F473215

General Info

Members Datasets Scaffolds Average Seq Length
658 495 351 278

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_003950|Ga0500618_003950_2687_3556
Length 289
Sequence MKSEGYTMQVSDLFIYPLKSARGIAIPSAAIDAFGLAGDRRAMLVDPSGHFFTQRELQDLARIDIQPGPSYLRLKMDGKSDIVVPPPLPENRMDVVVWKAPVNASVADEATNKALSTWLGREVRMVFFDRLAKRVASPEWAGDDTPVTFADGYQILVTTTGSLKALNANLAAHGEGAVGMERFRPNIVIDIDEEWPEDRWAAIEIGGIRLDLVKPCARCIMTTQDQKTGSRDVPNPMPAMGRIRMSADRRVPGPLFGWNAVPRSEGSIKIGDAVTVLEERPDGWAFKRR

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
27 2519899620 Rhizobium sp. Pop5 Isolate Nodule
28 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
29 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
30 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
31 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
32 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
33 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
34 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
35 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
36 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
37 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
38 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
39 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
40 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
41 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
42 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
43 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
44 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
45 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
46 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
47 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
48 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
49 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
50 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
51 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
52 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
53 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
54 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
55 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
56 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
57 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
58 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
59 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
60 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
61 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
62 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
63 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
64 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
65 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
66 2643221568 Rhizobium sp. Root564 Isolate Unclassified
67 2643221582 Rhizobium sp. Root651 Isolate Unclassified
68 2643221599 Rhizobium sp. Root708 Isolate Unclassified
69 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
70 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
71 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
72 2643221693 Rhizobium sp. Root491 Isolate Unclassified
73 2643221719 Rhizobium sp. Root274 Isolate Unclassified
74 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
75 2718217882 Rhizobium sp. N741 Isolate Nodule
76 2718217927 Rhizobium sp. N324 Isolate Nodule
77 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
78 2718218009 Rhizobium sp. N561 Isolate Nodule
79 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
80 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
81 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
82 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
83 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
84 2718218363 Rhizobium sp. N113 Isolate Nodule
85 2718218365 Rhizobium sp. N731 Isolate Nodule
86 2718218366 Rhizobium sp. N621 Isolate Nodule
87 2718218423 Rhizobium sp. N941 Isolate Nodule
88 2721755514 Rhizobium sp. N6212 Isolate Nodule
89 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
90 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
91 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
92 2721755809 Rhizobium sp. N541 Isolate Nodule
93 2721755810 Rhizobium sp. N871 Isolate Nodule
94 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
95 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
96 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
97 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
98 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
99 2728369365 Rhizobium sp. N1341 Isolate Nodule
100 2728369397 Rhizobium sp. N1314 Isolate Nodule
101 2738541293 Rhizobium sp. GV031 Isolate Unclassified
102 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
103 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
104 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
105 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
106 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
107 2791355256 Rhizobium sp. M10 Isolate Nodule
108 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
109 2791355260 Rhizobium sp. L9 Isolate Nodule
110 2791355261 Rhizobium sp. J15 Isolate Nodule
111 2791355262 Rhizobium sp. M1 Isolate Nodule
112 2791355263 Rhizobium chutanense C5 Isolate Nodule
113 2791355264 Rhizobium sp. S9 Isolate Nodule
114 2791355265 Rhizobium sp. H4 Isolate Nodule
115 2791355266 Rhizobium sp. L43 Isolate Nodule
116 2791355267 Rhizobium sp. L18 Isolate Nodule
117 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
118 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
119 2802429633 Rhizobium anhuiense J3 Isolate Nodule
120 2802429634 Rhizobium anhuiense S10 Isolate Nodule
121 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
122 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
123 2802429637 Rhizobium anhuiense C15 Isolate Nodule
124 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
125 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
126 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
127 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
