_1000224 3300027666 Bacteria 29523
110 Ga0307515_10000154 3300028794 Bacteria 166582
111 Ga0307515_10001722 3300028794 Bacteria 48683
112 Ga0307515_10004744 3300028794 Bacteria 27847
113 Ga0268256_1000010 3300030500 Bacteria 963034
114 Ga0268256_1009008 3300030500 Bacteria 3360
115 Ga0307408_100151144 3300031548 Bacteria 1833
116 Ga0307405_10000238 3300031731 Bacteria 20020
117 Ga0307406_10007930 3300031901 Bacteria 5912
118 Ga0307412_10022458 3300031911 Bacteria 3868
119 Ga0315914_1001342 3300031967 Bacteria 36422
120 Ga0307416_100067065 3300032002 Bacteria 2958
121 Ga0315913_1000452 3300033430 Bacteria 36290
122 Ga0315915_1000691 3300033464 Bacteria 36672
123 Ga0316584_0170300 3300036712 Bacteria 1616
124 Ga0439465_0013711 3300041413 Bacteria 2524
125 Ga0451795_1430566 3300041456 Bacteria 1515
126 Ga0439449_0028489 3300042007 Bacteria 2082
127 Ga0439449_0031793 3300042007 Bacteria 1967
128 Ga0450918_001138 3300042531 Bacteria 5452
129 Ga0495606_0059466 3300046507 Bacteria 2451
130 Ga0495606_0113529 3300046507 Bacteria 1631
131 Ga0495610_0010591 3300046512 Bacteria 5715
132 Ga0495620_0047257 3300046515 Bacteria 1853
133 Ga0495632_0048044 3300046519 Bacteria 2114
134 Ga0495632_0084155 3300046519 Bacteria 1514
135 Ga0495643_0014063 3300046522 Bacteria 4771
136 Ga0495633_0017399 3300046558 Bacteria 3678
137 Ga0495625_0183288 3300046660 Bacteria 1391
138 Ga0495588_0004349 3300046674 Bacteria 6255
139 Ga0495670_0069405 3300046691 Bacteria 1782
140 Ga0495649_0012442 3300046694 Bacteria 4948
141 Ga0495672_0039358 3300047320 Bacteria 2874
142 Ga0495681_0002944 3300047470 Bacteria 12026
143 Ga0495681_0088574 3300047470 Bacteria 1370
144 Ga0495686_0042949 3300047472 Bacteria 2870
145 Ga0495686_0173570 3300047472 Bacteria 1253
146 Ga0495615_0022047 3300048090 Bacteria 1444
147 Ga0496102_0190911 3300048905 Bacteria 1930
148 Ga0496104_0192662 3300048907 Bacteria 1950
149 Ga0496104_0206555 3300048907 Bacteria 1876
150 Ga0496105_0157264 3300048908 Bacteria 1866
151 Ga0496106_0000259 3300048909 Bacteria 37115
152 Ga0496110_0116996 3300048913 Bacteria 2400
153 Ga0496111_0098186 3300048914 Bacteria 2150
154 Ga0496111_0138964 3300048914 Bacteria 1800
155 Ga0496116_0000080 3300048919 Bacteria 224530
156 Ga0496116_0001010 3300048919 Bacteria 34302
157 Ga0496116_0037829 3300048919 Bacteria 3359
158 Ga0496116_0090731 3300048919 Bacteria 1859
159 Ga0496116_0117512 3300048919 Bacteria 1547
160 Ga0496116_0128357 3300048919 Bacteria 1451
161 Ga0496116_0146152 3300048919 Bacteria 1321
162 Ga0496116_0175644 3300048919 Bacteria 1154
163 Ga0496117_0000732 3300048920 Bacteria 51545
164 Ga0496117_0025185 3300048920 Bacteria 4683
165 Ga0496117_0035137 3300048920 Bacteria 3767
166 Ga0496117_0049643 3300048920 Bacteria 2982
167 Ga0496117_0174685 3300048920 Bacteria 1243
168 Ga0496118_0024440 3300048921 Bacteria 5213
169 Ga0496118_0028580 3300048921 Bacteria 4693
170 Ga0496118_0076527 3300048921 Bacteria 2379
171 Ga0496118_0176433 3300048921 Bacteria 1297
172 Ga0496119_0006263 3300048922 Bacteria 11104
173 Ga0496120_0007965 3300048923 Bacteria 7801
174 Ga0496120_0133205 3300048923 Bacteria 1270
175 Ga0496121_0000001 3300048924 Bacteria 1830318
176 Ga0496121_0000581 3300048924 Bacteria 68614
177 Ga0496121_0008494 3300048924 Bacteria 12052
178 Ga0496121_0009527 3300048924 Bacteria 11132
179 Ga0496121_0016422 3300048924 Bacteria 7648
180 Ga0496121_0029801 3300048924 Bacteria 5031
181 Ga0496121_0074985 3300048924 Bacteria 2704
182 Ga0496121_0095086 3300048924 Bacteria 2316
183 Ga0496121_0209152 3300048924 Bacteria 1384
184 Ga0496121_0269372 3300048924 Bacteria 1171
185 Ga0496122_0000009 3300048925 Bacteria 584024
186 Ga0496122_0000247 3300048925 Bacteria 121291
187 Ga0496122_0001682 3300048925 Bacteria 34269
188 Ga0496122_0014835 3300048925 Bacteria 7503
189 Ga0496122_0018592 3300048925 Bacteria 6406
190 Ga0496122_0098864 3300048925 Bacteria 1958
191 Ga0496122_0124793 3300048925 Bacteria 1650
192 Ga0496122_0169639 3300048925 Bacteria 1317
193 Ga0496123_0000020 3300048926 Bacteria 388748
194 Ga0496123_0000222 3300048926 Bacteria 115482
195 Ga0496123_0015313 3300048926 Bacteria 6298
196 Ga0496123_0026585 3300048926 Bacteria 4330
197 Ga0496123_0035198 3300048926 Bacteria 3572
198 Ga0496123_0048320 3300048926 Bacteria 2863
199 Ga0496123_0072254 3300048926 Bacteria 2147
200 Ga0496123_0089780 3300048926 Bacteria 1829
201 Ga0496123_0095121 3300048926 Bacteria 1753
202 Ga0496124_0000063 3300048927 Bacteria 229705
203 Ga0496124_0000704 3300048927 Bacteria 54690
204 Ga0496124_0006765 3300048927 Bacteria 12390
205 Ga0496124_0021527 3300048927 Bacteria 5939
206 Ga0496124_0025767 3300048927 Bacteria 5318
207 Ga0496124_0057470 3300048927 Bacteria 3277
208 Ga0496124_0068146 3300048927 Bacteria 2959
209 Ga0496124_0095480 3300048927 Bacteria 2416
210 Ga0496124_0117520 3300048927 Bacteria 2130
211 Ga0496124_0134805 3300048927 Bacteria 1956
212 Ga0496124_0303439 3300048927 Bacteria 1152
213 Ga0496124_0311563 3300048927 Bacteria 1131
214 Ga0496125_0000001 3300048928 Bacteria 1766138
215 Ga0496125_0004123 3300048928 Bacteria 16969
216 Ga0496125_0011912 3300048928 Bacteria 8663
217 Ga0496125_0014312 3300048928 Bacteria 7730
218 Ga0496125_0038012 3300048928 Bacteria 4175
219 Ga0496125_0060068 3300048928 Bacteria 3058
220 Ga0496125_0176139 3300048928 Bacteria 1431
221 Ga0496126_0000094 3300048929 Bacteria 208184
