F473285

General Info

Members Datasets Scaffolds Average Seq Length
659 291 580 163

Family's Representative Sequence

Representative Sequence 3300049460|Ga0495682_0028854|Ga0495682_0028854_298_873
Length 191
Sequence MRQRRIIVAVSIIHKDEGDQLHMPDHASLPCYRDIVRTEWVDYNGHLRDAFYMLIFSFATDVLIDVIGLPDAVRKERGRSIYTLEAHINYLHEIKEGTQVRVDMRVLGHDAKRLHLYLEMFADDGVEPVAAGEQMLLHVDTGGPRAIAFDPDVEAHVRALAQAHTVLPAPSFAGRVIGLPVKTPPHGSAHA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
5 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
6 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
7 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
8 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
9 2519103095 Burkholderia sp. KJ006 Isolate Nodule
10 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
11 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
12 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
13 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
14 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
15 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
16 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
17 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
18 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
19 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
20 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
21 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
22 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
23 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
24 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
25 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
26 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
27 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
28 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
29 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
30 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
31 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
32 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
33 2765235841 Pseudomonas putida AA7 Isolate Unclassified
34 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
35 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
36 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
37 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
38 2818991450 Burkholderia sp. 604 Isolate Unclassified
39 2818991452 Burkholderia cepacia 561 Isolate Unclassified
40 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
41 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
42 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
43 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
44 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
45 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
46 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
47 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
48 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
49 2904564687 Burkholderia sp. 571 Isolate Unclassified
50 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
51 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
52 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
53 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
54 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
55 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
56 2928163908 Burkholderia sp. 567 Isolate Unclassified
57 2928170801 Burkholderia sp. 572 Isolate Unclassified
58 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
59 2928536128 Burkholderia sola 565 Isolate Unclassified
60 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
61 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
62 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
63 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
64 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
65 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
68 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
69 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
70 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
71 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
153 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
154 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
273 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
274 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
275 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
276 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
277 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
278 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
279 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
280 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
281 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
282 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
283 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
284 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
285 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
286 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
287 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
288 8052494512 Pseudomonas putida LD6 Isolate Unclassified
289 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
290 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
291 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.01
Metatranscriptomes 0
Isolates 11.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 2.88
Rhizoplane 4.86
Rhizosphere 70.56
Stem 0
Stem Tuber 0
Unclassified 14.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2477539 2162886007 Bacteria 3896
2 JGI24739J22299_10029706 3300001989 Bacteria 1898
3 JGI24739J22299_10086848 3300001989 Bacteria 955
4 JGI25156J39149_1000131 3300002705 Bacteria 54470
5 JGI25156J39149_1024773 3300002705 Bacteria 975
6 JGI25165J46597_1001102 3300003214 Bacteria 17203
7 rootL2_10118523 3300003322 Bacteria 3884
8 rootL2_10220132 3300003322 Bacteria 2265
9 JGI25160J50197_1000362 3300003354 Bacteria 29800
10 Ga0055533_1000184 3300003756 Bacteria 52247
11 Ga0055533_1000333 3300003756 Bacteria 20773
12 Ga0055532_1000007 3300003758 Bacteria 429810
13 Ga0055532_1000269 3300003758 Bacteria 33980
14 Ga0055527_1000007 3300003760 Bacteria 429810
15 Ga0055527_1000228 3300003760 Bacteria 35654
16 Ga0055527_1000301 3300003760 Bacteria 27947
17 Ga0055535_1000005 3300003761 Bacteria 429810
18 Ga0055535_1000489 3300003761 Bacteria 35654
19 Ga0055535_1000540 3300003761 Bacteria 32548
20 Ga0055542_1000008 3300003762 Bacteria 429810
21 Ga0055542_1000555 3300003762 Bacteria 33003
22 Ga0055542_1003229 3300003762 Bacteria 4563
23 Ga0055529_1000005 3300003763 Bacteria 429810
24 Ga0055529_1000530 3300003763 Bacteria 33003
25 Ga0055528_1016968 3300003790 Bacteria 2545
26 Ga0065165_1001204 3300005262 Bacteria 29862
27 Ga0065704_10072329 3300005289 Bacteria 8730
28 Ga0065704_10163262 3300005289 Bacteria 1322
29 Ga0065704_10299613 3300005289 Bacteria 888
30 Ga0070658_10090326 3300005327 Bacteria 2524
31 Ga0070658_10146896 3300005327 Bacteria 1972
32 Ga0070658_11002829 3300005327 Bacteria 726
33 Ga0070683_100106523 3300005329 Bacteria 2643
34 Ga0070683_101741312 3300005329 Bacteria 599
35 Ga0070660_100000006 3300005339 Bacteria 166714
36 Ga0070660_100001980 3300005339 Bacteria 14140
37 Ga0070659_100000078 3300005366 Bacteria 74646
38 Ga0070684_100345447 3300005535 Bacteria 1368
39 Ga0068855_100002506 3300005563 Bacteria 22615
40 Ga0068855_100060864 3300005563 Bacteria 4413
41 Ga0070664_100980473 3300005564 Bacteria 794
42 Ga0068856_100146283 3300005614 Bacteria 2371
43 Ga0068852_100274052 3300005616 Bacteria 1624
44 Ga0099823_1000137 3300006944 Bacteria 37992
45 Ga0099823_1035496 3300006944 Bacteria 3886
46 Ga0105251_10000085 3300009011 Bacteria 89249
47 Ga0105251_10000698 3300009011 Bacteria 30976
48 Ga0105251_10001725 3300009011 Bacteria 18295
49 Ga0105251_10017437 3300009011 Bacteria 3848
50 Ga0105251_10020896 3300009011 Bacteria 3430
51 Ga0105251_10158469 3300009011 Bacteria 1021
52 Ga0105244_10003582 3300009036 Bacteria 11038
53 Ga0105244_10011314 3300009036 Bacteria 5361
54 Ga0105244_10032352 3300009036 Bacteria 2769
55 Ga0105244_10042310 3300009036 Bacteria 2356
56 Ga0105244_10338866 3300009036 Bacteria 693
57 Ga0105250_10014405 3300009092 Bacteria 3251
58 Ga0105250_10014716 3300009092 Bacteria 3210
59 Ga0105250_10230549 3300009092 Bacteria 787
60 Ga0105240_10001792 3300009093 Bacteria 36155
61 Ga0105240_10007379 3300009093 Bacteria 15992
62 Ga0105240_10172564 3300009093 Bacteria 2559
63 Ga0105240_10794936 3300009093 Bacteria 1025
64 Ga0105243_10996377 3300009148 Bacteria 840
65 Ga0105237_10052527 3300009545 Bacteria 4091
66 Ga0105237_10335215 3300009545 Bacteria 1517
67 Ga0105238_10417613 3300009551 Bacteria 1336
68 Ga0105239_10002612 3300010375 Bacteria 22800
69 Ga0105239_10007147 3300010375 Bacteria 12844
70 Ga0157373_10004430 3300013100 Bacteria 10575
71 Ga0157373_10005506 3300013100 Bacteria 9495
72 Ga0157373_10275947 3300013100 Bacteria 1191
73 Ga0157373_10716774 3300013100 Bacteria 734
74 Ga0157370_10001612 3300013104 Bacteria 27900
75 Ga0157370_10069089 3300013104 Bacteria 3337
76 Ga0157370_10117962 3300013104 Bacteria 2479
77 Ga0157370_10145763 3300013104 Bacteria 2205
78 Ga0157369_10001415 3300013105 Bacteria 29510