128 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
129 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
130 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
131 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
132 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
133 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
134 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
135 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
136 2838048938 Rhizobium pisi 27/80 Isolate Nodule
137 2838061910 Rhizobium phaseoli L15 Isolate Nodule
138 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
139 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
140 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
141 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
142 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
143 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
144 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
145 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
146 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
147 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
148 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
149 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
150 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
151 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
152 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
153 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
154 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
155 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
156 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
157 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
158 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
159 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
160 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
161 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
162 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
163 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
164 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
165 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
166 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
167 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
168 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
169 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
170 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
171 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
172 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
173 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
174 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
175 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
176 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
177 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
178 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
179 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
180 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
181 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
182 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
183 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
184 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
185 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
186 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
187 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
188 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
189 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
190 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
191 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
192 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
193 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
194 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
195 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
196 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
197 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
198 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
199 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
200 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
201 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
202 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
203 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
204 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
205 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
206 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
207 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
208 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
209 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
210 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
211 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
212 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
213 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
214 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
215 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
216 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
217 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
218 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
219 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
220 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
221 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
222 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
223 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
224 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
225 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
226 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
227 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
228 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
229 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
230 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
231 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
232 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
233 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
234 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
235 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
236 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
237 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
238 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
239 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
240 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
241 2933599457 Rhizobium phaseoli M3 Isolate Nodule
242 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
243 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
244 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
245 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
246 2936381700 Rhizobium chutanense C16 Isolate Unclassified
247 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
248 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
249 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
250 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
251 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
252 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
253 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
254 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
255 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
256 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
257 2996887358 Rhizobium sp. R711 Isolate Nodule
258 2996893221 Rhizobium sp. R635 Isolate Nodule
259 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
260 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
261 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
262 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
263 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
264 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
265 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
266 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
267 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
268 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
269 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
270 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
271 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
272 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
273 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
274 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
275 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
276 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
277 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
278 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
279 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
280 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
281 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
282 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
283 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
284 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
285 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
286 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
287 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
288 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
289 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
290 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
291 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
292 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
293 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
294 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
295 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
296 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
297 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
298 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
299 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
300 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
301 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
302 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
303 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
304 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
308 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
309 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
310 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
311 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
312 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
313 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
314 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
315 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
316 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
317 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
318 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
319 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
320 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
321 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
323 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
324 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
325 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
327 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
329 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
331 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
333 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
334 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
345 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
347 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
348 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
350 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
351 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
352 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
353 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
354 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
355 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
356 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
357 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
358 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