222 Ga0496126_0006808 3300048929 Bacteria 12679
223 Ga0496126_0034636 3300048929 Bacteria 4741
224 Ga0496126_0038693 3300048929 Bacteria 4434
225 Ga0496126_0108209 3300048929 Bacteria 2424
226 Ga0496126_0198663 3300048929 Bacteria 1694
227 Ga0495678_028473 3300049459 Bacteria 2357
228 Ga0501037_0075456 3300049573 Bacteria 2448
229 Ga0501280_002004 3300049776 Bacteria 3536
230 Ga0501280_005559 3300049776 Bacteria 1802
231 Ga0501045_0084430 3300049824 Bacteria 2343
232 nmdc:mga00v17_133_c2 3300050491 Bacteria 35968
233 nmdc:mga00v17_36276_c1 3300050491 Bacteria 2507
234 nmdc:mga0yw44_131648_c1 3300050492 Bacteria 1620
235 nmdc:mga0k408_52535_c2 3300050493 Bacteria 1877
236 nmdc:mga06z11_87426_c1 3300050494 Bacteria 1685
237 nmdc:mga0sz30_13742_c1 3300050516 Bacteria 3175
238 nmdc:mga0sz30_82645_c1 3300050516 Bacteria 1391
239 Ga0500651_0107524 3300053093 Bacteria 1705
240 Ga0500560_001584 3300053107 Bacteria 4019
241 Ga0500560_047081 3300053107 Bacteria 1373
242 Ga0500572_005116 3300053111 Bacteria 2966
243 Ga0500608_079518 3300053122 Bacteria 1548
244 Ga0500618_000151 3300053125 Bacteria 57092
245 Ga0500618_004812 3300053125 Bacteria 4224
246 Ga0500568_0001043 3300053139 Bacteria 18919
247 Ga0500568_0001239 3300053139 Bacteria 16933
248 Ga0500568_0074897 3300053139 Bacteria 1291
249 Ga0500616_0002540 3300053153 Bacteria 15067
250 Ga0500622_0000348 3300053156 Bacteria 45124
251 Ga0500622_0000644 3300053156 Bacteria 31219
252 Ga0500622_0085578 3300053156 Bacteria 1572
253 Ga0500633_0026574 3300053160 Bacteria 1823
254 Ga0500634_0001572 3300053161 Bacteria 8981
255 Ga0500636_0007563 3300053177 Bacteria 6282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0146152 Ga0496116_0146152_14_913 280
2 3300048925 Ga0496122_0169639 Ga0496122_0169639_10_909 280
3 3300053125 Ga0500618_004812 Ga0500618_004812_480_1568 304
4 3300046512 Ga0495610_0010591 Ga0495610_0010591_1295_2281 307
5 3300046515 Ga0495620_0047257 Ga0495620_0047257_806_1792 307
6 3300046519 Ga0495632_0084155 Ga0495632_0084155_273_1259 307
7 3300047472 Ga0495686_0042949 Ga0495686_0042949_492_1478 307
8 3300048924 Ga0496121_0074985 Ga0496121_0074985_253_1299 307
9 3300048927 Ga0496124_0117520 Ga0496124_0117520_623_1609 307
10 3300049459 Ga0495678_028473 Ga0495678_028473_451_1437 307
11 3300046519 Ga0495632_0048044 Ga0495632_0048044_865_1857 309
12 3300031911 Ga0307412_10022458 Ga0307412_100224584 310
13 3300048924 Ga0496121_0095086 Ga0496121_0095086_491_1537 310
14 3300048926 Ga0496123_0072254 Ga0496123_0072254_675_1721 310
15 3300048926 Ga0496123_0095121 Ga0496123_0095121_282_1328 310
16 3300048927 Ga0496124_0057470 Ga0496124_0057470_834_1880 310
17 3300048927 Ga0496124_0134805 Ga0496124_0134805_729_1775 310
18 3300002773 JGI25152J39213_1001312 JGI25152J39213_10013129 311
19 3300002774 JGI25150J39212_1000012 JGI25150J39212_1000012176 311
20 3300003187 JGI25151J46595_10000025 JGI25151J46595_10000025216 311
21 3300003215 JGI25153J46596_10000232 JGI25153J46596_100002329 311
22 3300025245 Ga0207425_1000012 Ga0207425_1000012379 311
23 3300025258 Ga0209129_1000086 Ga0209129_1000086162 311
24 3300025294 Ga0209025_1000024 Ga0209025_1000024379 311
25 3300025297 Ga0209758_1000046 Ga0209758_1000046162 311
26 3300031731 Ga0307405_10000238 Ga0307405_1000023816 311
27 3300048919 Ga0496116_0001010 Ga0496116_0001010_10067_11152 311
28 3300048919 Ga0496116_0175644 Ga0496116_0175644_41_1126 311
29 3300048920 Ga0496117_0025185 Ga0496117_0025185_1515_2600 311
30 3300048921 Ga0496118_0076527 Ga0496118_0076527_919_1965 311
31 3300048924 Ga0496121_0008494 Ga0496121_0008494_8970_10055 311
32 3300048925 Ga0496122_0001682 Ga0496122_0001682_4553_5638 311
33 3300048926 Ga0496123_0026585 Ga0496123_0026585_428_1513 311
34 3300048927 Ga0496124_0021527 Ga0496124_0021527_428_1513 311
35 3300048928 Ga0496125_0004123 Ga0496125_0004123_933_2018 311
36 3300048929 Ga0496126_0108209 Ga0496126_0108209_555_1640 311
37 3300003775 Ga0055524_1004019 Ga0055524_10040191 313
38 3300025299 Ga0209256_1000180 Ga0209256_100018011 313
39 iso_pu_bacteria 2916028427 2916029090 314
40 iso_pu_bacteria 2916055098 2916060132 314
41 iso_pu_bacteria 2921208531 2921214981 314
42 iso_pu_bacteria 2921263974 2921268999 314
43 iso_pu_bacteria 2924172951 2924178233 314
44 iso_pu_bacteria 2937042894 2937048666 314
45 iso_pu_bacteria 2957478035 2957482933 314
46 iso_pu_bacteria 2967775926 2967778338 314
47 3300046507 Ga0495606_0059466 Ga0495606_0059466_563_1531 317
48 3300048929 Ga0496126_0034636 Ga0496126_0034636_1455_2417 317
49 iso_pu_bacteria 2558860983 2561467411 317
50 iso_pu_bacteria 2921257292 2921260254 317
51 iso_pu_bacteria 2937023124 2937023912 317
52 iso_pu_bacteria 2957395598 2957399466 317
53 iso_pu_bacteria 2964615318 2964619901 317
54 iso_pu_bacteria 2967755722 2967761390 317
55 iso_pu_bacteria 2970102677 2970103458 317
56 3300009036 Ga0105244_10052971 Ga0105244_100529711 318
57 3300009177 Ga0105248_10008945 Ga0105248_100089459 318
58 3300009763 Ga0123340_1035040 Ga0123340_10350403 318
59 3300009765 Ga0123341_1044799 Ga0123341_10447993 318
60 3300014325 Ga0163163_10182980 Ga0163163_101829802 318
61 3300042007 Ga0439449_0028489 Ga0439449_0028489_216_1190 318
62 3300048905 Ga0496102_0190911 Ga0496102_0190911_97_1071 318
63 3300048907 Ga0496104_0192662 Ga0496104_0192662_135_1109 318
64 3300048908 Ga0496105_0157264 Ga0496105_0157264_58_1032 318