79 Ga0157369_10038787 3300013105 Bacteria 5208
80 Ga0157369_10114720 3300013105 Bacteria 2861
81 Ga0157374_10000141 3300013296 Bacteria 65347
82 Ga0163162_10013082 3300013306 Bacteria 8102
83 Ga0157372_10001060 3300013307 Bacteria 30037
84 Ga0157372_10002830 3300013307 Bacteria 18751
85 Ga0157372_10133859 3300013307 Bacteria 2853
86 Ga0157372_10691818 3300013307 Bacteria 1187
87 Ga0182008_10062438 3300014497 Bacteria 1836
88 Ga0182008_10214231 3300014497 Bacteria 984
89 Ga0182006_1019613 3300015261 Bacteria 2845
90 Ga0182006_1047236 3300015261 Bacteria 1670
91 Ga0182007_10003332 3300015262 Bacteria 7602
92 Ga0182007_10025158 3300015262 Bacteria 2076
93 Ga0182005_1016284 3300015265 Bacteria 2069
94 Ga0183361_10038 3300016635 Bacteria 26120
95 Ga0209566_100493 3300025225 Bacteria 27632
96 Ga0209674_100020 3300025226 Bacteria 672397
97 Ga0209672_100013 3300025228 Bacteria 740693
98 Ga0209672_100020 3300025228 Bacteria 429003
99 Ga0209672_100066 3300025228 Bacteria 189828
100 Ga0209147_100013 3300025229 Bacteria 660057
101 Ga0209147_100024 3300025229 Bacteria 429003
102 Ga0209147_100063 3300025229 Bacteria 241980
103 Ga0209147_100084 3300025229 Bacteria 189828
104 Ga0209563_100484 3300025230 Bacteria 13474
105 Ga0207427_101111 3300025231 Bacteria 10765
106 Ga0209258_100016 3300025242 Bacteria 668622
107 Ga0209258_100084 3300025242 Bacteria 244783
108 Ga0209258_100117 3300025242 Bacteria 189828
109 Ga0209148_1000020 3300025254 Bacteria 740693
110 Ga0209148_1000148 3300025254 Bacteria 159642
111 Ga0209148_1000814 3300025254 Bacteria 22594
112 Ga0209759_1000022 3300025256 Bacteria 329136
113 Ga0209759_1000217 3300025256 Bacteria 88349
114 Ga0209759_1002308 3300025256 Bacteria 8577
115 Ga0209233_1000055 3300025261 Bacteria 439422
116 Ga0209565_1007335 3300025263 Bacteria 2983
117 Ga0209455_1000017 3300025272 Bacteria 740693
118 Ga0209455_1000110 3300025272 Bacteria 189828
119 Ga0209455_1000298 3300025272 Bacteria 51486
120 Ga0209673_1000056 3300025273 Bacteria 271069
121 Ga0209676_1000548 3300025292 Bacteria 57446
122 Ga0209564_1001872 3300025295 Bacteria 18976
123 Ga0209564_1006691 3300025295 Bacteria 6128
124 Ga0207426_1000152 3300025302 Bacteria 183514
125 Ga0207696_1000064 3300025711 Bacteria 238379
126 Ga0207696_1001253 3300025711 Bacteria 14281
127 Ga0207696_1005613 3300025711 Bacteria 5178
128 Ga0207696_1008991 3300025711 Bacteria 3756
129 Ga0207655_1000455 3300025728 Bacteria 53605
130 Ga0207655_1001220 3300025728 Bacteria 24785
131 Ga0207655_1025552 3300025728 Bacteria 2863
132 Ga0207655_1026427 3300025728 Bacteria 2788
133 Ga0207713_1000081 3300025735 Bacteria 166910
134 Ga0207713_1000760 3300025735 Bacteria 29964
135 Ga0207713_1001445 3300025735 Bacteria 18948
136 Ga0207713_1006632 3300025735 Bacteria 7015
137 Ga0207713_1030237 3300025735 Bacteria 2414
138 Ga0207713_1091883 3300025735 Bacteria 1064
139 Ga0207713_1115508 3300025735 Bacteria 907
140 Ga0207713_1128256 3300025735 Bacteria 843
141 Ga0207647_10000264 3300025904 Bacteria 43118
142 Ga0207647_10009503 3300025904 Bacteria 6905
143 Ga0207647_10082119 3300025904 Bacteria 1931
144 Ga0207705_10344596 3300025909 Bacteria 1147
145 Ga0207695_10000328 3300025913 Bacteria 113378
146 Ga0207695_10080048 3300025913 Bacteria 3310
147 Ga0207695_10357976 3300025913 Bacteria 1346
148 Ga0207695_10499695 3300025913 Bacteria 1098
149 Ga0207671_10335062 3300025914 Bacteria 1198
150 Ga0207657_10000003 3300025919 Bacteria 263148
151 Ga0207657_10001781 3300025919 Bacteria 23254
152 Ga0207694_10078316 3300025924 Bacteria 2591
153 Ga0207690_10000007 3300025932 Bacteria 388533
154 Ga0207709_10006150 3300025935 Bacteria 6758
155 Ga0207709_10351595 3300025935 Bacteria 1112
156 Ga0207661_10082234 3300025944 Bacteria 2662
157 Ga0207661_11419145 3300025944 Bacteria 637
158 Ga0207679_10825585 3300025945 Bacteria 846
159 Ga0207667_10023113 3300025949 Bacteria 6848
160 Ga0207667_10059601 3300025949 Bacteria 3997
161 Ga0207658_10287499 3300025986 Bacteria 1412
162 Ga0207678_10000064 3300026067 Bacteria 83470
163 Ga0207698_10104694 3300026142 Bacteria 2355
164 Ga0209389_1000195 3300027296 Bacteria 44002
165 Ga0209371_1000076 3300027312 Bacteria 195166
166 Ga0209371_1000106 3300027312 Bacteria 146212
167 Ga0209371_1014239 3300027312 Bacteria 2189
168 Ga0209371_1016188 3300027312 Bacteria 1976
169 Ga0268256_1000077 3300030500 Bacteria 177593
170 Ga0268256_1000087 3300030500 Bacteria 157659
171 Ga0268256_1015786 3300030500 Bacteria 2189
172 Ga0268256_1017969 3300030500 Bacteria 1977
173 Ga0307408_100083379 3300031548 Bacteria 2395
174 Ga0307408_100220136 3300031548 Bacteria 1548
175 Ga0307412_10039543 3300031911 Bacteria 3046
176 Ga0307510_10218842 3300033180 Bacteria 1418
177 Ga0395899_0000005 3300037312 Bacteria 772966
178 Ga0395900_0000003 3300037418 Bacteria 587648
179 Ga0395900_0745072 3300037418 Bacteria 910
180 Ga0395898_0000003 3300037466 Bacteria 772986
181 Ga0395905_0000048 3300037471 Bacteria 236537
182 Ga0436365_0899666 3300039437 Bacteria 1544
183 Ga0439432_001411 3300042006 Bacteria 9040
184 Ga0439463_003105 3300042016 Bacteria 4212
185 Ga0439463_014774 3300042016 Bacteria 1927
186 Ga0450900_000235 3300042136 Bacteria 3782
187 Ga0450905_001760 3300042142 Bacteria 2760
188 Ga0439464_0012342 3300042439 Bacteria 2275
189 Ga0466969_0022810 3300044656 Bacteria 3228
190 Ga0466966_0000107 3300044684 Bacteria 51017
191 Ga0466966_0088971 3300044684 Bacteria 1918
192 Ga0466966_0188986 3300044684 Bacteria 1248
193 Ga0466961_0041461 3300044693 Bacteria 2951
194 Ga0466961_0139186 3300044693 Bacteria 1520
195 Ga0466963_0163660 3300044694 Bacteria 1549
196 Ga0466970_0131215 3300044765 Bacteria 1376
197 Ga0466960_0225108 3300044901 Bacteria 1033
198 Ga0466959_0004644 3300045049 Bacteria 9237
199 Ga0466959_0011760 3300045049 Bacteria 6300
200 Ga0466958_0021335 3300045836 Bacteria 3783
201 Ga0495592_0009048 3300046454 Bacteria 7486
202 Ga0495592_0096852 3300046454 Bacteria 2108
203 Ga0495603_0009881 3300046455 Bacteria 5775
204 Ga0495603_0249271 3300046455 Bacteria 1022
205 Ga0495590_0007935 3300046457 Bacteria 4070
206 Ga0495590_0047606 3300046457 Bacteria 1496
207 Ga0495590_0172227 3300046457 Bacteria 789
208 Ga0495590_0242051 3300046457 Bacteria 670
209 Ga0495591_000105 3300046458 Bacteria 97199
210 Ga0495591_001309 3300046458 Bacteria 15699
211 Ga0495591_001445 3300046458 Bacteria 14729
212 Ga0495591_003584 3300046458 Bacteria 7925
213 Ga0495591_010608 3300046458 Bacteria 3555
214 Ga0495591_027741 3300046458 Bacteria 1741
215 Ga0495629_0000023 3300046459 Bacteria 142325
216 Ga0495629_0003059 3300046459 Bacteria 12713
217 Ga0495629_0072937 3300046459 Bacteria 2397
218 Ga0495638_0055158 3300046460 Bacteria 2469
219 Ga0495641_0132037 3300046461 Bacteria 1115
220 Ga0495651_0004362 3300046462 Bacteria 10824
221 Ga0495651_0021965 3300046462 Bacteria 4963
222 Ga0495651_0281938 3300046462 Bacteria 1122
223 Ga0495653_0000234 3300046463 Bacteria 44654
224 Ga0495653_0081851 3300046463 Bacteria 2384
225 Ga0495653_0100116 3300046463 Bacteria 2101
226 Ga0495653_0145495 3300046463 Bacteria 1661
227 Ga0495650_0002467 3300046471 Bacteria 14882
228 Ga0495650_0005599 3300046471 Bacteria 8102
229 Ga0495580_0000070 3300046472 Bacteria 62590
230 Ga0495580_0000442 3300046472 Bacteria 34202
231 Ga0495580_0004916 3300046472 Bacteria 11172
232 Ga0495580_0031229 3300046472 Bacteria 3850
233 Ga0495580_0187052 3300046472 Bacteria 1429
234 Ga0495580_0456873 3300046472 Bacteria 856
235 Ga0495582_0006667 3300046473 Bacteria 6414
236 Ga0495582_0017648 3300046473 Bacteria 3905
237 Ga0495582_0096904 3300046473 Bacteria 1649
238 Ga0495582_0280019 3300046473 Bacteria 958
239 Ga0495605_0000342 3300046474 Bacteria 45965
240 Ga0495605_0001752 3300046474 Bacteria 13903
241 Ga0495605_0002036 3300046474 Bacteria 12753
242 Ga0495605_0007125 3300046474 Bacteria 6364
243 Ga0495605_0010647 3300046474 Bacteria 5140
244 Ga0495605_0037793 3300046474 Bacteria 2425
245 Ga0495605_0121699 3300046474 Bacteria 1182
246 Ga0495662_0013116 3300046476 Bacteria 4036
247 Ga0495664_0085111 3300046477 Bacteria 1898
248 Ga0495664_0216277 3300046477 Bacteria 1160
249 Ga0495664_0235030 3300046477 Bacteria 1109
250 Ga0495664_0371360 3300046477 Bacteria 860
251 Ga0495584_0036023 3300046491 Bacteria 2500
252 Ga0495584_0201046 3300046491 Bacteria 1013
253 Ga0495585_0007176 3300046492 Bacteria 6843
254 Ga0495585_0133729 3300046492 Bacteria 1303
255 Ga0495594_0132853 3300046499 Bacteria 1410
256 Ga0495596_0001240 3300046500 Bacteria 14840
257 Ga0495596_0016780 3300046500 Bacteria 3038
258 Ga0495607_0000173 3300046501 Bacteria 68694
259 Ga0495607_0004256 3300046501 Bacteria 10598
260 Ga0495607_0008198 3300046501 Bacteria 7155
261 Ga0495607_0019226 3300046501 Bacteria 4341
262 Ga0495607_0019516 3300046501 Bacteria 4304
263 Ga0495607_0030910 3300046501 Bacteria 3282
264 Ga0495607_0034862 3300046501 Bacteria 3050
265 Ga0495607_0036108 3300046501 Bacteria 2982
266 Ga0495607_0264354 3300046501 Bacteria 822
267 Ga0495583_0002802 3300046506 Bacteria 14305
268 Ga0495583_0005240 3300046506 Bacteria 8894
269 Ga0495583_0006154 3300046506 Bacteria 7904
270 Ga0495583_0030512 3300046506 Bacteria 2624
271 Ga0495583_0035763 3300046506 Bacteria 2367
272 Ga0495583_0126978 3300046506 Bacteria 1069
273 Ga0495606_0002796 3300046507 Bacteria 19461