359 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
360 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
361 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
362 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
363 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
364 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
365 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
366 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
367 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
368 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
372 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
373 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
374 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
375 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
376 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
377 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
378 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
379 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
380 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
381 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
382 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
383 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
384 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
385 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
388 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
393 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
394 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
395 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
396 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
397 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
398 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
399 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
400 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
401 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
402 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
403 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
404 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
405 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
409 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
413 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
414 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
415 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
416 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
417 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
418 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
419 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
425 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
426 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
427 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
428 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
434 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
435 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
436 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
437 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
438 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
439 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
440 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
441 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
442 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
443 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
444 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
445 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
446 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
447 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
448 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
449 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
451 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
452 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
453 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
454 8005258706 Rhizobium sp. R693 Isolate Nodule
455 8005275841 Rhizobium sp. N4311 Isolate Nodule
456 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
457 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
458 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
459 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
460 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
461 8005321885 Rhizobium sp. R72 Isolate Nodule
462 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
463 8005382845 Rhizobium sp. R634 Isolate Nodule
464 8005395548 Rhizobium sp. R339 Isolate Nodule
465 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
466 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
467 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
468 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
469 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
470 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
471 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
472 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
473 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
474 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
475 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
476 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
477 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
478 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
479 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
480 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
481 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
482 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
483 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
484 8018176218 Rhizobium sp. N122 Isolate Nodule
485 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
486 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
487 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
488 8024501048 Rhizobium sp. H4 Isolate Nodule
489 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
490 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
491 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