65 3300048913 Ga0496110_0116996 Ga0496110_0116996_140_1114 318
66 3300048914 Ga0496111_0138964 Ga0496111_0138964_12_986 318
67 3300048919 Ga0496116_0090731 Ga0496116_0090731_18_992 318
68 3300048923 Ga0496120_0133205 Ga0496120_0133205_215_1189 318
69 3300048924 Ga0496121_0269372 Ga0496121_0269372_64_1038 318
70 3300048925 Ga0496122_0098864 Ga0496122_0098864_850_1824 318
71 3300048926 Ga0496123_0048320 Ga0496123_0048320_1008_1979 318
72 3300048927 Ga0496124_0311563 Ga0496124_0311563_93_1067 318
73 3300048928 Ga0496125_0060068 Ga0496125_0060068_125_1099 318
74 3300048929 Ga0496126_0038693 Ga0496126_0038693_876_1847 318
75 iso_pu_bacteria 2510065057 2510305203 318
76 iso_pu_bacteria 2511231052 2511500632 318
77 iso_pu_bacteria 2512047086 2512532059 318
78 iso_pu_bacteria 2512875026 2512972611 318
79 iso_pu_bacteria 2513237086 2513584212 318
80 iso_pu_bacteria 2513237089 2513606816 318
81 iso_pu_bacteria 2513237091 2513619199 318
82 iso_pu_bacteria 2513237140 2513880677 318
83 iso_pu_bacteria 2513237143 2513903390 318
84 iso_pu_bacteria 2513237160 2514008482 318
85 iso_pu_bacteria 2515154107 2515607771 318
86 iso_pu_bacteria 2516653046 2516891908 318
87 iso_pu_bacteria 2517487022 2517568723 318
88 iso_pu_bacteria 2524023207 2524449961 318
89 iso_pu_bacteria 2551306084 2551681604 318
90 iso_pu_bacteria 2551306085 2551689124 318
91 iso_pu_bacteria 2551306086 2551694106 318
92 iso_pu_bacteria 2551306087 2551701774 318
93 iso_pu_bacteria 2551306089 2551709106 318
94 iso_pu_bacteria 2551306090 2551722432 318
95 iso_pu_bacteria 2551306091 2551729976 318
96 iso_pu_bacteria 2551306092 2551737328 318
97 iso_pu_bacteria 2551306093 2551742907 318
98 iso_pu_bacteria 2802428858 2802721648 318
99 iso_pu_bacteria 2802428859 2802728459 318
100 iso_pu_bacteria 2802428860 2802734520 318
101 iso_pu_bacteria 2802428861 2802735854 318
102 iso_pu_bacteria 2802428862 2802747265 318
103 iso_pu_bacteria 2802428863 2802753917 318
104 iso_pu_bacteria 2855825444 2855831827 318
105 iso_pu_bacteria 2858800743 2858804021 318
106 iso_pu_bacteria 2915980308 2915984959 318
107 iso_pu_bacteria 2915986958 2915990828 318
108 iso_pu_bacteria 2915993759 2915999623 318
109 iso_pu_bacteria 2916000859 2916007214 318
110 iso_pu_bacteria 2916007675 2916008977 318
111 iso_pu_bacteria 2916014648 2916019770 318
112 iso_pu_bacteria 2916021584 2916022587 318
113 iso_pu_bacteria 2916035215 2916039840 318
114 iso_pu_bacteria 2916041962 2916042844 318
115 iso_pu_bacteria 2916048683 2916051826 318
116 iso_pu_bacteria 2916061851 2916066898 318
117 iso_pu_bacteria 2916068649 2916073603 318
118 iso_pu_bacteria 2916076590 2916080929 318
119 iso_pu_bacteria 2921201388 2921205235 318
120 iso_pu_bacteria 2921237296 2921239943 318
121 iso_pu_bacteria 2921244191 2921245151 318
122 iso_pu_bacteria 2921250672 2921255918 318
123 iso_pu_bacteria 2921282425 2921286632 318
124 iso_pu_bacteria 2921289301 2921291891 318
125 iso_pu_bacteria 2921296804 2921298899 318
126 iso_pu_bacteria 2924144063 2924146101 318
127 iso_pu_bacteria 2924150972 2924153842 318
128 iso_pu_bacteria 2924158325 2924163559 318
129 iso_pu_bacteria 2924165586 2924165931 318
130 iso_pu_bacteria 2924179722 2924185624 318
131 iso_pu_bacteria 2924186466 2924191868 318
132 iso_pu_bacteria 2924193448 2924194242 318
133 iso_pu_bacteria 2924200457 2924202487 318
134 iso_pu_bacteria 2924207177 2924209719 318
135 iso_pu_bacteria 2924214083 2924215104 318
136 iso_pu_bacteria 2924221636 2924226430 318
137 iso_pu_bacteria 2924228884 2924232518 318
138 iso_pu_bacteria 2928521798 2928521880 318
139 iso_pu_bacteria 2936996657 2936999752 318
140 iso_pu_bacteria 2937002841 2937004996 318
141 iso_pu_bacteria 2937009748 2937011277 318
142 iso_pu_bacteria 2937016420 2937021029 318
143 iso_pu_bacteria 2937029754 2937034342 318
144 iso_pu_bacteria 2937036028 2937041117 318
145 iso_pu_bacteria 2937049772 2937053933 318
146 iso_pu_bacteria 2937056579 2937057644 318
147 iso_pu_bacteria 2937063883 2937070094 318
148 iso_pu_bacteria 2937071275 2937071469 318
149 iso_pu_bacteria 2937078374 2937083212 318
150 iso_pu_bacteria 2937084907 2937087452 318
151 iso_pu_bacteria 2937091812 2937097509 318
152 iso_pu_bacteria 2937098957 2937103383 318
153 iso_pu_bacteria 2937106411 2937112661 318
154 iso_pu_bacteria 2937113482 2937114616 318
155 iso_pu_bacteria 2937119839 2937122536 318
156 iso_pu_bacteria 2937126314 2937128413 318
157 iso_pu_bacteria 2954011201 2954014763 318
158 iso_pu_bacteria 2957375807 2957380429 318
159 iso_pu_bacteria 2957382221 2957383738 318
160 iso_pu_bacteria 2957388812 2957394132 318
161 iso_pu_bacteria 2957402308 2957403786 318
162 iso_pu_bacteria 2957408893 2957410987 318
163 iso_pu_bacteria 2957415311 2957421624 318
164 iso_pu_bacteria 2957422303 2957424944 318
165 iso_pu_bacteria 2957430029 2957435488 318
166 iso_pu_bacteria 2957437181 2957441998 318
167 iso_pu_bacteria 2957443900 2957447041 318
168 iso_pu_bacteria 2957450854 2957457379 318
169 iso_pu_bacteria 2957457609 2957464351 318
170 iso_pu_bacteria 2957464669 2957466133 318
171 iso_pu_bacteria 2957471148 2957473864 318
172 iso_pu_bacteria 2957484790 2957490230 318
173 iso_pu_bacteria 2957491536 2957496387 318
174 iso_pu_bacteria 2957498199 2957501966 318
175 iso_pu_bacteria 2957505466 2957511508 318
176 iso_pu_bacteria 2960584000 2960589104 318
177 iso_pu_bacteria 2960591022 2960595901 318