274 Ga0495606_0039995 3300046507 Bacteria 3154
275 Ga0495606_0048943 3300046507 Bacteria 2776
276 Ga0495606_0106670 3300046507 Bacteria 1696
277 Ga0495606_0179558 3300046507 Bacteria 1221
278 Ga0495606_0206337 3300046507 Bacteria 1116
279 Ga0495606_0225929 3300046507 Bacteria 1052
280 Ga0495606_0252839 3300046507 Bacteria 977
281 Ga0495608_0013727 3300046511 Bacteria 5619
282 Ga0495610_0028524 3300046512 Bacteria 2950
283 Ga0495616_0025147 3300046513 Bacteria 3185
284 Ga0495616_0031354 3300046513 Bacteria 2783
285 Ga0495616_0076940 3300046513 Bacteria 1602
286 Ga0495618_0005116 3300046514 Bacteria 8009
287 Ga0495618_0033954 3300046514 Bacteria 3198
288 Ga0495618_0075091 3300046514 Bacteria 2153
289 Ga0495618_0404764 3300046514 Bacteria 834
290 Ga0495620_0001842 3300046515 Bacteria 12481
291 Ga0495620_0004360 3300046515 Bacteria 7992
292 Ga0495620_0005341 3300046515 Bacteria 7184
293 Ga0495620_0008704 3300046515 Bacteria 5433
294 Ga0495620_0026248 3300046515 Bacteria 2741
295 Ga0495620_0156503 3300046515 Bacteria 886
296 Ga0495628_0009399 3300046516 Bacteria 8345
297 Ga0495628_0034710 3300046516 Bacteria 4056
298 Ga0495628_0035726 3300046516 Bacteria 3992
299 Ga0495628_0258617 3300046516 Bacteria 1298
300 Ga0495628_0362666 3300046516 Bacteria 1063
301 Ga0495628_0548140 3300046516 Bacteria 830
302 Ga0495630_0002732 3300046517 Bacteria 12238
303 Ga0495630_0009554 3300046517 Bacteria 6974
304 Ga0495631_0002675 3300046518 Bacteria 9918
305 Ga0495631_0004023 3300046518 Bacteria 7914
306 Ga0495631_0070150 3300046518 Bacteria 1515
307 Ga0495632_0009149 3300046519 Bacteria 5986
308 Ga0495632_0067230 3300046519 Bacteria 1728
309 Ga0495632_0135495 3300046519 Bacteria 1144
310 Ga0495632_0357076 3300046519 Bacteria 642
311 Ga0495637_0000695 3300046520 Bacteria 23132
312 Ga0495637_0002785 3300046520 Bacteria 9478
313 Ga0495637_0057831 3300046520 Bacteria 1600
314 Ga0495637_0092574 3300046520 Bacteria 1190
315 Ga0495637_0098202 3300046520 Bacteria 1147
316 Ga0495643_0002458 3300046522 Bacteria 14661
317 Ga0495643_0011532 3300046522 Bacteria 5377
318 Ga0495643_0071602 3300046522 Bacteria 1819
319 Ga0495644_0003826 3300046523 Bacteria 5921
320 Ga0495644_0056604 3300046523 Bacteria 1473
321 Ga0495648_0008380 3300046524 Bacteria 8144
322 Ga0495648_0019266 3300046524 Bacteria 4804
323 Ga0495648_0021955 3300046524 Bacteria 4407
324 Ga0495648_0045554 3300046524 Bacteria 2727
325 Ga0495648_0069230 3300046524 Bacteria 2054
326 Ga0495648_0164193 3300046524 Bacteria 1144
327 Ga0495648_0168688 3300046524 Bacteria 1124
328 Ga0495648_0180205 3300046524 Bacteria 1074
329 Ga0495648_0198961 3300046524 Bacteria 1004
330 Ga0495648_0212640 3300046524 Bacteria 959
331 Ga0495666_0001367 3300046526 Bacteria 11823
332 Ga0495666_0005663 3300046526 Bacteria 6293
333 Ga0495666_0016734 3300046526 Bacteria 3651
334 Ga0495666_0374571 3300046526 Bacteria 640
335 Ga0495666_0470276 3300046526 Bacteria 563
336 Ga0495642_0103649 3300046528 Bacteria 1213
337 Ga0495652_0013524 3300046529 Bacteria 7346
338 Ga0495652_0022476 3300046529 Bacteria 5596
339 Ga0495652_0111075 3300046529 Bacteria 2204
340 Ga0495652_0167014 3300046529 Bacteria 1702
341 Ga0495652_0341374 3300046529 Bacteria 1076
342 Ga0495654_0003870 3300046530 Bacteria 9041
343 Ga0495654_0040648 3300046530 Bacteria 2316
344 Ga0495654_0059040 3300046530 Bacteria 1848
345 Ga0495654_0063119 3300046530 Bacteria 1774
346 Ga0495654_0100479 3300046530 Bacteria 1332
347 Ga0495665_0001394 3300046531 Bacteria 12934
348 Ga0495665_0092564 3300046531 Bacteria 1588
349 Ga0495665_0141875 3300046531 Bacteria 1255
350 Ga0495665_0177214 3300046531 Bacteria 1108
351 Ga0495640_0008752 3300046533 Bacteria 7928
352 Ga0495640_0009250 3300046533 Bacteria 7684
353 Ga0495586_0235618 3300046535 Bacteria 1042
354 Ga0495586_0280483 3300046535 Bacteria 953
355 Ga0495587_0215845 3300046536 Bacteria 1082
356 Ga0495609_0000223 3300046538 Bacteria 55773
357 Ga0495609_0017516 3300046538 Bacteria 3327
358 Ga0495597_0255011 3300046542 Bacteria 688
359 Ga0495597_0264763 3300046542 Bacteria 672
360 Ga0495645_0048250 3300046543 Bacteria 3102
361 Ga0495645_0083266 3300046543 Bacteria 2293
362 Ga0495645_0203041 3300046543 Bacteria 1343
363 Ga0495645_0354417 3300046543 Bacteria 944
364 Ga0495645_0387611 3300046543 Bacteria 893
365 Ga0495645_0451869 3300046543 Bacteria 810
366 Ga0495622_0000183 3300046557 Bacteria 50803
367 Ga0495622_0008748 3300046557 Bacteria 4691
368 Ga0495667_0043416 3300046559 Bacteria 2979
369 Ga0495667_0127869 3300046559 Bacteria 1639
370 Ga0495667_0240570 3300046559 Bacteria 1153
371 Ga0495667_0309754 3300046559 Bacteria 1000
372 Ga0495668_0002851 3300046616 Bacteria 13715
373 Ga0495668_0029151 3300046616 Bacteria 3119
374 Ga0495668_0182790 3300046616 Bacteria 1148
375 Ga0495634_0013804 3300046642 Bacteria 5834
376 Ga0495634_0057402 3300046642 Bacteria 2598
377 Ga0495634_0231627 3300046642 Bacteria 1136
378 Ga0495611_0001214 3300046648 Bacteria 13332
379 Ga0495611_0160883 3300046648 Bacteria 1049
380 Ga0495611_0263963 3300046648 Bacteria 797
381 Ga0495625_0000027 3300046660 Bacteria 258545
382 Ga0495625_0229632 3300046660 Bacteria 1212
383 Ga0495625_0447488 3300046660 Bacteria 799
384 Ga0495635_0007617 3300046663 Bacteria 7556
385 Ga0495635_0018845 3300046663 Bacteria 4816
386 Ga0495661_0000174 3300046665 Bacteria 74521
387 Ga0495661_0002898 3300046665 Bacteria 12979
388 Ga0495661_0010553 3300046665 Bacteria 6298
389 Ga0495661_0017322 3300046665 Bacteria 4760
390 Ga0495661_0074502 3300046665 Bacteria 1975
391 Ga0495657_0066250 3300046675 Bacteria 2373
392 Ga0495599_0085535 3300046678 Bacteria 1969
393 Ga0495599_0107851 3300046678 Bacteria 1735
394 Ga0495599_0202746 3300046678 Bacteria 1218
395 Ga0495623_0017638 3300046679 Bacteria 4610
396 Ga0495623_0040674 3300046679 Bacteria 2967
397 Ga0495646_0002803 3300046680 Bacteria 10781
398 Ga0495646_0010215 3300046680 Bacteria 5970
399 Ga0495646_0022253 3300046680 Bacteria 3999
400 Ga0495646_0095080 3300046680 Bacteria 1715
401 Ga0495613_0091352 3300046689 Bacteria 2204
402 Ga0495624_0001456 3300046690 Bacteria 18406
403 Ga0495624_0007279 3300046690 Bacteria 7775
404 Ga0495624_0023447 3300046690 Bacteria 4069
405 Ga0495624_0277257 3300046690 Bacteria 1012
406 Ga0495670_0236644 3300046691 Bacteria 972
407 Ga0495671_0002833 3300046692 Bacteria 10858
408 Ga0495671_0011254 3300046692 Bacteria 4933
409 Ga0495671_0037929 3300046692 Bacteria 2436
410 Ga0495671_0084814 3300046692 Bacteria 1552
411 Ga0495649_0013597 3300046694 Bacteria 4692
412 Ga0495649_0013741 3300046694 Bacteria 4661
413 Ga0495649_0024324 3300046694 Bacteria 3377
414 Ga0495649_0061884 3300046694 Bacteria 2012
415 Ga0495649_0183388 3300046694 Bacteria 1091
416 Ga0495589_0000865 3300046794 Bacteria 18905
417 Ga0495589_0136448 3300046794 Bacteria 1176
418 Ga0495660_0004495 3300046810 Bacteria 8435
419 Ga0495660_0004914 3300046810 Bacteria 8051
420 Ga0495660_0034780 3300046810 Bacteria 2818
421 Ga0495660_0041990 3300046810 Bacteria 2529
422 Ga0495581_0032292 3300047315 Bacteria 3032
423 Ga0495604_0001443 3300047317 Bacteria 19513
424 Ga0495604_0017057 3300047317 Bacteria 5809
425 Ga0495604_0271676 3300047317 Bacteria 1148
426 Ga0495604_0294451 3300047317 Bacteria 1092
427 Ga0495674_0002804 3300047319 Bacteria 16927
428 Ga0495674_0012200 3300047319 Bacteria 8096
429 Ga0495674_0016911 3300047319 Bacteria 6800
430 Ga0495674_0029329 3300047319 Bacteria 5012
431 Ga0495674_0030152 3300047319 Bacteria 4934
432 Ga0495674_0035834 3300047319 Bacteria 4473
433 Ga0495674_0165893 3300047319 Bacteria 1845
434 Ga0495674_0230733 3300047319 Bacteria 1527
435 Ga0495672_0014049 3300047320 Bacteria 5499
436 Ga0495672_0018549 3300047320 Bacteria 4614
437 Ga0495672_0029902 3300047320 Bacteria 3424
438 Ga0495672_0043035 3300047320 Bacteria 2718
439 Ga0495672_0048034 3300047320 Bacteria 2533
440 Ga0495672_0048378 3300047320 Bacteria 2521
441 Ga0495672_0091522 3300047320 Bacteria 1669
442 Ga0495676_0000012 3300047321 Bacteria 230043
443 Ga0495676_0029017 3300047321 Bacteria 4715
444 Ga0495676_0037023 3300047321 Bacteria 4067
445 Ga0495676_0092778 3300047321 Bacteria 2253
446 Ga0495676_0356096 3300047321 Bacteria 977
447 Ga0495680_0151318 3300047322 Bacteria 1691
448 Ga0495683_0002235 3300047323 Bacteria 11836
449 Ga0495683_0002674 3300047323 Bacteria 10628
450 Ga0495683_0009891 3300047323 Bacteria 5066
451 Ga0495687_010249 3300047443 Bacteria 5152
452 Ga0495687_050515 3300047443 Bacteria 1771
453 Ga0495687_063796 3300047443 Bacteria 1507
454 Ga0495675_0002674 3300047444 Bacteria 10674
455 Ga0495675_0003270 3300047444 Bacteria 9738
456 Ga0495675_0008142 3300047444 Bacteria 6487
457 Ga0495679_000022 3300047446 Bacteria 215296
458 Ga0495679_000680 3300047446 Bacteria 22308
459 Ga0495679_001491 3300047446 Bacteria 13210
460 Ga0495679_005048 3300047446 Bacteria 5931
461 Ga0495673_0002387 3300047469 Bacteria 13286
462 Ga0495673_0004488 3300047469 Bacteria 8716
463 Ga0495673_0008039 3300047469 Bacteria 5977
464 Ga0495673_0008460 3300047469 Bacteria 5787
465 Ga0495673_0011550 3300047469 Bacteria 4742
466 Ga0495673_0029514 3300047469 Bacteria 2587
467 Ga0495673_0047633 3300047469 Bacteria 1893
468 Ga0495673_0081046 3300047469 Bacteria 1344
469 Ga0495673_0117324 3300047469 Bacteria 1057
470 Ga0495673_0122006 3300047469 Bacteria 1031