492 8056382006 Rhizobium croatiense 13T Isolate Nodule
493 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
494 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
495 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.19
Metatranscriptomes 0.15
Isolates 46.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 17.17
Nodule 31.31
Rhizoplane 3.65
Rhizosphere 24.16
Stem 0
Stem Tuber 0
Unclassified 23.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001537 3300001979 Bacteria 10611
2 JGI25155J39150_1000032 3300002704 Bacteria 105511
3 JGI25156J39149_1000153 3300002705 Bacteria 50769
4 JGI25162J39368_1001013 3300002737 Bacteria 17524
5 JGI25162J39368_1001557 3300002737 Bacteria 11750
6 JGI25154J39366_1000152 3300002738 Bacteria 53779
7 JGI25158J39367_1000020 3300002739 Bacteria 40034
8 JGI25157J39369_1000061 3300002741 Bacteria 105511
9 JGI25152J39213_1000618 3300002773 Bacteria 19040
10 JGI25152J39213_1007132 3300002773 Bacteria 2933
11 JGI25152J39213_1010654 3300002773 Bacteria 2087
12 JGI25159J45721_1000361 3300002987 Bacteria 21136
13 JGI25159J45721_1000998 3300002987 Bacteria 12205
14 JGI25151J46595_10009223 3300003187 Bacteria 4689
15 JGI25151J46595_10010883 3300003187 Bacteria 4207
16 JGI25151J46595_10032551 3300003187 Bacteria 2019
17 JGI25165J46597_1001133 3300003214 Bacteria 16714
18 JGI25165J46597_1001496 3300003214 Bacteria 11938
19 JGI25153J46596_10002832 3300003215 Bacteria 9859
20 JGI25153J46596_10025895 3300003215 Bacteria 2087
21 rootH1_10040872 3300003316 Bacteria 7394
22 rootH2_10017238 3300003320 Bacteria 4357
23 rootL2_10045393 3300003322 Bacteria 13888
24 rootL2_10160178 3300003322 Bacteria 1850
25 JGI25160J50197_1000052 3300003354 Bacteria 127795
26 JGI25161J50226_1000005 3300003374 Bacteria 292548
27 JGI25161J50226_1000113 3300003374 Bacteria 63092
28 JGI25161J50226_1000133 3300003374 Bacteria 52508
29 Ga0055526_1001219 3300003771 Bacteria 18486
30 Ga0055526_1006378 3300003771 Bacteria 6413
31 Ga0055524_1011374 3300003775 Bacteria 3486
32 Ga0055524_1011837 3300003775 Bacteria 3382
33 Ga0055528_1001051 3300003790 Bacteria 18227
34 Ga0055530_10018212 3300003791 Bacteria 2174
35 Ga0055540_1009491 3300003792 Bacteria 3351
36 Ga0055540_1017734 3300003792 Bacteria 1977
37 Ga0055531_10006375 3300003794 Bacteria 6710
38 Ga0058692_1000888 3300003856 Bacteria 11774
39 Ga0055543_1000035 3300004625 Bacteria 127833
40 Ga0055543_1000048 3300004625 Bacteria 109807
41 Ga0065165_1000253 3300005262 Bacteria 92969
42 Ga0065165_1002487 3300005262 Bacteria 15488
43 Ga0065165_1036225 3300005262 Bacteria 1507
44 Ga0070670_100004253 3300005331 Bacteria 11976
45 Ga0070670_100649415 3300005331 Bacteria 946
46 Ga0070668_100227358 3300005347 Bacteria 1541
47 Ga0070668_100334923 3300005347 Bacteria 1277
48 Ga0070671_100058184 3300005355 Bacteria 3218
49 Ga0070663_100059259 3300005455 Bacteria 2752
50 Ga0070665_100025012 3300005548 Bacteria 6019
51 Ga0070665_100048021 3300005548 Bacteria 4286
52 Ga0068855_100171268 3300005563 Bacteria 2459
53 Ga0068856_100031643 3300005614 Bacteria 5178
54 Ga0075365_10000250 3300006038 Bacteria 18403
55 Ga0075365_10242454 3300006038 Bacteria 1266
56 Ga0075368_10030015 3300006042 Bacteria 2104
57 Ga0075364_10005219 3300006051 Bacteria 7541
58 Ga0075362_10016675 3300006177 Bacteria 3012
59 Ga0075367_10071575 3300006178 Bacteria 2086
60 Ga0075367_10157209 3300006178 Bacteria 1413
61 Ga0075367_10194215 3300006178 Bacteria 1267
62 Ga0075369_10000922 3300006186 Bacteria 9752
63 Ga0075369_10076060 3300006186 Bacteria 1483
64 Ga0079104_1000032 3300006946 Bacteria 203094
65 Ga0099826_10000859 3300006948 Bacteria 16488
66 Ga0099826_10018485 3300006948 Bacteria 5258
67 Ga0105240_10000032 3300009093 Bacteria 283907
68 Ga0105243_10009258 3300009148 Bacteria 7520
69 Ga0105248_10146700 3300009177 Bacteria 2662
70 Ga0105237_10001967 3300009545 Bacteria 26136
71 Ga0105249_10164591 3300009553 Bacteria 2146
72 Ga0105239_10004104 3300010375 Bacteria 17509
73 Ga0157373_10003685 3300013100 Bacteria 11585
74 Ga0157373_10259251 3300013100 Bacteria 1230
75 Ga0157371_10000380 3300013102 Bacteria 55836
76 Ga0157371_10322701 3300013102 Bacteria 1121
77 Ga0157370_10000748 3300013104 Bacteria 40596
78 Ga0157370_10000986 3300013104 Bacteria 35999
79 Ga0157369_10159075 3300013105 Bacteria 2385
80 Ga0157369_10312927 3300013105 Bacteria 1633
81 Ga0157369_10328664 3300013105 Bacteria 1589
82 Ga0182007_10001327 3300015262 Bacteria 13356
83 Ga0182005_1003450 3300015265 Bacteria 5361
84 Ga0209435_100042 3300025206 Bacteria 105563
85 Ga0209436_100064 3300025208 Bacteria 56015
86 Ga0209436_105847 3300025208 Bacteria 2768
87 Ga0209437_100033 3300025233 Bacteria 512520
88 Ga0209437_100075 3300025233 Bacteria 297202
89 Ga0207425_1029968 3300025245 Bacteria 1094
90 Ga0209646_1000145 3300025246 Bacteria 105563
91 Ga0209026_1000160 3300025250 Bacteria 105563
92 Ga0209677_104902 3300025253 Bacteria 3661
93 Ga0209759_1000177 3300025256 Bacteria 105563
94 Ga0209129_1000362 3300025258 Bacteria 37617
95 Ga0209129_1000592 3300025258 Bacteria 24759
96 Ga0209129_1002959 3300025258 Bacteria 7757
97 Ga0209129_1003939 3300025258 Bacteria 6154
98 Ga0209233_1000056 3300025261 Bacteria 438104
99 Ga0209233_1000064 3300025261 Bacteria 392156
100 Ga0209233_1000209 3300025261 Bacteria 115124
101 Ga0209673_1000254 3300025273 Bacteria 101508
102 Ga0209673_1002450 3300025273 Bacteria 12865
103 Ga0209130_1000006 3300025284 Bacteria 596528
104 Ga0209130_1000018 3300025284 Bacteria 388301
105 Ga0209676_1011847 3300025292 Bacteria 3478
106 Ga0209025_1000074 3300025294 Bacteria 277445
107 Ga0209025_1000080 3300025294 Bacteria 267244
108 Ga0209025_1001310 3300025294 Bacteria 33978
109 Ga0209025_1001555 3300025294 Bacteria 29161
110 Ga0209025_1016585 3300025294 Bacteria 4328
111 Ga0209564_1000233 3300025295 Bacteria 121692
112 Ga0209564_1000399 3300025295 Bacteria 77444
113 Ga0209564_1003413 3300025295 Bacteria 10909
114 Ga0209758_1000121 3300025297 Bacteria 192028
115 Ga0209758_1000737 3300025297 Bacteria 47765
116 Ga0209758_1001702 3300025297 Bacteria 24700
117 Ga0209758_1047729 3300025297 Bacteria 1529