178 iso_pu_bacteria 2960597568 2960599688 318
179 iso_pu_bacteria 2960603979 2960605494 318
180 iso_pu_bacteria 2960610863 2960616984 318
181 iso_pu_bacteria 2960617483 2960621813 318
182 iso_pu_bacteria 2960624210 2960630270 318
183 iso_pu_bacteria 2960631154 2960636361 318
184 iso_pu_bacteria 2960637947 2960644740 318
185 iso_pu_bacteria 2960645483 2960651794 318
186 iso_pu_bacteria 2960652885 2960653214 318
187 iso_pu_bacteria 2960660292 2960660324 318
188 iso_pu_bacteria 2960667422 2960668375 318
189 iso_pu_bacteria 2960674078 2960675642 318
190 iso_pu_bacteria 2960680706 2960685514 318
191 iso_pu_bacteria 2960687367 2960691954 318
192 iso_pu_bacteria 2960693952 2960699543 318
193 iso_pu_bacteria 2964607997 2964609425 318
194 iso_pu_bacteria 2964621998 2964627439 318
195 iso_pu_bacteria 2964628898 2964634384 318
196 iso_pu_bacteria 2964636051 2964636358 318
197 iso_pu_bacteria 2964643177 2964648192 318
198 iso_pu_bacteria 2964649959 2964650396 318
199 iso_pu_bacteria 2964656573 2964660390 318
200 iso_pu_bacteria 2964663802 2964665864 318
201 iso_pu_bacteria 2964670856 2964675929 318
202 iso_pu_bacteria 2964678106 2964680671 318
203 iso_pu_bacteria 2964685014 2964687976 318
204 iso_pu_bacteria 2964691889 2964692990 318
205 iso_pu_bacteria 2964698721 2964700594 318
206 iso_pu_bacteria 2964705432 2964711287 318
207 iso_pu_bacteria 2964712639 2964714723 318
208 iso_pu_bacteria 2964719344 2964719840 318
209 iso_pu_bacteria 2967664464 2967670340 318
210 iso_pu_bacteria 2967671571 2967674287 318
211 iso_pu_bacteria 2967678726 2967685022 318
212 iso_pu_bacteria 2967686174 2967691371 318
213 iso_pu_bacteria 2967693043 2967695135 318
214 iso_pu_bacteria 2967699805 2967706859 318
215 iso_pu_bacteria 2967706974 2967712827 318
216 iso_pu_bacteria 2967714385 2967714727 318
217 iso_pu_bacteria 2967721400 2967724219 318
218 iso_pu_bacteria 2967728569 2967733569 318
219 iso_pu_bacteria 2967735183 2967736266 318
220 iso_pu_bacteria 2967742019 2967744040 318
221 iso_pu_bacteria 2967748971 2967751796 318
222 iso_pu_bacteria 2967762386 2967762622 318
223 iso_pu_bacteria 2967769361 2967771253 318
224 iso_pu_bacteria 2970019648 2970025647 318
225 iso_pu_bacteria 2970026789 2970032446 318
226 iso_pu_bacteria 2970033650 2970033971 318
227 iso_pu_bacteria 2970040964 2970045554 318
228 iso_pu_bacteria 2970047711 2970052567 318
229 iso_pu_bacteria 2970054988 2970057369 318
230 iso_pu_bacteria 2970061556 2970068063 318
231 iso_pu_bacteria 2970068827 2970071419 318
232 iso_pu_bacteria 2970076120 2970080547 318
233 iso_pu_bacteria 2970082768 2970086067 318
234 iso_pu_bacteria 2970088815 2970091224 318
235 iso_pu_bacteria 2970095765 2970101564 318
236 iso_pu_bacteria 2970109326 2970115998 318
237 iso_pu_bacteria 2970116247 2970118463 318
238 iso_pu_bacteria 2970122695 2970127538 318
239 iso_pu_bacteria 2970129317 2970131633 318
240 iso_pu_bacteria 2970136068 2970136512 318
241 iso_pu_bacteria 2970143518 2970148466 318
242 iso_pu_bacteria 2970149975 2970153953 318
243 iso_pu_bacteria 2970156795 2970162692 318
244 iso_pu_bacteria 2970164137 2970167658 318
245 iso_pu_bacteria 2970170962 2970174214 318
246 iso_pu_bacteria 2970177841 2970181813 318
247 iso_pu_bacteria 2970184632 2970190516 318
248 iso_pu_bacteria 2970191845 2970194968 318
249 iso_pu_bacteria 2977516862 2977518943 318
250 iso_pu_bacteria 2977523885 2977529073 318
251 iso_pu_bacteria 2977530762 2977536181 318
252 iso_pu_bacteria 2977537788 2977540038 318
253 iso_pu_bacteria 2977544691 2977545131 318
254 iso_pu_bacteria 2977551784 2977552865 318
255 iso_pu_bacteria 2977558990 2977559229 318
256 iso_pu_bacteria 2977565890 2977567571 318
257 iso_pu_bacteria 2977572785 2977573095 318
258 iso_pu_bacteria 2977579622 2977580502 318
259 iso_pu_bacteria 648276728 648739421 318
260 iso_pu_bacteria 8003992118 8003992525 318
261 iso_pu_bacteria 8003999396 8003999853 318
262 3300036712 Ga0316584_0170300 Ga0316584_0170300_571_1539 319
263 3300049776 Ga0501280_002004 Ga0501280_002004_1297_2265 319
264 3300049776 Ga0501280_005559 Ga0501280_005559_805_1773 319
265 iso_pu_bacteria 2508501122 2509107154 319
266 iso_pu_bacteria 2509276019 2509374881 319
267 iso_pu_bacteria 2516143018 2516208512 319
268 iso_pu_bacteria 2558860100 2558863873 319
269 iso_pu_bacteria 2582581294 2585203716 319
270 iso_pu_bacteria 2643221637 2644206643 319
271 iso_pu_bacteria 2643221718 2644650290 319
272 iso_pu_bacteria 2657244999 2657681949 319
273 iso_pu_bacteria 2690316117 2692317207 319
274 iso_pu_bacteria 2802429268 2804750968 319
275 iso_pu_bacteria 2838736955 2838739284 319
276 iso_pu_bacteria 2841840854 2841843182 319
277 iso_pu_bacteria 2842140634 2842142964 319
278 iso_pu_bacteria 2847417321 2847417725 319
279 iso_pu_bacteria 2848992105 2848992570 319
280 iso_pu_bacteria 2850079185 2850080089 319
281 iso_pu_bacteria 2855872281 2855873125 319
282 iso_pu_bacteria 2857531043 2857531247 319
283 iso_pu_bacteria 2989771324 2989774004 319
284 3300025284 Ga0209130_1012451 Ga0209130_10124512 320
285 iso_pu_bacteria 2509276033 2509443932 320
286 iso_pu_bacteria 2510461069 2510841763 320
287 iso_pu_bacteria 2510917028 2511185646 320
288 iso_pu_bacteria 2510917030 2511196785 320
289 iso_pu_bacteria 2513237144 2513910408 320
290 iso_pu_bacteria 2515075009 2515110454 320
291 iso_pu_bacteria 2519899620 2520380035 320
292 iso_pu_bacteria 2534681796 2535515134 320