471 Ga0495681_0023278 3300047470 Bacteria 3295
472 Ga0495684_0129791 3300047471 Bacteria 1894
473 Ga0495684_0624438 3300047471 Bacteria 724
474 Ga0495686_0000359 3300047472 Bacteria 73907
475 Ga0495686_0005197 3300047472 Bacteria 10363
476 Ga0495686_0053552 3300047472 Bacteria 2529
477 Ga0495593_0003541 3300047673 Bacteria 9342
478 Ga0495593_0003959 3300047673 Bacteria 8844
479 Ga0495593_0010106 3300047673 Bacteria 5460
480 Ga0495602_0017649 3300048088 Bacteria 7149
481 Ga0495602_0076269 3300048088 Bacteria 2841
482 Ga0495602_0128488 3300048088 Bacteria 2025
483 Ga0495602_0460955 3300048088 Bacteria 895
484 Ga0495602_0463229 3300048088 Bacteria 892
485 Ga0495614_0002865 3300048089 Bacteria 7669
486 Ga0495614_0003497 3300048089 Bacteria 7031
487 Ga0495614_0007822 3300048089 Bacteria 4753
488 Ga0495626_0000545 3300048091 Bacteria 37397
489 Ga0495626_0148593 3300048091 Bacteria 989
490 Ga0495626_0175849 3300048091 Bacteria 890
491 Ga0496100_0000093 3300048903 Bacteria 50733
492 Ga0496100_0002599 3300048903 Bacteria 9204
493 Ga0496100_0510272 3300048903 Bacteria 927
494 Ga0496101_0000186 3300048904 Bacteria 48919
495 Ga0496101_0274900 3300048904 Bacteria 1315
496 Ga0496102_0000423 3300048905 Bacteria 48838
497 Ga0496102_0024648 3300048905 Bacteria 5349
498 Ga0496102_0102093 3300048905 Bacteria 2666
499 Ga0496102_0570613 3300048905 Bacteria 1054
500 Ga0496103_0000245 3300048906 Bacteria 52965
501 Ga0496103_0028516 3300048906 Bacteria 3389
502 Ga0496103_0082138 3300048906 Bacteria 2027
503 Ga0496104_1159577 3300048907 Bacteria 676
504 Ga0496105_0159878 3300048908 Bacteria 1849
505 Ga0496106_0022595 3300048909 Bacteria 4675
506 Ga0496106_0103542 3300048909 Bacteria 2209
507 Ga0496110_0338342 3300048913 Bacteria 1371
508 Ga0496110_0612652 3300048913 Bacteria 987
509 Ga0496110_0687879 3300048913 Bacteria 924
510 Ga0496113_0024846 3300048916 Bacteria 4264
511 Ga0496113_0417719 3300048916 Bacteria 1077
512 Ga0496114_0066226 3300048917 Bacteria 3028
513 Ga0496114_1316651 3300048917 Bacteria 609
514 Ga0496115_0026743 3300048918 Bacteria 4507
515 Ga0496115_0471632 3300048918 Bacteria 1012
516 Ga0496116_0029460 3300048919 Bacteria 3957
517 Ga0496116_0212065 3300048919 Bacteria 1002
518 Ga0496117_0000704 3300048920 Bacteria 53026
519 Ga0496117_0003780 3300048920 Bacteria 17292
520 Ga0496117_0007044 3300048920 Bacteria 11125
521 Ga0496117_0008849 3300048920 Bacteria 9500
522 Ga0496117_0072488 3300048920 Bacteria 2302
523 Ga0496117_0182271 3300048920 Bacteria 1205
524 Ga0496117_0263903 3300048920 Bacteria 932
525 Ga0496118_0000400 3300048921 Bacteria 73227
526 Ga0496118_0000644 3300048921 Bacteria 57224
527 Ga0496118_0000733 3300048921 Bacteria 52997
528 Ga0496118_0004167 3300048921 Bacteria 17442
529 Ga0496118_0031655 3300048921 Bacteria 4379
530 Ga0496118_0045699 3300048921 Bacteria 3414
531 Ga0496118_0119512 3300048921 Bacteria 1723
532 Ga0496118_0446739 3300048921 Bacteria 658
533 Ga0496119_0000071 3300048922 Bacteria 153652
534 Ga0496119_0039678 3300048922 Bacteria 3023
535 Ga0496119_0055355 3300048922 Bacteria 2410
536 Ga0496119_0137013 3300048922 Bacteria 1326
537 Ga0496120_0003860 3300048923 Bacteria 13156
538 Ga0496121_0002178 3300048924 Bacteria 30679
539 Ga0496121_0003032 3300048924 Bacteria 24380
540 Ga0496121_0005413 3300048924 Bacteria 16389
541 Ga0496121_0018363 3300048924 Bacteria 7056
542 Ga0496121_0032686 3300048924 Bacteria 4724
543 Ga0496121_0155185 3300048924 Bacteria 1680
544 Ga0496122_0000370 3300048925 Bacteria 96422
545 Ga0496122_0330241 3300048925 Bacteria 806
546 Ga0496123_0000135 3300048926 Bacteria 153056
547 Ga0496123_0130020 3300048926 Bacteria 1397
548 Ga0496123_0144072 3300048926 Bacteria 1297
549 Ga0496124_0000144 3300048927 Bacteria 146921
550 Ga0496124_0003720 3300048927 Bacteria 18402
551 Ga0496124_0006911 3300048927 Bacteria 12195
552 Ga0496124_0016832 3300048927 Bacteria 6930
553 Ga0496124_0029188 3300048927 Bacteria 4920
554 Ga0496124_0037219 3300048927 Bacteria 4234
555 Ga0496124_0079095 3300048927 Bacteria 2708
556 Ga0496124_0165339 3300048927 Bacteria 1720
557 Ga0496124_0191060 3300048927 Bacteria 1567
558 Ga0496125_0002910 3300048928 Bacteria 21537
559 Ga0496125_0032634 3300048928 Bacteria 4623
560 Ga0496126_0000319 3300048929 Bacteria 102596
561 Ga0496126_0073302 3300048929 Bacteria 3044
562 Ga0496126_0098621 3300048929 Bacteria 2560
563 Ga0496126_0321598 3300048929 Bacteria 1271
564 Ga0496126_0800769 3300048929 Bacteria 723
565 Ga0496126_1215516 3300048929 Bacteria 553
566 Ga0495678_001576 3300049459 Bacteria 17517
567 Ga0495678_031512 3300049459 Bacteria 2209
568 Ga0495678_035581 3300049459 Bacteria 2039
569 Ga0495678_044758 3300049459 Bacteria 1749
570 Ga0495678_045697 3300049459 Bacteria 1726
571 Ga0495678_047245 3300049459 Bacteria 1686
572 Ga0495682_0009335 3300049460 Bacteria 3830
573 Ga0495682_0028854 3300049460 Bacteria 2055
574 Ga0495682_0057584 3300049460 Bacteria 1406
575 Ga0495682_0059806 3300049460 Bacteria 1376
576 Ga0495682_0188006 3300049460 Bacteria 733
577 Ga0501034_0000101 3300049571 Bacteria 158656
578 Ga0495655_0097155 3300053083 Bacteria 867
579 Ga0500659_0002194 3300053135 Bacteria 11858
580 Ga0500577_0259147 3300053142 Bacteria 756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0215845 Ga0495587_0215845_25_495 147
2 3300046559 Ga0495667_0127869 Ga0495667_0127869_750_1289 147
3 3300047317 Ga0495604_0271676 Ga0495604_0271676_667_1137 147
4 iso_pu_bacteria 2919155634 2919155767 151
5 3300048916 Ga0496113_0417719 Ga0496113_0417719_594_1061 152
6 iso_pu_bacteria 2515154123 2515690558 152
7 iso_pu_bacteria 2554235231 2555247011 152
8 iso_pu_bacteria 2599185307 2599975093 152
9 iso_pu_bacteria 2765235841 2765586461 152
10 iso_pu_bacteria 8052494512 8052499666 152
11 iso_pu_bacteria 8054929484 8054934158 152
12 3300027312 Ga0209371_1016188 Ga0209371_10161882 153
13 3300030500 Ga0268256_1017969 Ga0268256_10179692 153
14 iso_pu_bacteria 2600255283 2601628421 153
15 iso_pu_bacteria 2738541271 2738690211 153
16 iso_pu_bacteria 2738543016 2739265985 153
17 iso_pu_bacteria 3007872151 3007873195 153
18 3300005289 Ga0065704_10163262 Ga0065704_101632622 154
19 3300009036 Ga0105244_10003582 Ga0105244_100035827 154
20 3300013104 Ga0157370_10069089 Ga0157370_100690893 154
21 3300048920 Ga0496117_0007044 Ga0496117_0007044_5308_5805 154
22 3300005327 Ga0070658_11002829 Ga0070658_110028291 155
23 3300005329 Ga0070683_100106523 Ga0070683_1001065232 155
24 3300013306 Ga0163162_10013082 Ga0163162_100130828 155
25 3300013307 Ga0157372_10133859 Ga0157372_101338592 155
26 3300025944 Ga0207661_10082234 Ga0207661_100822342 155
27 3300046516 Ga0495628_0035726 Ga0495628_0035726_190_690 155
28 3300046529 Ga0495652_0167014 Ga0495652_0167014_412_912 155
29 3300046559 Ga0495667_0240570 Ga0495667_0240570_599_1099 155
30 3300047472 Ga0495686_0000359 Ga0495686_0000359_69639_70139 155
31 3300048920 Ga0496117_0263903 Ga0496117_0263903_72_572 155
32 3300048922 Ga0496119_0000071 Ga0496119_0000071_150908_151375 155
33 3300048923 Ga0496120_0003860 Ga0496120_0003860_1106_1573 155
34 3300005289 Ga0065704_10299613 Ga0065704_102996131 156
35 3300006944 Ga0099823_1000137 Ga0099823_100013731 156
36 3300009011 Ga0105251_10001725 Ga0105251_100017257 156
37 3300009011 Ga0105251_10020896 Ga0105251_100208962 156
38 3300009011 Ga0105251_10158469 Ga0105251_101584692 156
39 3300009036 Ga0105244_10032352 Ga0105244_100323522 156
40 3300009092 Ga0105250_10014405 Ga0105250_100144054 156
41 3300013104 Ga0157370_10117962 Ga0157370_101179623 156
42 3300014497 Ga0182008_10062438 Ga0182008_100624382 156
43 3300015261 Ga0182006_1047236 Ga0182006_10472362 156
44 3300015262 Ga0182007_10025158 Ga0182007_100251582 156
45 3300025711 Ga0207696_1008991 Ga0207696_10089912 156
46 3300025728 Ga0207655_1025552 Ga0207655_10255523 156
47 3300025735 Ga0207713_1001445 Ga0207713_10014457 156
48 3300025735 Ga0207713_1091883 Ga0207713_10918832 156
49 3300025735 Ga0207713_1128256 Ga0207713_11282562 156
50 3300027296 Ga0209389_1000195 Ga0209389_100019529 156
51 3300042006 Ga0439432_001411 Ga0439432_001411_1995_2465 156
52 3300042136 Ga0450900_000235 Ga0450900_000235_2434_2904 156
53 3300042142 Ga0450905_001760 Ga0450905_001760_1632_2102 156
54 3300042439 Ga0439464_0012342 Ga0439464_0012342_1730_2200 156
55 3300046506 Ga0495583_0035763 Ga0495583_0035763_1576_2049 156
56 3300046522 Ga0495643_0002458 Ga0495643_0002458_8952_9422 156
57 3300048913 Ga0496110_0338342 Ga0496110_0338342_57_530 156
58 3300048926 Ga0496123_0130020 Ga0496123_0130020_304_774 156
59 3300048927 Ga0496124_0000144 Ga0496124_0000144_31821_32294 156
60 3300048927 Ga0496124_0016832 Ga0496124_0016832_985_1458 156
61 3300048927 Ga0496124_0079095 Ga0496124_0079095_460_930 156
62 3300048929 Ga0496126_0321598 Ga0496126_0321598_580_1050 156
63 3300049571 Ga0501034_0000101 Ga0501034_0000101_6780_7250 156
64 3300053135 Ga0500659_0002194 Ga0500659_0002194_1588_2058 156
65 iso_pu_bacteria 2508501125 2509126325 156
66 iso_pu_bacteria 2510065045 2510248785 156
67 iso_pu_bacteria 2512047030 2512349080 156
68 iso_pu_bacteria 2513237151 2513958464 156
69 iso_pu_bacteria 2513237166 2514052756 156
70 iso_pu_bacteria 2515154122 2515680321 156
71 iso_pu_bacteria 2519103095 2519460293 156
72 iso_pu_bacteria 2526164713 2527077406 156
73 iso_pu_bacteria 2562617112 2563057260 156