118 Ga0209050_1004350 3300025298 Bacteria 9629
119 Ga0209256_1001044 3300025299 Bacteria 32321
120 Ga0209256_1006397 3300025299 Bacteria 6261
121 Ga0207426_1000044 3300025302 Bacteria 428043
122 Ga0207426_1000106 3300025302 Bacteria 244368
123 Ga0209051_1002851 3300025303 Bacteria 11913
124 Ga0209051_1026551 3300025303 Bacteria 2331
125 Ga0209257_1002587 3300025304 Bacteria 17594
126 Ga0207695_10000024 3300025913 Bacteria 632311
127 Ga0207671_10000548 3300025914 Bacteria 50646
128 Ga0207650_10027479 3300025925 Bacteria 4074
129 Ga0207644_10039006 3300025931 Bacteria 3351
130 Ga0207709_10041102 3300025935 Bacteria 2773
131 Ga0207668_10271659 3300025972 Bacteria 1386
132 Ga0207678_10039421 3300026067 Bacteria 4100
133 Ga0207702_10105350 3300026078 Bacteria 2498
134 Ga0209281_1000053 3300027111 Bacteria 309587
135 Ga0209371_1000021 3300027312 Bacteria 555864
136 Ga0209371_1002143 3300027312 Bacteria 11615
137 Ga0209371_1014964 3300027312 Bacteria 2106
138 Ga0209282_1000483 3300027666 Bacteria 19392
139 Ga0209813_10011275 3300027866 Bacteria 2333
140 Ga0268266_10002687 3300028379 Bacteria 18670
141 Ga0307515_10062680 3300028794 Bacteria 5243
142 Ga0268256_1000020 3300030500 Bacteria 557873
143 Ga0268256_1001181 3300030500 Bacteria 16760
144 Ga0268256_1002522 3300030500 Bacteria 9240
145 Ga0307405_10029256 3300031731 Bacteria 3219
146 Ga0307406_10018142 3300031901 Bacteria 4106
147 Ga0307412_10018618 3300031911 Bacteria 4184
148 Ga0439465_0005020 3300041413 Bacteria 4250
149 Ga0439465_0009454 3300041413 Bacteria 3071
150 Ga0439465_0030864 3300041413 Bacteria 1706
151 Ga0439465_0042314 3300041413 Bacteria 1476
152 Ga0451787_839244 3300041441 Bacteria 1336
153 Ga0451833_0037214 3300041491 Bacteria 2447
154 Ga0451839_1469187 3300041496 Bacteria 1050
155 Ga0439449_0042451 3300042007 Bacteria 1689
156 Ga0466963_0003021 3300044694 Bacteria 9519
157 Ga0466971_0037283 3300044719 Bacteria 2179
158 Ga0466970_0000377 3300044765 Bacteria 21647
159 Ga0466957_0021660 3300044842 Bacteria 3789
160 Ga0466958_0118022 3300045836 Bacteria 1659
161 Ga0495638_0000353 3300046460 Bacteria 57451
162 Ga0495650_0069153 3300046471 Bacteria 1391
163 Ga0495605_0004628 3300046474 Bacteria 8045
164 Ga0495585_0010463 3300046492 Bacteria 5517
165 Ga0495585_0014518 3300046492 Bacteria 4586
166 Ga0495585_0052437 3300046492 Bacteria 2258
167 Ga0495607_0060526 3300046501 Bacteria 2155
168 Ga0495607_0091871 3300046501 Bacteria 1643
169 Ga0495583_0002283 3300046506 Bacteria 16772
170 Ga0495606_0000914 3300046507 Bacteria 43775
171 Ga0495606_0017496 3300046507 Bacteria 5416
172 Ga0495606_0065512 3300046507 Bacteria 2308
173 Ga0495610_0002783 3300046512 Bacteria 14321
174 Ga0495610_0019250 3300046512 Bacteria 3828
175 Ga0495610_0083417 3300046512 Bacteria 1463
176 Ga0495616_0019290 3300046513 Bacteria 3723
177 Ga0495620_0015946 3300046515 Bacteria 3783
178 Ga0495620_0039783 3300046515 Bacteria 2075
179 Ga0495620_0043030 3300046515 Bacteria 1969
180 Ga0495631_0001313 3300046518 Bacteria 15229
181 Ga0495632_0002649 3300046519 Bacteria 13438
182 Ga0495643_0182379 3300046522 Bacteria 1019
183 Ga0495609_0010286 3300046538 Bacteria 4493
184 Ga0495622_0124670 3300046557 Bacteria 1175
185 Ga0495633_0008369 3300046558 Bacteria 5836
186 Ga0495633_0072469 3300046558 Bacteria 1606
187 Ga0495656_0031453 3300046615 Bacteria 2153
188 Ga0495668_0005184 3300046616 Bacteria 8949
189 Ga0495611_0003016 3300046648 Bacteria 7511
190 Ga0495625_0002953 3300046660 Bacteria 17720
191 Ga0495625_0135407 3300046660 Bacteria 1666
192 Ga0495625_0375067 3300046660 Bacteria 894
193 Ga0495588_0001302 3300046674 Bacteria 10683
194 Ga0495588_0075851 3300046674 Bacteria 1752
195 Ga0495657_0043799 3300046675 Bacteria 3049
196 Ga0495623_0226335 3300046679 Bacteria 1063
197 Ga0495670_0007267 3300046691 Bacteria 5446
198 Ga0495671_0234443 3300046692 Bacteria 887
199 Ga0495604_0043543 3300047317 Bacteria 3513
200 Ga0495636_0020148 3300047318 Bacteria 2686
201 Ga0495672_0015235 3300047320 Bacteria 5229
202 Ga0495683_0077096 3300047323 Bacteria 1630
203 Ga0495679_046487 3300047446 Bacteria 1321
204 Ga0495681_0014913 3300047470 Bacteria 4427
205 Ga0495686_0001094 3300047472 Bacteria 32227
206 Ga0495686_0016885 3300047472 Bacteria 4934
207 Ga0495686_0211448 3300047472 Bacteria 1108
208 Ga0495686_0283022 3300047472 Bacteria 921
209 Ga0496100_0003910 3300048903 Bacteria 7825
210 Ga0496101_0146855 3300048904 Bacteria 1801
211 Ga0496101_0399449 3300048904 Bacteria 1082
212 Ga0496102_0008391 3300048905 Bacteria 8848
213 Ga0496102_0173098 3300048905 Bacteria 2032
214 Ga0496103_0027637 3300048906 Bacteria 3438
215 Ga0496104_0037469 3300048907 Bacteria 4535
216 Ga0496105_0023236 3300048908 Bacteria 5027
217 Ga0496106_0048400 3300048909 Bacteria 3202
218 Ga0496107_0042291 3300048910 Bacteria 3273
219 Ga0496110_0135081 3300048913 Bacteria 2228
220 Ga0496111_0001122 3300048914 Bacteria 14834
221 Ga0496111_0061087 3300048914 Bacteria 2732
222 Ga0496113_0027859 3300048916 Bacteria 4056
223 Ga0496113_0133720 3300048916 Bacteria 1948
224 Ga0496114_0071964 3300048917 Bacteria 2907
225 Ga0496114_0195856 3300048917 Bacteria 1769
226 Ga0496116_0000036 3300048919 Bacteria 388508
227 Ga0496116_0006978 3300048919 Bacteria 10120
228 Ga0496116_0011699 3300048919 Bacteria 7231
229 Ga0496116_0017796 3300048919 Bacteria 5502
230 Ga0496116_0046695 3300048919 Bacteria 2921
231 Ga0496116_0068102 3300048919 Bacteria 2269
232 Ga0496116_0107458 3300048919 Bacteria 1649
233 Ga0496116_0114086 3300048919 Bacteria 1579
234 Ga0496117_0000002 3300048920 Bacteria 2483758
235 Ga0496117_0002153 3300048920 Bacteria 25711
236 Ga0496117_0024145 3300048920 Bacteria 4819
237 Ga0496117_0040942 3300048920 Bacteria 3401
238 Ga0496117_0055859 3300048920 Bacteria 2755
239 Ga0496118_0000214 3300048921 Bacteria 100898
240 Ga0496118_0000695 3300048921 Bacteria 54668
241 Ga0496118_0004792 3300048921 Bacteria 15799
242 Ga0496118_0009296 3300048921 Bacteria 9964
243 Ga0496118_0287450 3300048921 Bacteria 911
244 Ga0496119_0005012 3300048922 Bacteria 12912
245 Ga0496119_0019046 3300048922 Bacteria 5075
246 Ga0496119_0056642 3300048922 Bacteria 2374