293 iso_pu_bacteria 2537561587 2537872848 320
294 iso_pu_bacteria 2582581298 2585227108 320
295 iso_pu_bacteria 2582581304 2585259534 320
296 iso_pu_bacteria 2582581867 2585398510 320
297 iso_pu_bacteria 2585427528 2585539746 320
298 iso_pu_bacteria 2585427529 2585550467 320
299 iso_pu_bacteria 2585427593 2585837731 320
300 iso_pu_bacteria 2585427594 2585844611 320
301 iso_pu_bacteria 2643221599 2644007391 320
302 iso_pu_bacteria 2643221634 2644190641 320
303 iso_pu_bacteria 2718217882 2719179625 320
304 iso_pu_bacteria 2718217997 2719663969 320
305 iso_pu_bacteria 2718218009 2719730295 320
306 iso_pu_bacteria 2718218199 2720490388 320
307 iso_pu_bacteria 2718218363 2721145718 320
308 iso_pu_bacteria 2718218365 2721157250 320
309 iso_pu_bacteria 2718218366 2721162597 320
310 iso_pu_bacteria 2721755514 2722838767 320
311 iso_pu_bacteria 2721755810 2724043051 320
312 iso_pu_bacteria 2728369365 2730162862 320
313 iso_pu_bacteria 2728369397 2730296882 320
314 iso_pu_bacteria 2738541293 2738803792 320
315 iso_pu_bacteria 2738541333 2739034607 320
316 iso_pu_bacteria 2791355259 2793315374 320
317 iso_pu_bacteria 2791355261 2793326100 320
318 iso_pu_bacteria 2791355262 2793332485 320
319 iso_pu_bacteria 2791355265 2793353325 320
320 iso_pu_bacteria 2791355266 2793362718 320
321 iso_pu_bacteria 2791355267 2793364728 320
322 iso_pu_bacteria 2802429605 2805927530 320
323 iso_pu_bacteria 2802429633 2806043904 320
324 iso_pu_bacteria 2802429635 2806058579 320
325 iso_pu_bacteria 2802429636 2806067076 320
326 iso_pu_bacteria 2802429637 2806074820 320
327 iso_pu_bacteria 2838016132 2838022178 320
328 iso_pu_bacteria 2838042994 2838044363 320
329 iso_pu_bacteria 2838048938 2838051421 320
330 iso_pu_bacteria 2838061910 2838066634 320
331 iso_pu_bacteria 2838068647 2838073687 320
332 iso_pu_bacteria 2838668709 2838672339 320
333 iso_pu_bacteria 2838680041 2838680639 320
334 iso_pu_bacteria 2838694306 2838695328 320
335 iso_pu_bacteria 2838701080 2838703918 320
336 iso_pu_bacteria 2838707686 2838708704 320
337 iso_pu_bacteria 2841864319 2841866758 320
338 iso_pu_bacteria 2842077413 2842080061 320
339 iso_pu_bacteria 2842118031 2842120681 320
340 iso_pu_bacteria 2842146304 2842148290 320
341 iso_pu_bacteria 2842192696 2842192958 320
342 iso_pu_bacteria 2842205361 2842206874 320
343 iso_pu_bacteria 2842237096 2842238116 320
344 iso_pu_bacteria 2842250916 2842253355 320
345 iso_pu_bacteria 2842278818 2842280433 320
346 iso_pu_bacteria 2842285085 2842289380 320
347 iso_pu_bacteria 2842291075 2842293721 320
348 iso_pu_bacteria 2842311132 2842312569 320
349 iso_pu_bacteria 2842317721 2842322602 320
350 iso_pu_bacteria 2842370503 2842371102 320
351 iso_pu_bacteria 2842377471 2842380118 320
352 iso_pu_bacteria 2842384541 2842387189 320
353 iso_pu_bacteria 2842402390 2842406728 320
354 iso_pu_bacteria 2842409023 2842413776 320
355 iso_pu_bacteria 2842415677 2842420262 320
356 iso_pu_bacteria 2842422224 2842427135 320
357 iso_pu_bacteria 2842447887 2842450257 320
358 iso_pu_bacteria 2842489311 2842492405 320
359 iso_pu_bacteria 2842495871 2842501964 320
360 iso_pu_bacteria 2899803654 2899804460 320
361 iso_pu_bacteria 2919100787 2919101297 320
362 iso_pu_bacteria 2923556063 2923557236 320
363 iso_pu_bacteria 2933599457 2933604115 320
364 iso_pu_bacteria 2935894831 2935895851 320
365 iso_pu_bacteria 2996893221 2996893512 320
366 iso_pu_bacteria 3005452660 3005452877 320
367 iso_pu_bacteria 8005282627 8005283635 320
368 iso_pu_bacteria 8005289223 8005291025 320
369 iso_pu_bacteria 8005301065 8005303900 320
370 iso_pu_bacteria 8005382845 8005387237 320
371 iso_pu_bacteria 8005395548 8005401996 320
372 iso_pu_bacteria 8005460587 8005461093 320
373 iso_pu_bacteria 8005542996 8005543809 320
374 iso_pu_bacteria 8005556819 8005560687 320
375 iso_pu_bacteria 8005563573 8005569669 320
376 iso_pu_bacteria 8005570704 8005576982 320
377 iso_pu_bacteria 8005626139 8005628503 320
378 iso_pu_bacteria 8005688590 8005690328 320
379 iso_pu_bacteria 8018127388 8018133185 320
380 iso_pu_bacteria 8018176218 8018182075 320
381 iso_pu_bacteria 8024501048 8024503622 320
382 iso_pu_bacteria 8056375014 8056375685 320
383 iso_pu_bacteria 8056382006 8056386010 320
384 3300021321 Ga0214542_1000011 Ga0214542_1000011216 321
385 3300021327 Ga0214543_1000004 Ga0214543_1000004284 321
386 3300022739 Ga0228711_1001272 Ga0228711_100127231 321
387 3300022740 Ga0228710_1001367 Ga0228710_100136731 321
388 3300027111 Ga0209281_1000629 Ga0209281_100062933 321
389 3300027111 Ga0209281_1000665 Ga0209281_10006654 321
390 3300027666 Ga0209282_1000172 Ga0209282_100017231 321
391 3300028794 Ga0307515_10001722 Ga0307515_1000172225 321
392 3300031548 Ga0307408_100151144 Ga0307408_1001511441 321
393 3300031967 Ga0315914_1001342 Ga0315914_100134231 321
394 3300032002 Ga0307416_100067065 Ga0307416_1000670652 321
395 3300033430 Ga0315913_1000452 Ga0315913_10004523 321
396 3300033464 Ga0315915_1000691 Ga0315915_100069132 321
397 iso_pu_bacteria 2643221653 2644297529 321
398 iso_pu_bacteria 2643221719 2644655782 321
399 iso_pu_bacteria 2775507049 2776912178 321
400 iso_pu_bacteria 2989776772 2989777554 321
401 iso_pu_bacteria 8005658619 8005660418 321
402 iso_pu_bacteria 8054558443 8054563428 321
403 3300002773 JGI25152J39213_1003296 JGI25152J39213_10032962 322
404 3300003771 Ga0055526_1030776 Ga0055526_10307762 322