74 iso_pu_bacteria 2582581311 2585292605 156
75 iso_pu_bacteria 2599185239 2599739723 156
76 iso_pu_bacteria 2599185240 2599747314 156
77 iso_pu_bacteria 2599185355 2600209061 156
78 iso_pu_bacteria 2600255067 2600813416 156
79 iso_pu_bacteria 2675903129 2676745089 156
80 iso_pu_bacteria 2711768613 2713474044 156
81 iso_pu_bacteria 2718217991 2719642789 156
82 iso_pu_bacteria 2744054900 2746085055 156
83 iso_pu_bacteria 2744054901 2746094960 156
84 iso_pu_bacteria 2751185846 2753571090 156
85 iso_pu_bacteria 2791355137 2792838479 156
86 iso_pu_bacteria 2816332253 2817257909 156
87 iso_pu_bacteria 2816332256 2817281700 156
88 iso_pu_bacteria 2816332286 2817456045 156
89 iso_pu_bacteria 2818991450 2819619137 156
90 iso_pu_bacteria 2818991452 2819635256 156
91 iso_pu_bacteria 2842324504 2842330849 156
92 iso_pu_bacteria 2842348783 2842355188 156
93 iso_pu_bacteria 2842454564 2842456138 156
94 iso_pu_bacteria 2863421361 2863424334 156
95 iso_pu_bacteria 2870068957 2870073490 156
96 iso_pu_bacteria 2885270888 2885278058 156
97 iso_pu_bacteria 2900634093 2900638421 156
98 iso_pu_bacteria 2902682994 2902687934 156
99 iso_pu_bacteria 2904483920 2904488988 156
100 iso_pu_bacteria 2904564687 2904567500 156
101 iso_pu_bacteria 2904571731 2904574545 156
102 iso_pu_bacteria 2919527303 2919529598 156
103 iso_pu_bacteria 2928108538 2928114055 156
104 iso_pu_bacteria 2928135762 2928141431 156
105 iso_pu_bacteria 2928157003 2928158414 156
106 iso_pu_bacteria 2928163908 2928167374 156
107 iso_pu_bacteria 2928170801 2928177077 156
108 iso_pu_bacteria 2928503688 2928504542 156
109 iso_pu_bacteria 2928536128 2928540339 156
110 iso_pu_bacteria 2981990288 2981991880 156
111 iso_pu_bacteria 642555112 642595073 156
112 iso_pu_bacteria 642555113 642615597 156
113 iso_pu_bacteria 8018845410 8018851715 156
114 iso_pu_bacteria 8020807995 8020812193 156
115 iso_pu_bacteria 8020938398 8020942971 156
116 iso_pu_bacteria 8020945358 8020946662 156
117 iso_pu_bacteria 8020953355 8020959651 156
118 iso_pu_bacteria 8021120328 8021123939 156
119 iso_pu_bacteria 8039098773 8039100322 156
120 iso_pu_bacteria 8040167225 8040170712 156
121 iso_pu_bacteria 8040173305 8040176916 156
122 iso_pu_bacteria 8055266321 8055269308 156
123 iso_pu_bacteria 8055301274 8055303627 156
124 2162886007 SwRhRL2b_contig_2477539 SwRhRL2b_0941.00003510 157
125 3300001989 JGI24739J22299_10029706 JGI24739J22299_100297063 157
126 3300001989 JGI24739J22299_10086848 JGI24739J22299_100868482 157
127 3300002705 JGI25156J39149_1000131 JGI25156J39149_100013148 157
128 3300002705 JGI25156J39149_1024773 JGI25156J39149_10247732 157
129 3300003214 JGI25165J46597_1001102 JGI25165J46597_100110213 157
130 3300003322 rootL2_10118523 rootL2_101185232 157
131 3300003322 rootL2_10220132 rootL2_102201323 157
132 3300003354 JGI25160J50197_1000362 JGI25160J50197_100036213 157
133 3300003756 Ga0055533_1000184 Ga0055533_100018439 157
134 3300003756 Ga0055533_1000333 Ga0055533_10003331 157
135 3300003758 Ga0055532_1000007 Ga0055532_1000007204 157
136 3300003758 Ga0055532_1000269 Ga0055532_100026925 157
137 3300003760 Ga0055527_1000007 Ga0055527_1000007201 157
138 3300003760 Ga0055527_1000228 Ga0055527_100022827 157
139 3300003760 Ga0055527_1000301 Ga0055527_10003013 157
140 3300003761 Ga0055535_1000005 Ga0055535_1000005204 157
141 3300003761 Ga0055535_1000489 Ga0055535_100048927 157
142 3300003761 Ga0055535_1000540 Ga0055535_100054026 157
143 3300003762 Ga0055542_1000008 Ga0055542_1000008204 157
144 3300003762 Ga0055542_1000555 Ga0055542_10005559 157
145 3300003762 Ga0055542_1003229 Ga0055542_10032292 157
146 3300003763 Ga0055529_1000005 Ga0055529_1000005204 157
147 3300003763 Ga0055529_1000530 Ga0055529_10005309 157
148 3300003790 Ga0055528_1016968 Ga0055528_10169683 157
149 3300005262 Ga0065165_1001204 Ga0065165_100120413 157
150 3300005289 Ga0065704_10072329 Ga0065704_100723294 157
151 3300005327 Ga0070658_10090326 Ga0070658_100903263 157
152 3300005327 Ga0070658_10146896 Ga0070658_101468962 157
153 3300005329 Ga0070683_101741312 Ga0070683_1017413121 157
154 3300005339 Ga0070660_100000006 Ga0070660_100000006125 157
155 3300005339 Ga0070660_100001980 Ga0070660_10000198012 157
156 3300005366 Ga0070659_100000078 Ga0070659_1000000782 157
157 3300005535 Ga0070684_100345447 Ga0070684_1003454472 157
158 3300005563 Ga0068855_100002506 Ga0068855_10000250612 157
159 3300005563 Ga0068855_100060864 Ga0068855_1000608643 157
160 3300005564 Ga0070664_100980473 Ga0070664_1009804731 157
161 3300005614 Ga0068856_100146283 Ga0068856_1001462832 157
162 3300005616 Ga0068852_100274052 Ga0068852_1002740522 157
163 3300006944 Ga0099823_1035496 Ga0099823_10354962 157
164 3300009011 Ga0105251_10000085 Ga0105251_1000008548 157
165 3300009011 Ga0105251_10000698 Ga0105251_1000069810 157
166 3300009011 Ga0105251_10017437 Ga0105251_100174372 157
167 3300009036 Ga0105244_10011314 Ga0105244_100113141 157
168 3300009036 Ga0105244_10042310 Ga0105244_100423103 157
169 3300009036 Ga0105244_10338866 Ga0105244_103388661 157
170 3300009092 Ga0105250_10014716 Ga0105250_100147163 157
171 3300009092 Ga0105250_10230549 Ga0105250_102305492 157
172 3300009093 Ga0105240_10001792 Ga0105240_1000179221 157
173 3300009093 Ga0105240_10007379 Ga0105240_1000737912 157
174 3300009093 Ga0105240_10172564 Ga0105240_101725643 157
175 3300009093 Ga0105240_10794936 Ga0105240_107949362 157
176 3300009148 Ga0105243_10996377 Ga0105243_109963771 157
177 3300009545 Ga0105237_10052527 Ga0105237_100525272 157
178 3300009545 Ga0105237_10335215 Ga0105237_103352151 157
179 3300009551 Ga0105238_10417613 Ga0105238_104176132 157
180 3300010375 Ga0105239_10002612 Ga0105239_100026125 157
181 3300010375 Ga0105239_10007147 Ga0105239_1000714712 157
182 3300013100 Ga0157373_10004430 Ga0157373_100044308 157
183 3300013100 Ga0157373_10005506 Ga0157373_100055065 157
184 3300013100 Ga0157373_10275947 Ga0157373_102759472 157
185 3300013100 Ga0157373_10716774 Ga0157373_107167742 157
186 3300013104 Ga0157370_10001612 Ga0157370_1000161213 157
187 3300013104 Ga0157370_10145763 Ga0157370_101457633 157
188 3300013105 Ga0157369_10001415 Ga0157369_1000141512 157
189 3300013105 Ga0157369_10038787 Ga0157369_100387872 157
190 3300013105 Ga0157369_10114720 Ga0157369_101147202 157
191 3300013296 Ga0157374_10000141 Ga0157374_1000014136 157
192 3300013307 Ga0157372_10001060 Ga0157372_1000106027 157
193 3300013307 Ga0157372_10002830 Ga0157372_1000283010 157
194 3300013307 Ga0157372_10691818 Ga0157372_106918182 157
195 3300014497 Ga0182008_10214231 Ga0182008_102142312 157
196 3300015261 Ga0182006_1019613 Ga0182006_10196132 157
197 3300015262 Ga0182007_10003332 Ga0182007_100033323 157
198 3300015265 Ga0182005_1016284 Ga0182005_10162842 157
199 3300016635 Ga0183361_10038 Ga0183361_1003820 157
200 3300025225 Ga0209566_100493 Ga0209566_1004939 157
201 3300025226 Ga0209674_100020 Ga0209674_100020342 157
202 3300025228 Ga0209672_100013 Ga0209672_100013456 157
203 3300025228 Ga0209672_100020 Ga0209672_100020200 157
204 3300025228 Ga0209672_100066 Ga0209672_100066138 157
205 3300025229 Ga0209147_100013 Ga0209147_100013332 157
206 3300025229 Ga0209147_100024 Ga0209147_100024200 157
207 3300025229 Ga0209147_100063 Ga0209147_10006336 157
208 3300025229 Ga0209147_100084 Ga0209147_10008429 157
209 3300025230 Ga0209563_100484 Ga0209563_1004844 157
210 3300025231 Ga0207427_101111 Ga0207427_1011119 157
211 3300025242 Ga0209258_100016 Ga0209258_100016456 157
212 3300025242 Ga0209258_100084 Ga0209258_100084200 157
213 3300025242 Ga0209258_100117 Ga0209258_10011729 157
214 3300025254 Ga0209148_1000020 Ga0209148_1000020456 157
215 3300025254 Ga0209148_1000148 Ga0209148_1000148107 157
216 3300025254 Ga0209148_1000814 Ga0209148_10008145 157
217 3300025256 Ga0209759_1000022 Ga0209759_1000022116 157
218 3300025256 Ga0209759_1000217 Ga0209759_100021749 157
219 3300025256 Ga0209759_1002308 Ga0209759_10023082 157
220 3300025261 Ga0209233_1000055 Ga0209233_1000055195 157
221 3300025263 Ga0209565_1007335 Ga0209565_10073352 157
222 3300025272 Ga0209455_1000017 Ga0209455_1000017456 157
223 3300025272 Ga0209455_1000110 Ga0209455_100011029 157
224 3300025272 Ga0209455_1000298 Ga0209455_100029829 157
225 3300025273 Ga0209673_1000056 Ga0209673_10000566 157
226 3300025292 Ga0209676_1000548 Ga0209676_10005489 157
227 3300025295 Ga0209564_1001872 Ga0209564_10018726 157
228 3300025295 Ga0209564_1006691 Ga0209564_10066915 157
229 3300025302 Ga0207426_1000152 Ga0207426_1000152152 157
230 3300025711 Ga0207696_1000064 Ga0207696_100006457 157
231 3300025711 Ga0207696_1001253 Ga0207696_10012539 157
232 3300025711 Ga0207696_1005613 Ga0207696_10056134 157
233 3300025728 Ga0207655_1000455 Ga0207655_100045543 157
234 3300025728 Ga0207655_1001220 Ga0207655_10012204 157
235 3300025728 Ga0207655_1026427 Ga0207655_10264272 157
236 3300025735 Ga0207713_1000081 Ga0207713_100008154 157
237 3300025735 Ga0207713_1000760 Ga0207713_100076014 157
238 3300025735 Ga0207713_1006632 Ga0207713_10066324 157
239 3300025735 Ga0207713_1030237 Ga0207713_10302372 157
240 3300025735 Ga0207713_1115508 Ga0207713_11155082 157
241 3300025904 Ga0207647_10000264 Ga0207647_1000026425 157
242 3300025904 Ga0207647_10009503 Ga0207647_100095032 157
243 3300025904 Ga0207647_10082119 Ga0207647_100821193 157
244 3300025909 Ga0207705_10344596 Ga0207705_103445962 157