247 Ga0496119_0077172 3300048922 Bacteria 1930
248 Ga0496119_0081267 3300048922 Bacteria 1867
249 Ga0496119_0082610 3300048922 Bacteria 1847
250 Ga0496119_0133509 3300048922 Bacteria 1349
251 Ga0496119_0139061 3300048922 Bacteria 1313
252 Ga0496119_0143550 3300048922 Bacteria 1286
253 Ga0496120_0000125 3300048923 Bacteria 128983
254 Ga0496120_0016315 3300048923 Bacteria 4858
255 Ga0496120_0026522 3300048923 Bacteria 3576
256 Ga0496120_0041901 3300048923 Bacteria 2677
257 Ga0496120_0166865 3300048923 Bacteria 1092
258 Ga0496121_0000001 3300048924 Bacteria 1830318
259 Ga0496121_0001632 3300048924 Bacteria 37117
260 Ga0496121_0005867 3300048924 Bacteria 15554
261 Ga0496121_0022682 3300048924 Bacteria 6077
262 Ga0496121_0031339 3300048924 Bacteria 4859
263 Ga0496121_0031878 3300048924 Bacteria 4806
264 Ga0496121_0080174 3300048924 Bacteria 2589
265 Ga0496122_0000001 3300048925 Bacteria 1827766
266 Ga0496122_0000009 3300048925 Bacteria 584024
267 Ga0496122_0003139 3300048925 Bacteria 22132
268 Ga0496122_0009743 3300048925 Bacteria 10037
269 Ga0496122_0017735 3300048925 Bacteria 6628
270 Ga0496122_0028863 3300048925 Bacteria 4693
271 Ga0496122_0029765 3300048925 Bacteria 4593
272 Ga0496122_0031879 3300048925 Bacteria 4372
273 Ga0496122_0154485 3300048925 Bacteria 1410
274 Ga0496122_0220290 3300048925 Bacteria 1089
275 Ga0496123_0000001 3300048926 Bacteria 1831497
276 Ga0496123_0000034 3300048926 Bacteria 274836
277 Ga0496123_0007403 3300048926 Bacteria 10359
278 Ga0496123_0010652 3300048926 Bacteria 8092
279 Ga0496123_0037069 3300048926 Bacteria 3448
280 Ga0496123_0038964 3300048926 Bacteria 3330
281 Ga0496123_0044310 3300048926 Bacteria 3043
282 Ga0496123_0044526 3300048926 Bacteria 3034
283 Ga0496123_0117530 3300048926 Bacteria 1503
284 Ga0496123_0119140 3300048926 Bacteria 1489
285 Ga0496124_0000133 3300048927 Bacteria 154328
286 Ga0496124_0003191 3300048927 Bacteria 20248
287 Ga0496124_0004429 3300048927 Bacteria 16380
288 Ga0496124_0031384 3300048927 Bacteria 4704
289 Ga0496124_0032219 3300048927 Bacteria 4632
290 Ga0496124_0037079 3300048927 Bacteria 4244
291 Ga0496124_0046921 3300048927 Bacteria 3698
292 Ga0496124_0086493 3300048927 Bacteria 2565
293 Ga0496124_0095545 3300048927 Bacteria 2415
294 Ga0496124_0097216 3300048927 Bacteria 2391
295 Ga0496124_0136348 3300048927 Bacteria 1943
296 Ga0496124_0143113 3300048927 Bacteria 1884
297 Ga0496124_0251897 3300048927 Bacteria 1305
298 Ga0496124_0290509 3300048927 Bacteria 1187
299 Ga0496125_0000001 3300048928 Bacteria 1766138
300 Ga0496125_0006310 3300048928 Bacteria 12871
301 Ga0496125_0009778 3300048928 Bacteria 9780
302 Ga0496125_0027121 3300048928 Bacteria 5200
303 Ga0496126_0000156 3300048929 Bacteria 158537
304 Ga0496126_0048613 3300048929 Bacteria 3874
305 Ga0496126_0132498 3300048929 Bacteria 2152
306 Ga0496126_0137143 3300048929 Bacteria 2109
307 Ga0496126_0149041 3300048929 Bacteria 2006
308 Ga0496126_0267194 3300048929 Bacteria 1420
309 Ga0501031_0230896 3300049568 Bacteria 1204
310 Ga0501032_0104204 3300049569 Bacteria 1879
311 Ga0501034_0139738 3300049571 Bacteria 2402
312 Ga0501034_0210410 3300049571 Bacteria 1900
313 Ga0501038_0294085 3300049574 Bacteria 1276
314 Ga0501047_0080246 3300049581 Bacteria 3136
315 Ga0501067_0050133 3300049583 Bacteria 2314
316 Ga0501073_0119356 3300049589 Bacteria 1828
317 Ga0501080_0107823 3300049742 Bacteria 2581
318 Ga0501083_0038640 3300049744 Bacteria 3244
319 Ga0501044_0273762 3300049823 Bacteria 1623
320 nmdc:mga00v17_1425_c1 3300050491 Bacteria 12551
321 nmdc:mga00v17_187_c1 3300050491 Bacteria 37112
322 nmdc:mga00v17_530_c1 3300050491 Bacteria 21410
323 nmdc:mga0yw44_153355_c1 3300050492 Bacteria 1504
324 nmdc:mga0yw44_18543_c1 3300050492 Bacteria 3816
325 nmdc:mga0yw44_320376_c1 3300050492 Bacteria 1041
326 nmdc:mga0k408_26172_c1 3300050493 Bacteria 1426
327 nmdc:mga06z11_21036_c1 3300050494 Bacteria 3025
328 nmdc:mga04h51_26027_c1 3300050495 Bacteria 1806
329 nmdc:mga0sz30_150_c1 3300050516 Bacteria 25823
330 nmdc:mga0sz30_34607_c1 3300050516 Bacteria 2104
331 nmdc:mga0sz30_3539_c1 3300050516 Bacteria 5634
332 Ga0500557_000339 3300053105 Bacteria 6105
333 Ga0500572_001399 3300053111 Bacteria 6626
334 Ga0500594_0004922 3300053118 Bacteria 2953
335 Ga0500607_098564 3300053121 Bacteria 1456
336 Ga0500618_000351 3300053125 Bacteria 32263
337 Ga0500618_000560 3300053125 Bacteria 23031
338 Ga0500618_003950 3300053125 Bacteria 4909
339 Ga0500618_011030 3300053125 Bacteria 2408
340 Ga0500568_0000565 3300053139 Bacteria 27186
341 Ga0500573_0036492 3300053140 Bacteria 2838
342 Ga0500590_010975 3300053148 Bacteria 4582
343 Ga0500616_0002376 3300053153 Bacteria 15771
344 Ga0500622_0000322 3300053156 Bacteria 48225
345 Ga0500624_000336 3300053157 Bacteria 15794
346 Ga0500627_0031130 3300053158 Bacteria 2239
347 Ga0500634_0007390 3300053161 Bacteria 5415
348 Ga0500634_0036559 3300053161 Bacteria 2673
349 Ga0500636_0000004 3300053177 Bacteria 202392
350 Ga0500636_0080075 3300053177 Bacteria 1883
351 Ga0587072_006949 3300059643 Bacteria 1741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10040872 rootH1_100408723 222
2 3300046660 Ga0495625_0375067 Ga0495625_0375067_32_739 232
3 3300047472 Ga0495686_0283022 Ga0495686_0283022_190_888 232
4 3300046692 Ga0495671_0234443 Ga0495671_0234443_102_839 237
5 iso_pu_bacteria 2513237138 2513865663 243
6 3300046538 Ga0495609_0010286 Ga0495609_0010286_2810_3556 245
7 3300048920 Ga0496117_0040942 Ga0496117_0040942_2617_3357 245
8 3300048921 Ga0496118_0287450 Ga0496118_0287450_128_868 245
9 3300048925 Ga0496122_0220290 Ga0496122_0220290_45_785 245
10 3300048926 Ga0496123_0117530 Ga0496123_0117530_695_1435 245
11 3300046519 Ga0495632_0002649 Ga0495632_0002649_8155_8904 246
12 3300048904 Ga0496101_0399449 Ga0496101_0399449_32_781 246
13 3300048907 Ga0496104_0037469 Ga0496104_0037469_26_775 246
14 3300048927 Ga0496124_0037079 Ga0496124_0037079_3423_4169 246
15 3300048922 Ga0496119_0133509 Ga0496119_0133509_16_759 247
16 3300048922 Ga0496119_0139061 Ga0496119_0139061_555_1298 247
17 3300048927 Ga0496124_0095545 Ga0496124_0095545_16_759 247
18 3300048927 Ga0496124_0251897 Ga0496124_0251897_547_1290 247