405 3300003790 Ga0055528_1033589 Ga0055528_10335891 322
406 3300005355 Ga0070671_100016028 Ga0070671_1000160282 322
407 3300021327 Ga0214543_1000003 Ga0214543_100000382 322
408 3300025258 Ga0209129_1004270 Ga0209129_10042705 322
409 3300025273 Ga0209673_1002894 Ga0209673_10028942 322
410 3300025294 Ga0209025_1008383 Ga0209025_10083832 322
411 3300025299 Ga0209256_1006061 Ga0209256_10060616 322
412 3300025302 Ga0207426_1001284 Ga0207426_100128411 322
413 3300025904 Ga0207647_10076193 Ga0207647_100761932 322
414 3300025972 Ga0207668_10277893 Ga0207668_102778931 322
415 3300041456 Ga0451795_1430566 Ga0451795_1430566_516_1502 322
416 3300053122 Ga0500608_079518 Ga0500608_079518_159_1136 322
417 3300053156 Ga0500622_0000644 Ga0500622_0000644_1410_2387 322
418 iso_pu_bacteria 2582581283 2585165049 322
419 iso_pu_bacteria 2582581865 2585387759 322
420 iso_pu_bacteria 2643221607 2644047532 322
421 iso_pu_bacteria 2643221618 2644103132 322
422 iso_pu_bacteria 2643221626 2644151938 322
423 iso_pu_bacteria 2643221636 2644205998 322
424 iso_pu_bacteria 2643221655 2644306059 322
425 iso_pu_bacteria 2643221659 2644330367 322
426 iso_pu_bacteria 2643221686 2644480999 322
427 iso_pu_bacteria 2643221689 2644496693 322
428 iso_pu_bacteria 2643221698 2644542886 322
429 iso_pu_bacteria 2643221712 2644618990 322
430 iso_pu_bacteria 2818991272 2819243190 322
431 iso_pu_bacteria 2844163670 2844170700 322
432 iso_pu_bacteria 2941499720 2941500663 322
433 iso_pu_bacteria 8005246636 8005247283 322
434 3300002739 JGI25158J39367_1000091 JGI25158J39367_10000918 323
435 3300002773 JGI25152J39213_1005777 JGI25152J39213_10057773 323
436 3300002987 JGI25159J45721_1000452 JGI25159J45721_100045210 323
437 3300003187 JGI25151J46595_10000250 JGI25151J46595_1000025029 323
438 3300003187 JGI25151J46595_10003372 JGI25151J46595_100033727 323
439 3300003215 JGI25153J46596_10013500 JGI25153J46596_100135002 323
440 3300003322 rootL2_10161986 rootL2_101619861 323
441 3300003323 rootH1_10196940 rootH1_101969401 323
442 3300003354 JGI25160J50197_1005755 JGI25160J50197_10057552 323
443 3300003374 JGI25161J50226_1000074 JGI25161J50226_100007456 323
444 3300003374 JGI25161J50226_1001359 JGI25161J50226_10013594 323
445 3300003771 Ga0055526_1002214 Ga0055526_100221414 323
446 3300003771 Ga0055526_1005759 Ga0055526_10057594 323
447 3300003790 Ga0055528_1002867 Ga0055528_10028674 323
448 3300003790 Ga0055528_1018107 Ga0055528_10181072 323
449 3300003790 Ga0055528_1024591 Ga0055528_10245911 323
450 3300003792 Ga0055540_1000111 Ga0055540_100011152 323
451 3300003792 Ga0055540_1010213 Ga0055540_10102132 323
452 3300004625 Ga0055543_1000188 Ga0055543_100018829 323
453 3300004625 Ga0055543_1002371 Ga0055543_10023714 323
454 3300005262 Ga0065165_1027683 Ga0065165_10276832 323
455 3300006042 Ga0075368_10069955 Ga0075368_100699551 323
456 3300009765 Ga0123341_1000175 Ga0123341_100017523 323
457 3300025208 Ga0209436_100650 Ga0209436_10065018 323
458 3300025258 Ga0209129_1000123 Ga0209129_100012388 323
459 3300025258 Ga0209129_1000261 Ga0209129_100026152 323
460 3300025258 Ga0209129_1000316 Ga0209129_100031641 323
461 3300025273 Ga0209673_1000015 Ga0209673_1000015327 323
462 3300025273 Ga0209673_1000091 Ga0209673_1000091189 323
463 3300025273 Ga0209673_1000919 Ga0209673_10009195 323
464 3300025273 Ga0209673_1003237 Ga0209673_10032378 323
465 3300025284 Ga0209130_1000002 Ga0209130_100000225 323
466 3300025292 Ga0209676_1023395 Ga0209676_10233952 323
467 3300025294 Ga0209025_1000407 Ga0209025_100040742 323
468 3300025294 Ga0209025_1003038 Ga0209025_100303811 323
469 3300025294 Ga0209025_1006436 Ga0209025_10064364 323
470 3300025295 Ga0209564_1000845 Ga0209564_10008458 323
471 3300025295 Ga0209564_1001820 Ga0209564_100182019 323
472 3300025295 Ga0209564_1006326 Ga0209564_10063262 323
473 3300025297 Ga0209758_1000336 Ga0209758_100033646 323
474 3300025297 Ga0209758_1000877 Ga0209758_100087741 323
475 3300025299 Ga0209256_1002068 Ga0209256_10020688 323
476 3300025299 Ga0209256_1002341 Ga0209256_100234118 323
477 3300025299 Ga0209256_1007494 Ga0209256_10074945 323
478 3300025299 Ga0209256_1025746 Ga0209256_10257462 323
479 3300025302 Ga0207426_1000013 Ga0207426_100001325 323
480 3300025302 Ga0207426_1000172 Ga0207426_1000172143 323
481 3300025303 Ga0209051_1000084 Ga0209051_100008483 323
482 3300025303 Ga0209051_1001391 Ga0209051_10013915 323
483 3300025304 Ga0209257_1005200 Ga0209257_10052004 323
484 3300031901 Ga0307406_10007930 Ga0307406_100079301 323
485 3300042007 Ga0439449_0031793 Ga0439449_0031793_393_1379 323
486 3300046507 Ga0495606_0113529 Ga0495606_0113529_370_1362 323
487 3300046522 Ga0495643_0014063 Ga0495643_0014063_2998_3990 323
488 3300046660 Ga0495625_0183288 Ga0495625_0183288_114_1106 323
489 3300046691 Ga0495670_0069405 Ga0495670_0069405_233_1225 323
490 3300046694 Ga0495649_0012442 Ga0495649_0012442_626_1618 323
491 3300047320 Ga0495672_0039358 Ga0495672_0039358_315_1316 323
492 3300047470 Ga0495681_0088574 Ga0495681_0088574_97_1089 323
493 3300047472 Ga0495686_0173570 Ga0495686_0173570_120_1112 323
494 3300048090 Ga0495615_0022047 Ga0495615_0022047_45_1037 323
495 3300048909 Ga0496106_0000259 Ga0496106_0000259_12709_13701 323
496 3300048919 Ga0496116_0037829 Ga0496116_0037829_1052_2044 323
497 3300048919 Ga0496116_0117512 Ga0496116_0117512_150_1196 323
498 3300048920 Ga0496117_0035137 Ga0496117_0035137_115_1161 323