245 3300025913 Ga0207695_10000328 Ga0207695_1000032824 157
246 3300025913 Ga0207695_10080048 Ga0207695_100800482 157
247 3300025913 Ga0207695_10357976 Ga0207695_103579761 157
248 3300025913 Ga0207695_10499695 Ga0207695_104996952 157
249 3300025914 Ga0207671_10335062 Ga0207671_103350622 157
250 3300025919 Ga0207657_10000003 Ga0207657_10000003209 157
251 3300025919 Ga0207657_10001781 Ga0207657_100017812 157
252 3300025924 Ga0207694_10078316 Ga0207694_100783162 157
253 3300025932 Ga0207690_10000007 Ga0207690_10000007210 157
254 3300025935 Ga0207709_10006150 Ga0207709_100061503 157
255 3300025935 Ga0207709_10351595 Ga0207709_103515952 157
256 3300025944 Ga0207661_11419145 Ga0207661_114191451 157
257 3300025945 Ga0207679_10825585 Ga0207679_108255852 157
258 3300025949 Ga0207667_10023113 Ga0207667_100231134 157
259 3300025949 Ga0207667_10059601 Ga0207667_100596012 157
260 3300025986 Ga0207658_10287499 Ga0207658_102874991 157
261 3300026067 Ga0207678_10000064 Ga0207678_1000006447 157
262 3300026142 Ga0207698_10104694 Ga0207698_101046942 157
263 3300027312 Ga0209371_1000076 Ga0209371_100007646 157
264 3300027312 Ga0209371_1000106 Ga0209371_10001062 157
265 3300027312 Ga0209371_1014239 Ga0209371_10142391 157
266 3300030500 Ga0268256_1000077 Ga0268256_10000772 157
267 3300030500 Ga0268256_1000087 Ga0268256_100008792 157
268 3300030500 Ga0268256_1015786 Ga0268256_10157861 157
269 3300031548 Ga0307408_100083379 Ga0307408_1000833791 157
270 3300031548 Ga0307408_100220136 Ga0307408_1002201362 157
271 3300031911 Ga0307412_10039543 Ga0307412_100395432 157
272 3300033180 Ga0307510_10218842 Ga0307510_102188422 157
273 3300037312 Ga0395899_0000005 Ga0395899_0000005_765370_765861 157
274 3300037418 Ga0395900_0000003 Ga0395900_0000003_7106_7597 157
275 3300037418 Ga0395900_0745072 Ga0395900_0745072_233_724 157
276 3300037466 Ga0395898_0000003 Ga0395898_0000003_765390_765881 157
277 3300037471 Ga0395905_0000048 Ga0395905_0000048_154734_155225 157
278 3300039437 Ga0436365_0899666 Ga0436365_0899666_854_1342 157
279 3300042016 Ga0439463_003105 Ga0439463_003105_401_880 157
280 3300042016 Ga0439463_014774 Ga0439463_014774_1314_1793 157
281 3300044656 Ga0466969_0022810 Ga0466969_0022810_508_999 157
282 3300044684 Ga0466966_0000107 Ga0466966_0000107_39713_40204 157
283 3300044684 Ga0466966_0088971 Ga0466966_0088971_981_1472 157
284 3300044684 Ga0466966_0188986 Ga0466966_0188986_317_805 157
285 3300044693 Ga0466961_0041461 Ga0466961_0041461_1391_1882 157
286 3300044693 Ga0466961_0139186 Ga0466961_0139186_560_1051 157
287 3300044694 Ga0466963_0163660 Ga0466963_0163660_115_606 157
288 3300044765 Ga0466970_0131215 Ga0466970_0131215_194_685 157
289 3300044901 Ga0466960_0225108 Ga0466960_0225108_178_669 157
290 3300045049 Ga0466959_0004644 Ga0466959_0004644_475_966 157
291 3300045049 Ga0466959_0011760 Ga0466959_0011760_5673_6164 157
292 3300045836 Ga0466958_0021335 Ga0466958_0021335_1463_1954 157
293 3300046454 Ga0495592_0009048 Ga0495592_0009048_6336_6845 157
294 3300046454 Ga0495592_0096852 Ga0495592_0096852_69_578 157
295 3300046455 Ga0495603_0009881 Ga0495603_0009881_56_547 157
296 3300046455 Ga0495603_0249271 Ga0495603_0249271_119_628 157
297 3300046457 Ga0495590_0007935 Ga0495590_0007935_309_818 157
298 3300046457 Ga0495590_0047606 Ga0495590_0047606_634_1110 157
299 3300046457 Ga0495590_0172227 Ga0495590_0172227_216_707 157
300 3300046457 Ga0495590_0242051 Ga0495590_0242051_38_547 157
301 3300046458 Ga0495591_000105 Ga0495591_000105_88090_88569 157
302 3300046458 Ga0495591_001309 Ga0495591_001309_5838_6317 157
303 3300046458 Ga0495591_001445 Ga0495591_001445_11617_12126 157
304 3300046458 Ga0495591_003584 Ga0495591_003584_3131_3607 157
305 3300046458 Ga0495591_010608 Ga0495591_010608_2541_3017 157
306 3300046458 Ga0495591_027741 Ga0495591_027741_382_858 157
307 3300046459 Ga0495629_0000023 Ga0495629_0000023_46978_47487 157
308 3300046459 Ga0495629_0003059 Ga0495629_0003059_4605_5114 157
309 3300046459 Ga0495629_0072937 Ga0495629_0072937_1684_2169 157
310 3300046460 Ga0495638_0055158 Ga0495638_0055158_1632_2141 157
311 3300046461 Ga0495641_0132037 Ga0495641_0132037_561_1070 157
312 3300046462 Ga0495651_0004362 Ga0495651_0004362_6209_6718 157
313 3300046462 Ga0495651_0021965 Ga0495651_0021965_3331_3840 157
314 3300046462 Ga0495651_0281938 Ga0495651_0281938_424_933 157
315 3300046463 Ga0495653_0000234 Ga0495653_0000234_13674_14183 157
316 3300046463 Ga0495653_0081851 Ga0495653_0081851_1696_2205 157
317 3300046463 Ga0495653_0100116 Ga0495653_0100116_463_972 157
318 3300046463 Ga0495653_0145495 Ga0495653_0145495_1113_1622 157
319 3300046471 Ga0495650_0002467 Ga0495650_0002467_6140_6616 157
320 3300046471 Ga0495650_0005599 Ga0495650_0005599_4493_5002 157
321 3300046472 Ga0495580_0000070 Ga0495580_0000070_28288_28797 157
322 3300046472 Ga0495580_0000442 Ga0495580_0000442_27657_28181 157
323 3300046472 Ga0495580_0004916 Ga0495580_0004916_7653_8162 157
324 3300046472 Ga0495580_0031229 Ga0495580_0031229_503_1012 157
325 3300046472 Ga0495580_0187052 Ga0495580_0187052_916_1401 157
326 3300046472 Ga0495580_0456873 Ga0495580_0456873_279_788 157
327 3300046473 Ga0495582_0006667 Ga0495582_0006667_5296_5805 157
328 3300046473 Ga0495582_0017648 Ga0495582_0017648_790_1299 157
329 3300046473 Ga0495582_0096904 Ga0495582_0096904_999_1508 157
330 3300046473 Ga0495582_0280019 Ga0495582_0280019_252_761 157
331 3300046474 Ga0495605_0000342 Ga0495605_0000342_24551_25060 157
332 3300046474 Ga0495605_0001752 Ga0495605_0001752_4927_5406 157
333 3300046474 Ga0495605_0002036 Ga0495605_0002036_11200_11679 157
334 3300046474 Ga0495605_0007125 Ga0495605_0007125_1971_2462 157
335 3300046474 Ga0495605_0010647 Ga0495605_0010647_956_1441 157
336 3300046474 Ga0495605_0037793 Ga0495605_0037793_97_606 157
337 3300046474 Ga0495605_0121699 Ga0495605_0121699_641_1117 157
338 3300046476 Ga0495662_0013116 Ga0495662_0013116_2066_2575 157
339 3300046477 Ga0495664_0085111 Ga0495664_0085111_979_1488 157
340 3300046477 Ga0495664_0216277 Ga0495664_0216277_228_737 157
341 3300046477 Ga0495664_0235030 Ga0495664_0235030_362_847 157
342 3300046477 Ga0495664_0371360 Ga0495664_0371360_46_555 157
343 3300046491 Ga0495584_0036023 Ga0495584_0036023_971_1462 157
344 3300046491 Ga0495584_0201046 Ga0495584_0201046_130_609 157
345 3300046492 Ga0495585_0007176 Ga0495585_0007176_484_963 157
346 3300046492 Ga0495585_0133729 Ga0495585_0133729_271_747 157
347 3300046499 Ga0495594_0132853 Ga0495594_0132853_221_730 157
348 3300046500 Ga0495596_0001240 Ga0495596_0001240_11672_12181 157
349 3300046500 Ga0495596_0016780 Ga0495596_0016780_1340_1816 157
350 3300046501 Ga0495607_0000173 Ga0495607_0000173_738_1217 157
351 3300046501 Ga0495607_0004256 Ga0495607_0004256_5681_6160 157
352 3300046501 Ga0495607_0008198 Ga0495607_0008198_355_834 157
353 3300046501 Ga0495607_0019226 Ga0495607_0019226_100_579 157
354 3300046501 Ga0495607_0019516 Ga0495607_0019516_1357_1833 157
355 3300046501 Ga0495607_0030910 Ga0495607_0030910_1228_1719 157
356 3300046501 Ga0495607_0034862 Ga0495607_0034862_507_983 157
357 3300046501 Ga0495607_0036108 Ga0495607_0036108_1087_1566 157
358 3300046501 Ga0495607_0264354 Ga0495607_0264354_65_541 157
359 3300046506 Ga0495583_0002802 Ga0495583_0002802_484_960 157
360 3300046506 Ga0495583_0005240 Ga0495583_0005240_7551_8060 157
361 3300046506 Ga0495583_0006154 Ga0495583_0006154_601_1092 157
362 3300046506 Ga0495583_0030512 Ga0495583_0030512_1665_2141 157
363 3300046506 Ga0495583_0126978 Ga0495583_0126978_366_845 157
364 3300046507 Ga0495606_0002796 Ga0495606_0002796_11595_12074 157
365 3300046507 Ga0495606_0039995 Ga0495606_0039995_2065_2544 157
366 3300046507 Ga0495606_0048943 Ga0495606_0048943_931_1440 157
367 3300046507 Ga0495606_0106670 Ga0495606_0106670_630_1109 157
368 3300046507 Ga0495606_0179558 Ga0495606_0179558_316_792 157
369 3300046507 Ga0495606_0206337 Ga0495606_0206337_543_1052 157
370 3300046507 Ga0495606_0225929 Ga0495606_0225929_322_831 157
371 3300046507 Ga0495606_0252839 Ga0495606_0252839_464_949 157
372 3300046511 Ga0495608_0013727 Ga0495608_0013727_250_759 157
373 3300046512 Ga0495610_0028524 Ga0495610_0028524_1081_1557 157
374 3300046513 Ga0495616_0025147 Ga0495616_0025147_1649_2140 157
375 3300046513 Ga0495616_0031354 Ga0495616_0031354_1305_1781 157
376 3300046513 Ga0495616_0076940 Ga0495616_0076940_652_1128 157
377 3300046514 Ga0495618_0005116 Ga0495618_0005116_7242_7751 157
378 3300046514 Ga0495618_0033954 Ga0495618_0033954_1804_2313 157
379 3300046514 Ga0495618_0075091 Ga0495618_0075091_302_811 157
380 3300046514 Ga0495618_0404764 Ga0495618_0404764_96_605 157
381 3300046515 Ga0495620_0001842 Ga0495620_0001842_5795_6274 157
382 3300046515 Ga0495620_0004360 Ga0495620_0004360_786_1262 157
383 3300046515 Ga0495620_0005341 Ga0495620_0005341_1987_2496 157
384 3300046515 Ga0495620_0008704 Ga0495620_0008704_1028_1507 157
385 3300046515 Ga0495620_0026248 Ga0495620_0026248_1887_2363 157
386 3300046515 Ga0495620_0156503 Ga0495620_0156503_116_595 157
387 3300046516 Ga0495628_0009399 Ga0495628_0009399_479_988 157
388 3300046516 Ga0495628_0034710 Ga0495628_0034710_2519_3028 157
389 3300046516 Ga0495628_0258617 Ga0495628_0258617_516_1025 157
390 3300046516 Ga0495628_0362666 Ga0495628_0362666_295_804 157
391 3300046516 Ga0495628_0548140 Ga0495628_0548140_52_561 157
392 3300046517 Ga0495630_0002732 Ga0495630_0002732_7016_7525 157
393 3300046517 Ga0495630_0009554 Ga0495630_0009554_4760_5269 157
394 3300046518 Ga0495631_0002675 Ga0495631_0002675_3966_4442 157
395 3300046518 Ga0495631_0004023 Ga0495631_0004023_1098_1574 157
396 3300046518 Ga0495631_0070150 Ga0495631_0070150_405_884 157
397 3300046519 Ga0495632_0009149 Ga0495632_0009149_523_999 157
398 3300046519 Ga0495632_0067230 Ga0495632_0067230_589_1068 157
399 3300046519 Ga0495632_0135495 Ga0495632_0135495_176_655 157
400 3300046519 Ga0495632_0357076 Ga0495632_0357076_130_609 157
401 3300046520 Ga0495637_0000695 Ga0495637_0000695_7663_8139 157
402 3300046520 Ga0495637_0002785 Ga0495637_0002785_8347_8823 157
403 3300046520 Ga0495637_0057831 Ga0495637_0057831_867_1343 157
404 3300046520 Ga0495637_0092574 Ga0495637_0092574_272_751 157
405 3300046520 Ga0495637_0098202 Ga0495637_0098202_204_680 157
406 3300046522 Ga0495643_0011532 Ga0495643_0011532_54_530 157
407 3300046522 Ga0495643_0071602 Ga0495643_0071602_1070_1546 157
408 3300046523 Ga0495644_0003826 Ga0495644_0003826_261_737 157
409 3300046523 Ga0495644_0056604 Ga0495644_0056604_591_1067 157
410 3300046524 Ga0495648_0008380 Ga0495648_0008380_1821_2306 157
411 3300046524 Ga0495648_0019266 Ga0495648_0019266_490_969 157
412 3300046524 Ga0495648_0021955 Ga0495648_0021955_1096_1587 157
413 3300046524 Ga0495648_0045554 Ga0495648_0045554_1594_2070 157
414 3300046524 Ga0495648_0069230 Ga0495648_0069230_169_678 157
415 3300046524 Ga0495648_0164193 Ga0495648_0164193_490_969 157
416 3300046524 Ga0495648_0168688 Ga0495648_0168688_266_745 157
417 3300046524 Ga0495648_0180205 Ga0495648_0180205_52_561 157
418 3300046524 Ga0495648_0198961 Ga0495648_0198961_284_793 157
419 3300046524 Ga0495648_0212640 Ga0495648_0212640_146_622 157
420 3300046526 Ga0495666_0001367 Ga0495666_0001367_7446_7955 157
421 3300046526 Ga0495666_0005663 Ga0495666_0005663_1732_2241 157
422 3300046526 Ga0495666_0016734 Ga0495666_0016734_611_1120 157
423 3300046526 Ga0495666_0374571 Ga0495666_0374571_80_589 157
424 3300046526 Ga0495666_0470276 Ga0495666_0470276_30_521 157
425 3300046528 Ga0495642_0103649 Ga0495642_0103649_463_954 157
426 3300046529 Ga0495652_0013524 Ga0495652_0013524_4174_4683 157
427 3300046529 Ga0495652_0022476 Ga0495652_0022476_4930_5439 157
428 3300046529 Ga0495652_0111075 Ga0495652_0111075_52_561 157
429 3300046529 Ga0495652_0341374 Ga0495652_0341374_280_765 157
430 3300046530 Ga0495654_0003870 Ga0495654_0003870_5956_6432 157
431 3300046530 Ga0495654_0040648 Ga0495654_0040648_844_1320 157
432 3300046530 Ga0495654_0059040 Ga0495654_0059040_781_1260 157
433 3300046530 Ga0495654_0063119 Ga0495654_0063119_148_627 157
434 3300046530 Ga0495654_0100479 Ga0495654_0100479_351_830 157
435 3300046531 Ga0495665_0001394 Ga0495665_0001394_5445_5954 157
436 3300046531 Ga0495665_0092564 Ga0495665_0092564_1042_1551 157
437 3300046531 Ga0495665_0141875 Ga0495665_0141875_502_1011 157
438 3300046531 Ga0495665_0177214 Ga0495665_0177214_561_1052 157
439 3300046533 Ga0495640_0008752 Ga0495640_0008752_2737_3246 157
440 3300046533 Ga0495640_0009250 Ga0495640_0009250_3413_3922 157
441 3300046535 Ga0495586_0235618 Ga0495586_0235618_298_807 157
442 3300046535 Ga0495586_0280483 Ga0495586_0280483_357_866 157
443 3300046538 Ga0495609_0000223 Ga0495609_0000223_33274_33750 157
444 3300046538 Ga0495609_0017516 Ga0495609_0017516_432_920 157
445 3300046542 Ga0495597_0255011 Ga0495597_0255011_82_573 157
446 3300046542 Ga0495597_0264763 Ga0495597_0264763_19_495 157
447 3300046543 Ga0495645_0048250 Ga0495645_0048250_2246_2755 157
448 3300046543 Ga0495645_0083266 Ga0495645_0083266_106_585 157
449 3300046543 Ga0495645_0203041 Ga0495645_0203041_44_553 157
450 3300046543 Ga0495645_0354417 Ga0495645_0354417_88_597 157
451 3300046543 Ga0495645_0387611 Ga0495645_0387611_65_550 157
452 3300046543 Ga0495645_0451869 Ga0495645_0451869_19_522 157
453 3300046557 Ga0495622_0000183 Ga0495622_0000183_45316_45825 157
454 3300046557 Ga0495622_0008748 Ga0495622_0008748_414_905 157
455 3300046559 Ga0495667_0043416 Ga0495667_0043416_655_1164 157
456 3300046559 Ga0495667_0309754 Ga0495667_0309754_76_585 157
457 3300046616 Ga0495668_0002851 Ga0495668_0002851_6921_7397 157
458 3300046616 Ga0495668_0029151 Ga0495668_0029151_537_1013 157
459 3300046616 Ga0495668_0182790 Ga0495668_0182790_357_833 157
460 3300046642 Ga0495634_0013804 Ga0495634_0013804_717_1226 157
461 3300046642 Ga0495634_0057402 Ga0495634_0057402_1644_2153 157
462 3300046642 Ga0495634_0231627 Ga0495634_0231627_317_826 157
463 3300046648 Ga0495611_0001214 Ga0495611_0001214_8255_8734 157
464 3300046648 Ga0495611_0160883 Ga0495611_0160883_313_822 157
465 3300046648 Ga0495611_0263963 Ga0495611_0263963_272_781 157
466 3300046660 Ga0495625_0000027 Ga0495625_0000027_118910_119389 157
467 3300046660 Ga0495625_0229632 Ga0495625_0229632_278_754 157
468 3300046660 Ga0495625_0447488 Ga0495625_0447488_236_745 157
469 3300046663 Ga0495635_0007617 Ga0495635_0007617_5927_6436 157
470 3300046663 Ga0495635_0018845 Ga0495635_0018845_3104_3613 157
471 3300046665 Ga0495661_0000174 Ga0495661_0000174_1215_1691 157
472 3300046665 Ga0495661_0002898 Ga0495661_0002898_11519_12028 157
473 3300046665 Ga0495661_0010553 Ga0495661_0010553_1563_2042 157
474 3300046665 Ga0495661_0017322 Ga0495661_0017322_418_897 157
475 3300046665 Ga0495661_0074502 Ga0495661_0074502_978_1454 157
476 3300046675 Ga0495657_0066250 Ga0495657_0066250_861_1370 157
477 3300046678 Ga0495599_0085535 Ga0495599_0085535_680_1207 157
478 3300046678 Ga0495599_0107851 Ga0495599_0107851_218_727 157
479 3300046678 Ga0495599_0202746 Ga0495599_0202746_446_955 157
480 3300046679 Ga0495623_0017638 Ga0495623_0017638_179_688 157
481 3300046679 Ga0495623_0040674 Ga0495623_0040674_1067_1594 157
482 3300046680 Ga0495646_0002803 Ga0495646_0002803_4134_4643 157
483 3300046680 Ga0495646_0010215 Ga0495646_0010215_249_758 157
484 3300046680 Ga0495646_0022253 Ga0495646_0022253_1772_2281 157
485 3300046680 Ga0495646_0095080 Ga0495646_0095080_161_670 157
486 3300046689 Ga0495613_0091352 Ga0495613_0091352_1644_2153 157
487 3300046690 Ga0495624_0001456 Ga0495624_0001456_10297_10806 157
488 3300046690 Ga0495624_0007279 Ga0495624_0007279_2728_3237 157
489 3300046690 Ga0495624_0023447 Ga0495624_0023447_1644_2153 157
490 3300046690 Ga0495624_0277257 Ga0495624_0277257_388_897 157
491 3300046691 Ga0495670_0236644 Ga0495670_0236644_267_743 157
492 3300046692 Ga0495671_0002833 Ga0495671_0002833_2277_2753 157
493 3300046692 Ga0495671_0011254 Ga0495671_0011254_528_1007 157
494 3300046692 Ga0495671_0037929 Ga0495671_0037929_1590_2099 157
495 3300046692 Ga0495671_0084814 Ga0495671_0084814_1039_1530 157
496 3300046694 Ga0495649_0013597 Ga0495649_0013597_539_1048 157
497 3300046694 Ga0495649_0013741 Ga0495649_0013741_1163_1672 157
498 3300046694 Ga0495649_0024324 Ga0495649_0024324_1333_1809 157
499 3300046694 Ga0495649_0061884 Ga0495649_0061884_129_638 157
500 3300046694 Ga0495649_0183388 Ga0495649_0183388_418_909 157
501 3300046794 Ga0495589_0000865 Ga0495589_0000865_5036_5545 157
502 3300046794 Ga0495589_0136448 Ga0495589_0136448_255_746 157
503 3300046810 Ga0495660_0004495 Ga0495660_0004495_7554_8030 157
504 3300046810 Ga0495660_0004914 Ga0495660_0004914_3962_4441 157
505 3300046810 Ga0495660_0034780 Ga0495660_0034780_1809_2288 157
506 3300046810 Ga0495660_0041990 Ga0495660_0041990_345_854 157
507 3300047315 Ga0495581_0032292 Ga0495581_0032292_1818_2327 157
508 3300047317 Ga0495604_0001443 Ga0495604_0001443_8258_8785 157
509 3300047317 Ga0495604_0017057 Ga0495604_0017057_5227_5736 157
510 3300047317 Ga0495604_0294451 Ga0495604_0294451_305_808 157
511 3300047319 Ga0495674_0002804 Ga0495674_0002804_13558_14049 157
512 3300047319 Ga0495674_0012200 Ga0495674_0012200_7144_7653 157
513 3300047319 Ga0495674_0016911 Ga0495674_0016911_5534_6019 157
514 3300047319 Ga0495674_0029329 Ga0495674_0029329_251_754 157
515 3300047319 Ga0495674_0030152 Ga0495674_0030152_1367_1876 157
516 3300047319 Ga0495674_0035834 Ga0495674_0035834_503_1012 157
517 3300047319 Ga0495674_0165893 Ga0495674_0165893_446_955 157
518 3300047319 Ga0495674_0230733 Ga0495674_0230733_960_1469 157
519 3300047320 Ga0495672_0014049 Ga0495672_0014049_4123_4602 157
520 3300047320 Ga0495672_0018549 Ga0495672_0018549_873_1358 157
521 3300047320 Ga0495672_0029902 Ga0495672_0029902_582_1058 157
522 3300047320 Ga0495672_0043035 Ga0495672_0043035_1668_2147 157
523 3300047320 Ga0495672_0048034 Ga0495672_0048034_182_691 157
524 3300047320 Ga0495672_0048378 Ga0495672_0048378_1033_1524 157
525 3300047320 Ga0495672_0091522 Ga0495672_0091522_441_920 157
526 3300047321 Ga0495676_0000012 Ga0495676_0000012_115999_116475 157
527 3300047321 Ga0495676_0029017 Ga0495676_0029017_1721_2230 157
528 3300047321 Ga0495676_0037023 Ga0495676_0037023_767_1252 157
529 3300047321 Ga0495676_0092778 Ga0495676_0092778_843_1352 157
530 3300047321 Ga0495676_0356096 Ga0495676_0356096_218_727 157
531 3300047322 Ga0495680_0151318 Ga0495680_0151318_1121_1630 157
532 3300047323 Ga0495683_0002235 Ga0495683_0002235_10081_10590 157
533 3300047323 Ga0495683_0002674 Ga0495683_0002674_9190_9699 157
534 3300047323 Ga0495683_0009891 Ga0495683_0009891_3693_4184 157
535 3300047443 Ga0495687_010249 Ga0495687_010249_2191_2700 157