499 3300048920 Ga0496117_0049643 Ga0496117_0049643_1796_2788 323
500 3300048921 Ga0496118_0176433 Ga0496118_0176433_198_1244 323
501 3300048924 Ga0496121_0029801 Ga0496121_0029801_1459_2451 323
502 3300048925 Ga0496122_0124793 Ga0496122_0124793_296_1342 323
503 3300048926 Ga0496123_0089780 Ga0496123_0089780_114_1160 323
504 3300048927 Ga0496124_0006765 Ga0496124_0006765_412_1458 323
505 3300048927 Ga0496124_0095480 Ga0496124_0095480_1122_2114 323
506 3300048928 Ga0496125_0038012 Ga0496125_0038012_2827_3819 323
507 3300048928 Ga0496125_0176139 Ga0496125_0176139_49_1038 323
508 3300050492 nmdc:mga0yw44_131648_c1 nmdc:mga0yw44_131648_c1_328_1320 323
509 3300050493 nmdc:mga0k408_52535_c2 nmdc:mga0k408_52535_c2_258_1250 323
510 3300050516 nmdc:mga0sz30_13742_c1 nmdc:mga0sz30_13742_c1_1766_2758 323
511 3300053093 Ga0500651_0107524 Ga0500651_0107524_389_1381 323
512 3300053139 Ga0500568_0001043 Ga0500568_0001043_11393_12385 323
513 3300053139 Ga0500568_0001239 Ga0500568_0001239_1573_2574 323
514 3300053139 Ga0500568_0074897 Ga0500568_0074897_135_1127 323
515 3300053153 Ga0500616_0002540 Ga0500616_0002540_10467_11468 323
516 3300053156 Ga0500622_0000348 Ga0500622_0000348_42762_43754 323
517 3300053156 Ga0500622_0085578 Ga0500622_0085578_437_1429 323
518 3300053160 Ga0500633_0026574 Ga0500633_0026574_482_1474 323
519 iso_pu_bacteria 2599185156 2599333090 323
520 iso_pu_bacteria 2721755823 2724108709 323
521 iso_pu_bacteria 2802429606 2805932315 323
522 iso_pu_bacteria 2842198810 2842200306 323
523 iso_pu_bacteria 2842922631 2842923393 323
524 iso_pu_bacteria 3003930520 3003932140 323
525 iso_pu_bacteria 8005430974 8005432987 323
526 3300015690 Ga0183363_1147 Ga0183363_11475 324
527 3300048924 Ga0496121_0016422 Ga0496121_0016422_1398_2393 324
528 iso_pu_bacteria 2738541317 2738945618 324
529 iso_pu_bacteria 2913308742 2913310703 324
530 iso_pu_bacteria 2989349275 2989355467 324
531 3300025297 Ga0209758_1033753 Ga0209758_10337532 325
532 3300028794 Ga0307515_10000154 Ga0307515_1000015412 325
533 3300028794 Ga0307515_10004744 Ga0307515_1000474421 325
534 3300041413 Ga0439465_0013711 Ga0439465_0013711_205_1197 325
535 3300042531 Ga0450918_001138 Ga0450918_001138_3835_4827 325
536 3300048919 Ga0496116_0000080 Ga0496116_0000080_34542_35528 325
537 3300048929 Ga0496126_0000094 Ga0496126_0000094_18002_18988 325
538 iso_pu_bacteria 2643221568 2643856328 325
539 iso_pu_bacteria 2818991461 2819684658 325
540 iso_pu_bacteria 2854896431 2854898336 325
541 iso_pu_bacteria 2854916844 2854919049 325
542 iso_pu_bacteria 2891373044 2891376210 325
543 iso_pu_bacteria 2919166419 2919166905 325
544 iso_pu_bacteria 2919171160 2919172018 325
545 iso_pu_bacteria 2978969890 2978973322 325
546 iso_pu_bacteria 2984587000 2984591603 325
547 iso_pu_bacteria 8056875544 8056879183 325
548 iso_pu_bacteria 2554235003 2554246651 326
549 iso_pu_bacteria 2558860242 2559293879 326
550 iso_pu_bacteria 2599185210 2599605427 326
551 iso_pu_bacteria 2600255279 2601609149 326
552 iso_pu_bacteria 2600255308 2601745924 326
553 iso_pu_bacteria 2643221582 2643921134 326
554 iso_pu_bacteria 2643221693 2644519207 326
555 iso_pu_bacteria 2808606387 2808986345 326
556 iso_pu_bacteria 2818991439 2819556477 326
557 iso_pu_bacteria 2838675328 2838677206 326
558 iso_pu_bacteria 2838714209 2838716094 326
559 iso_pu_bacteria 2838719591 2838720106 326
560 iso_pu_bacteria 2838724970 2838726846 326
561 iso_pu_bacteria 2841846520 2841847040 326
562 iso_pu_bacteria 2841859092 2841860431 326
563 iso_pu_bacteria 2842124991 2842126931 326
564 iso_pu_bacteria 2842130223 2842132099 326
565 iso_pu_bacteria 2842152218 2842152732 326
566 iso_pu_bacteria 2842170452 2842172339 326
567 iso_pu_bacteria 2842175837 2842176351 326
568 iso_pu_bacteria 2842187318 2842189201 326
569 iso_pu_bacteria 2842211629 2842213515 326
570 iso_pu_bacteria 2842224351 2842224867 326
571 iso_pu_bacteria 2842515876 2842517216 326
572 iso_pu_bacteria 2855839649 2855840113 326
573 iso_pu_bacteria 2899792073 2899792497 326
574 iso_pu_bacteria 2899845264 2899847914 326
575 iso_pu_bacteria 2919114240 2919116297 326
576 iso_pu_bacteria 2926754445 2926757251 326
577 iso_pu_bacteria 2926760298 2926761465 326
578 iso_pu_bacteria 2929138655 2929139002 326
579 iso_pu_bacteria 2933006813 2933007377 326
580 iso_pu_bacteria 2933011516 2933012141 326
581 iso_pu_bacteria 2933594066 2933594586 326
582 iso_pu_bacteria 2979089926 2979093247 326
583 iso_pu_bacteria 2979095461 2979099365 326
584 iso_pu_bacteria 2979100975 2979105217 326
585 iso_pu_bacteria 2984509177 2984512927 326
586 iso_pu_bacteria 2984518228 2984520709 326
587 iso_pu_bacteria 2984537506 2984540001 326
588 iso_pu_bacteria 2984601300 2984602192 326
589 iso_pu_bacteria 8003570095 8003572701 326
590 3300049573 Ga0501037_0075456 Ga0501037_0075456_1333_2382 327
591 3300049824 Ga0501045_0084430 Ga0501045_0084430_1177_2226 327
592 3300003187 JGI25151J46595_10003625 JGI25151J46595_100036255 328
593 3300005366 Ga0070659_100183812 Ga0070659_1001838122 328
594 3300025294 Ga0209025_1000469 Ga0209025_100046933 328
595 3300048919 Ga0496116_0128357 Ga0496116_0128357_128_1129 328
596 3300048920 Ga0496117_0000732 Ga0496117_0000732_14245_15246 328
597 3300048924 Ga0496121_0209152 Ga0496121_0209152_324_1325 328
598 3300048925 Ga0496122_0000247 Ga0496122_0000247_13769_14791 328
599 3300048926 Ga0496123_0000222 Ga0496123_0000222_13430_14452 328
600 3300048927 Ga0496124_0000704 Ga0496124_0000704_5587_6588 328
601 3300048928 Ga0496125_0014312 Ga0496125_0014312_6037_7059 328
602 3300048929 Ga0496126_0006808 Ga0496126_0006808_10410_11411 328
603 3300003791 Ga0055530_10014572 Ga0055530_100145722 329
604 3300003856 Ga0058692_1002656 Ga0058692_10026561 329
605 3300003856 Ga0058692_1002911 Ga0058692_10029112 329
606 3300005262 Ga0065165_1012507 Ga0065165_10125072 329
607 3300006178 Ga0075367_10092128 Ga0075367_100921281 329
608 3300006186 Ga0075369_10060632 Ga0075369_100606322 329
609 3300006948 Ga0099826_10018831 Ga0099826_100188314 329
610 3300025292 Ga0209676_1015012 Ga0209676_10150122 329
611 3300025294 Ga0209025_1000441 Ga0209025_100044175 329
612 3300025297 Ga0209758_1000602 Ga0209758_100060235 329
613 3300025303 Ga0209051_1009000 Ga0209051_10090005 329
614 3300025304 Ga0209257_1002244 Ga0209257_10022446 329
615 3300027312 Ga0209371_1000009 Ga0209371_1000009419 329
616 3300027312 Ga0209371_1000547 Ga0209371_100054730 329
617 3300027666 Ga0209282_1000224 Ga0209282_100022421 329
618 3300030500 Ga0268256_1000010 Ga0268256_1000010418 329
619 3300030500 Ga0268256_1009008 Ga0268256_10090081 329
620 3300046558 Ga0495633_0017399 Ga0495633_0017399_1151_2155 329
621 3300046674 Ga0495588_0004349 Ga0495588_0004349_3207_4211 329
622 3300047470 Ga0495681_0002944 Ga0495681_0002944_3314_4318 329
623 3300048907 Ga0496104_0206555 Ga0496104_0206555_310_1311 329
624 3300048920 Ga0496117_0174685 Ga0496117_0174685_231_1232 329
625 3300048921 Ga0496118_0024440 Ga0496118_0024440_341_1342 329
626 3300048921 Ga0496118_0028580 Ga0496118_0028580_2367_3368 329
627 3300048922 Ga0496119_0006263 Ga0496119_0006263_4006_5007 329
628 3300048923 Ga0496120_0007965 Ga0496120_0007965_5965_6966 329
629 3300048924 Ga0496121_0000001 Ga0496121_0000001_458824_459825 329
630 3300048925 Ga0496122_0000009 Ga0496122_0000009_468826_469815 329
631 3300048925 Ga0496122_0014835 Ga0496122_0014835_5085_6086 329
632 3300048926 Ga0496123_0000020 Ga0496123_0000020_273384_274373 329
633 3300048926 Ga0496123_0035198 Ga0496123_0035198_2373_3374 329
634 3300048927 Ga0496124_0000063 Ga0496124_0000063_79523_80524 329
635 3300048927 Ga0496124_0025767 Ga0496124_0025767_70_1059 329
636 3300048927 Ga0496124_0303439 Ga0496124_0303439_73_1074 329
637 3300048928 Ga0496125_0000001 Ga0496125_0000001_570877_571878 329
638 3300048928 Ga0496125_0011912 Ga0496125_0011912_1747_2748 329
639 3300048929 Ga0496126_0198663 Ga0496126_0198663_617_1618 329
640 3300050491 nmdc:mga00v17_36276_c1 nmdc:mga00v17_36276_c1_265_1266 329
641 3300050494 nmdc:mga06z11_87426_c1 nmdc:mga06z11_87426_c1_77_1078 329
642 3300050516 nmdc:mga0sz30_82645_c1 nmdc:mga0sz30_82645_c1_128_1132 329
643 3300053107 Ga0500560_001584 Ga0500560_001584_805_1809 329
644 3300053107 Ga0500560_047081 Ga0500560_047081_104_1108 329
645 3300053111 Ga0500572_005116 Ga0500572_005116_861_1862 329
646 3300053125 Ga0500618_000151 Ga0500618_000151_47225_48214 329
647 3300053177 Ga0500636_0007563 Ga0500636_0007563_3799_4800 329
648 iso_pu_bacteria 2599185236 2599719512 329
649 iso_pu_bacteria 2643221558 2643810500 329
650 iso_pu_bacteria 2821123053 2821123685 329
651 iso_pu_bacteria 650716007 650739069 329
652 iso_pu_bacteria 8018150411 8018152003 329
653 3300053161 Ga0500634_0001572 Ga0500634_0001572_4929_5933 331
654 2010549000 RicEn_C3453 RicEn_62480 333
655 3300006051 Ga0075364_10003332 Ga0075364_100033327 333
656 3300006946 Ga0079104_1000069 Ga0079104_100006975 333
657 3300027111 Ga0209281_1000192 Ga0209281_100019241 333
658 3300048914 Ga0496111_0098186 Ga0496111_0098186_35_1039 333
659 3300048924 Ga0496121_0000581 Ga0496121_0000581_37973_38995 333
660 3300048924 Ga0496121_0009527 Ga0496121_0009527_8330_9334 333
661 3300048925 Ga0496122_0018592 Ga0496122_0018592_1503_2507 333
662 3300048926 Ga0496123_0015313 Ga0496123_0015313_27_1031 333
663 3300048927 Ga0496124_0068146 Ga0496124_0068146_783_1787 333
664 3300050491 nmdc:mga00v17_133_c2 nmdc:mga00v17_133_c2_30503_31525 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

166

351

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.9352 51 331
1p9e-assembly1.cif.gz_A crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 0.9112 46 329
4xuk-assembly1.cif.gz_B crystal structure of hydrolase aboph in beta lactamase superfamily 0.9112 52 328
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.9102 51 331
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.9052 50 328
ID Description Score Start End Superfamily
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9185 48 328 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9164 52 328 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8882 34 329 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8871 34 328 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8791 48 328 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2V5AL04-F1-model_v4 deleted 0.9823 118 333
AF-A0A6A8A903-F1-model_v4 MBL fold metallo-hydrolase 0.9798 159 333 GO:0016787
AF-A0A4Q4CJR5-F1-model_v4 MBL fold metallo-hydrolase 0.9754 225 328 GO:0016787
AF-A0A6A8A903-F1-model_v4 MBL fold metallo-hydrolase 0.9743 159 333 GO:0016787
AF-A0A2V5AL04-F1-model_v4 deleted 0.9734 118 333

Feature Viewer

pLDDT pTM Quality
85.05 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map