536 3300047443 Ga0495687_050515 Ga0495687_050515_1024_1515 157
537 3300047443 Ga0495687_063796 Ga0495687_063796_913_1422 157
538 3300047444 Ga0495675_0002674 Ga0495675_0002674_5413_5922 157
539 3300047444 Ga0495675_0003270 Ga0495675_0003270_5940_6449 157
540 3300047444 Ga0495675_0008142 Ga0495675_0008142_4602_5129 157
541 3300047446 Ga0495679_000022 Ga0495679_000022_211529_212038 157
542 3300047446 Ga0495679_000680 Ga0495679_000680_10630_11106 157
543 3300047446 Ga0495679_001491 Ga0495679_001491_8667_9176 157
544 3300047446 Ga0495679_005048 Ga0495679_005048_3926_4405 157
545 3300047469 Ga0495673_0002387 Ga0495673_0002387_7644_8153 157
546 3300047469 Ga0495673_0004488 Ga0495673_0004488_7920_8396 157
547 3300047469 Ga0495673_0008039 Ga0495673_0008039_1451_1930 157
548 3300047469 Ga0495673_0008460 Ga0495673_0008460_4891_5367 157
549 3300047469 Ga0495673_0011550 Ga0495673_0011550_546_1025 157
550 3300047469 Ga0495673_0029514 Ga0495673_0029514_844_1335 157
551 3300047469 Ga0495673_0047633 Ga0495673_0047633_410_889 157
552 3300047469 Ga0495673_0081046 Ga0495673_0081046_351_860 157
553 3300047469 Ga0495673_0117324 Ga0495673_0117324_56_535 157
554 3300047469 Ga0495673_0122006 Ga0495673_0122006_494_970 157
555 3300047470 Ga0495681_0023278 Ga0495681_0023278_379_855 157
556 3300047471 Ga0495684_0129791 Ga0495684_0129791_352_861 157
557 3300047471 Ga0495684_0624438 Ga0495684_0624438_194_703 157
558 3300047472 Ga0495686_0005197 Ga0495686_0005197_9434_9913 157
559 3300047472 Ga0495686_0053552 Ga0495686_0053552_896_1405 157
560 3300047673 Ga0495593_0003541 Ga0495593_0003541_3876_4385 157
561 3300047673 Ga0495593_0003959 Ga0495593_0003959_7620_8129 157
562 3300047673 Ga0495593_0010106 Ga0495593_0010106_3763_4272 157
563 3300048088 Ga0495602_0017649 Ga0495602_0017649_1291_1800 157
564 3300048088 Ga0495602_0076269 Ga0495602_0076269_1801_2328 157
565 3300048088 Ga0495602_0128488 Ga0495602_0128488_851_1360 157
566 3300048088 Ga0495602_0460955 Ga0495602_0460955_171_680 157
567 3300048088 Ga0495602_0463229 Ga0495602_0463229_114_623 157
568 3300048089 Ga0495614_0002865 Ga0495614_0002865_2264_2773 157
569 3300048089 Ga0495614_0003497 Ga0495614_0003497_1809_2318 157
570 3300048089 Ga0495614_0007822 Ga0495614_0007822_2630_3139 157
571 3300048091 Ga0495626_0000545 Ga0495626_0000545_22091_22567 157
572 3300048091 Ga0495626_0148593 Ga0495626_0148593_376_867 157
573 3300048091 Ga0495626_0175849 Ga0495626_0175849_17_526 157
574 3300048903 Ga0496100_0000093 Ga0496100_0000093_36158_36664 157
575 3300048903 Ga0496100_0002599 Ga0496100_0002599_474_965 157
576 3300048903 Ga0496100_0510272 Ga0496100_0510272_312_785 157
577 3300048904 Ga0496101_0000186 Ga0496101_0000186_14070_14576 157
578 3300048904 Ga0496101_0274900 Ga0496101_0274900_475_966 157
579 3300048905 Ga0496102_0000423 Ga0496102_0000423_9965_10471 157
580 3300048905 Ga0496102_0024648 Ga0496102_0024648_887_1396 157
581 3300048905 Ga0496102_0102093 Ga0496102_0102093_1335_1844 157
582 3300048905 Ga0496102_0570613 Ga0496102_0570613_457_936 157
583 3300048906 Ga0496103_0000245 Ga0496103_0000245_38392_38898 157
584 3300048906 Ga0496103_0028516 Ga0496103_0028516_59_568 157
585 3300048906 Ga0496103_0082138 Ga0496103_0082138_435_944 157
586 3300048907 Ga0496104_1159577 Ga0496104_1159577_119_607 157
587 3300048908 Ga0496105_0159878 Ga0496105_0159878_475_966 157
588 3300048909 Ga0496106_0022595 Ga0496106_0022595_205_696 157
589 3300048909 Ga0496106_0103542 Ga0496106_0103542_93_599 157
590 3300048913 Ga0496110_0612652 Ga0496110_0612652_407_880 157
591 3300048913 Ga0496110_0687879 Ga0496110_0687879_47_526 157
592 3300048916 Ga0496113_0024846 Ga0496113_0024846_251_742 157
593 3300048917 Ga0496114_0066226 Ga0496114_0066226_1506_1982 157
594 3300048917 Ga0496114_1316651 Ga0496114_1316651_23_514 157
595 3300048918 Ga0496115_0026743 Ga0496115_0026743_50_541 157
596 3300048918 Ga0496115_0471632 Ga0496115_0471632_220_705 157
597 3300048919 Ga0496116_0029460 Ga0496116_0029460_2561_3061 157
598 3300048919 Ga0496116_0212065 Ga0496116_0212065_202_696 157
599 3300048920 Ga0496117_0000704 Ga0496117_0000704_14040_14546 157
600 3300048920 Ga0496117_0003780 Ga0496117_0003780_11643_12116 157
601 3300048920 Ga0496117_0008849 Ga0496117_0008849_560_1069 157
602 3300048920 Ga0496117_0072488 Ga0496117_0072488_1709_2209 157
603 3300048920 Ga0496117_0182271 Ga0496117_0182271_300_788 157
604 3300048921 Ga0496118_0000400 Ga0496118_0000400_33697_34197 157
605 3300048921 Ga0496118_0000644 Ga0496118_0000644_44717_45226 157
606 3300048921 Ga0496118_0000733 Ga0496118_0000733_14098_14604 157
607 3300048921 Ga0496118_0004167 Ga0496118_0004167_5292_5765 157
608 3300048921 Ga0496118_0031655 Ga0496118_0031655_665_1174 157
609 3300048921 Ga0496118_0045699 Ga0496118_0045699_271_759 157
610 3300048921 Ga0496118_0119512 Ga0496118_0119512_30_509 157
611 3300048921 Ga0496118_0446739 Ga0496118_0446739_29_505 157
612 3300048922 Ga0496119_0039678 Ga0496119_0039678_177_662 157
613 3300048922 Ga0496119_0055355 Ga0496119_0055355_1502_1981 157
614 3300048922 Ga0496119_0137013 Ga0496119_0137013_319_810 157
615 3300048924 Ga0496121_0002178 Ga0496121_0002178_24316_24807 157
616 3300048924 Ga0496121_0003032 Ga0496121_0003032_9805_10311 157
617 3300048924 Ga0496121_0005413 Ga0496121_0005413_6605_7084 157
618 3300048924 Ga0496121_0018363 Ga0496121_0018363_4351_4827 157
619 3300048924 Ga0496121_0032686 Ga0496121_0032686_1065_1574 157
620 3300048924 Ga0496121_0155185 Ga0496121_0155185_929_1417 157
621 3300048925 Ga0496122_0000370 Ga0496122_0000370_70710_71186 157
622 3300048925 Ga0496122_0330241 Ga0496122_0330241_37_525 157
623 3300048926 Ga0496123_0000135 Ga0496123_0000135_123947_124423 157
624 3300048926 Ga0496123_0144072 Ga0496123_0144072_500_1006 157
625 3300048927 Ga0496124_0003720 Ga0496124_0003720_11505_11984 157
626 3300048927 Ga0496124_0006911 Ga0496124_0006911_11257_11736 157
627 3300048927 Ga0496124_0029188 Ga0496124_0029188_389_862 157
628 3300048927 Ga0496124_0037219 Ga0496124_0037219_2669_3142 157
629 3300048927 Ga0496124_0165339 Ga0496124_0165339_188_679 157
630 3300048927 Ga0496124_0191060 Ga0496124_0191060_241_717 157
631 3300048928 Ga0496125_0002910 Ga0496125_0002910_5220_5693 157
632 3300048928 Ga0496125_0032634 Ga0496125_0032634_126_599 157
633 3300048929 Ga0496126_0000319 Ga0496126_0000319_8540_9049 157
634 3300048929 Ga0496126_0073302 Ga0496126_0073302_2395_2868 157
635 3300048929 Ga0496126_0098621 Ga0496126_0098621_1860_2351 157
636 3300048929 Ga0496126_0800769 Ga0496126_0800769_10_519 157
637 3300048929 Ga0496126_1215516 Ga0496126_1215516_49_522 157
638 3300049459 Ga0495678_001576 Ga0495678_001576_9393_9869 157
639 3300049459 Ga0495678_031512 Ga0495678_031512_17_493 157
640 3300049459 Ga0495678_035581 Ga0495678_035581_59_535 157
641 3300049459 Ga0495678_044758 Ga0495678_044758_868_1359 157
642 3300049459 Ga0495678_045697 Ga0495678_045697_733_1242 157
643 3300049459 Ga0495678_047245 Ga0495678_047245_844_1323 157
644 3300049460 Ga0495682_0009335 Ga0495682_0009335_863_1342 157
645 3300049460 Ga0495682_0028854 Ga0495682_0028854_298_873 157
646 3300049460 Ga0495682_0057584 Ga0495682_0057584_659_1150 157
647 3300049460 Ga0495682_0059806 Ga0495682_0059806_506_1015 157
648 3300049460 Ga0495682_0188006 Ga0495682_0188006_155_664 157
649 3300053083 Ga0495655_0097155 Ga0495655_0097155_165_650 157
650 3300053142 Ga0500577_0259147 Ga0500577_0259147_195_704 157
651 iso_pu_bacteria 2738541296 2738819174 157
652 iso_pu_bacteria 2738541298 2738831653 157
653 iso_pu_bacteria 2738541306 2738873181 157
654 iso_pu_bacteria 2738543002 2739184811 157
655 iso_pu_bacteria 2738543008 2739219780 157
656 iso_pu_bacteria 2945934425 2945940185 157
657 iso_pu_bacteria 2990703756 2990707316 157
658 iso_pu_bacteria 641736151 642423757 157
659 iso_pu_bacteria 641736154 642414170 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13279

4HBT_2

Thioesterase-like superfamily

36

157

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tbu-assembly1.cif.gz_C crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.9265 56 112
3ck1-assembly1.cif.gz_A crystal structure of a putative thioesterase (reut_a2179) from ralstonia eutropha jmp134 at 1.74 a resolution 0.9245 7 135
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9198 7 132
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9178 4 132
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9174 7 132
ID Description Score Start End Superfamily
5eo2C01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9292 1 137 3.10.129.10
2hljA01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9279 1 139 3.10.129.10
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9265 56 112 3.10.129.10
af_P41903_5_339_2.40.160.210 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9263 56 112 2.40.160.210
2hljA01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9212 1 139 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A349SF16-F1-model_v4 Thioesterase 0.9639 16 137
AF-A0A1Y5E2S4-F1-model_v4 Thioesterase 0.9452 20 135
AF-S5S9K2-F1-model_v4 deleted 0.9411 7 135
AF-A0A316GN31-F1-model_v4 (3S)-malyl-CoA thioesterase 0.9404 4 135 GO:0047617
AF-A0A520MR75-F1-model_v4 Acyl-CoA thioesterase 0.94 11 139 GO:0047617

Feature Viewer

pLDDT pTM Quality
93.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map