19 3300046679 Ga0495623_0226335 Ga0495623_0226335_296_1048 248
20 3300041496 Ga0451839_1469187 Ga0451839_1469187_83_940 249
21 3300048921 Ga0496118_0004792 Ga0496118_0004792_9981_10838 249
22 3300041491 Ga0451833_0037214 Ga0451833_0037214_1520_2377 250
23 3300046691 Ga0495670_0007267 Ga0495670_0007267_288_1145 251
24 3300002773 JGI25152J39213_1010654 JGI25152J39213_10106542 256
25 3300003187 JGI25151J46595_10032551 JGI25151J46595_100325512 256
26 3300003215 JGI25153J46596_10025895 JGI25153J46596_100258952 256
27 3300025245 Ga0207425_1029968 Ga0207425_10299682 256
28 3300025258 Ga0209129_1003939 Ga0209129_10039396 256
29 3300025294 Ga0209025_1001555 Ga0209025_100155518 256
30 3300025297 Ga0209758_1001702 Ga0209758_100170219 256
31 3300003771 Ga0055526_1006378 Ga0055526_10063783 257
32 3300003790 Ga0055528_1001051 Ga0055528_100105110 257
33 3300025273 Ga0209673_1000254 Ga0209673_100025473 257
34 3300025295 Ga0209564_1000233 Ga0209564_100023370 257
35 3300025299 Ga0209256_1001044 Ga0209256_100104428 257
36 3300005548 Ga0070665_100025012 Ga0070665_1000250124 259
37 3300006177 Ga0075362_10016675 Ga0075362_100166753 259
38 3300009148 Ga0105243_10009258 Ga0105243_100092586 259
39 3300013100 Ga0157373_10003685 Ga0157373_100036852 259
40 3300013102 Ga0157371_10000380 Ga0157371_1000038038 259
41 3300013104 Ga0157370_10000748 Ga0157370_1000074823 259
42 3300025935 Ga0207709_10041102 Ga0207709_100411023 259
43 3300027866 Ga0209813_10011275 Ga0209813_100112753 259
44 3300028379 Ga0268266_10002687 Ga0268266_100026872 259
45 3300046522 Ga0495643_0182379 Ga0495643_0182379_29_871 259
46 3300048919 Ga0496116_0046695 Ga0496116_0046695_1913_2755 259
47 3300048920 Ga0496117_0000002 Ga0496117_0000002_1538187_1539029 259
48 3300048921 Ga0496118_0000214 Ga0496118_0000214_9961_10803 259
49 3300048922 Ga0496119_0077172 Ga0496119_0077172_134_976 259
50 3300048922 Ga0496119_0082610 Ga0496119_0082610_872_1714 259
51 3300048923 Ga0496120_0000125 Ga0496120_0000125_106834_107676 259
52 3300048925 Ga0496122_0000001 Ga0496122_0000001_908976_909818 259
53 3300048926 Ga0496123_0000001 Ga0496123_0000001_912707_913549 259
54 3300048927 Ga0496124_0004429 Ga0496124_0004429_10398_11240 259
55 3300048929 Ga0496126_0132498 Ga0496126_0132498_409_1251 259
56 3300048929 Ga0496126_0267194 Ga0496126_0267194_409_1251 259
57 3300050491 nmdc:mga00v17_187_c1 nmdc:mga00v17_187_c1_30732_31574 259
58 3300050493 nmdc:mga0k408_26172_c1 nmdc:mga0k408_26172_c1_190_1032 259
59 3300050495 nmdc:mga04h51_26027_c1 nmdc:mga04h51_26027_c1_190_1032 259
60 3300050516 nmdc:mga0sz30_150_c1 nmdc:mga0sz30_150_c1_8390_9232 259
61 3300053125 Ga0500618_000351 Ga0500618_000351_17417_18265 259
62 3300047472 Ga0495686_0211448 Ga0495686_0211448_184_1041 260
63 3300048927 Ga0496124_0136348 Ga0496124_0136348_982_1830 261
64 3300049568 Ga0501031_0230896 Ga0501031_0230896_122_979 267
65 3300049571 Ga0501034_0139738 Ga0501034_0139738_1345_2202 267
66 3300049589 Ga0501073_0119356 Ga0501073_0119356_659_1516 267
67 3300049742 Ga0501080_0107823 Ga0501080_0107823_934_1791 267
68 3300049744 Ga0501083_0038640 Ga0501083_0038640_1794_2651 267
69 3300049823 Ga0501044_0273762 Ga0501044_0273762_693_1550 267
70 3300050492 nmdc:mga0yw44_18543_c1 nmdc:mga0yw44_18543_c1_1179_2021 267
71 3300005347 Ga0070668_100334923 Ga0070668_1003349231 268
72 3300006948 Ga0099826_10000859 Ga0099826_100008593 268
73 3300025972 Ga0207668_10271659 Ga0207668_102716591 268
74 3300027666 Ga0209282_1000483 Ga0209282_100048319 268
75 3300041441 Ga0451787_839244 Ga0451787_839244_46_903 268
76 3300046492 Ga0495585_0010463 Ga0495585_0010463_3076_3930 268
77 3300046515 Ga0495620_0039783 Ga0495620_0039783_1164_2018 268
78 3300047472 Ga0495686_0001094 Ga0495686_0001094_7745_8602 268
79 3300048928 Ga0496125_0009778 Ga0496125_0009778_1752_2594 268
80 3300003322 rootL2_10160178 rootL2_101601783 271
81 3300046558 Ga0495633_0072469 Ga0495633_0072469_565_1407 272
82 3300046674 Ga0495588_0001302 Ga0495588_0001302_4361_5203 272
83 3300047470 Ga0495681_0014913 Ga0495681_0014913_3543_4385 272
84 3300053157 Ga0500624_000336 Ga0500624_000336_9874_10716 272
85 3300053161 Ga0500634_0036559 Ga0500634_0036559_162_1004 272
86 3300046507 Ga0495606_0000914 Ga0495606_0000914_23445_24302 273
87 3300048924 Ga0496121_0031878 Ga0496121_0031878_3022_3879 273
88 3300006051 Ga0075364_10005219 Ga0075364_100052192 274
89 3300013100 Ga0157373_10259251 Ga0157373_102592512 274
90 3300050491 nmdc:mga00v17_530_c1 nmdc:mga00v17_530_c1_10612_11469 274
91 iso_pu_bacteria 2537561587 2537874454 276
92 iso_pu_bacteria 2554235003 2554247064 276
93 iso_pu_bacteria 2558860242 2559294289 276
94 iso_pu_bacteria 2599185210 2599602646 276
95 iso_pu_bacteria 2600255279 2601608723 276
96 iso_pu_bacteria 2600255308 2601745497 276
97 iso_pu_bacteria 2643221568 2643855914 276
98 iso_pu_bacteria 2643221582 2643918664 276
99 iso_pu_bacteria 2643221693 2644518793 276
100 iso_pu_bacteria 2808606387 2808985936 276
101 iso_pu_bacteria 2818991439 2819556056 276
102 iso_pu_bacteria 2838675328 2838676782 276
103 iso_pu_bacteria 2838714209 2838715666 276
104 iso_pu_bacteria 2838719591 2838720534 276
105 iso_pu_bacteria 2838724970 2838726422 276
106 iso_pu_bacteria 2841846520 2841847468 276
107 iso_pu_bacteria 2841859092 2841859996 276
108 iso_pu_bacteria 2842124991 2842126502 276
109 iso_pu_bacteria 2842130223 2842131675 276
110 iso_pu_bacteria 2842152218 2842153156 276
111 iso_pu_bacteria 2842170452 2842171909 276
112 iso_pu_bacteria 2842175837 2842176775 276
113 iso_pu_bacteria 2842187318 2842188774 276
114 iso_pu_bacteria 2842211629 2842213085 276
115 iso_pu_bacteria 2842224351 2842225296 276
116 iso_pu_bacteria 2842515876 2842516781 276
117 iso_pu_bacteria 2899792073 2899796553 276
118 iso_pu_bacteria 2899845264 2899847181 276
119 iso_pu_bacteria 2919114240 2919115869 276
120 iso_pu_bacteria 2919166419 2919167320 276
121 iso_pu_bacteria 2926754445 2926756809 276
122 iso_pu_bacteria 2926760298 2926761048 276
123 iso_pu_bacteria 2929138655 2929139476 276
124 iso_pu_bacteria 2933006813 2933007799 276
125 iso_pu_bacteria 2933011516 2933012577 276
126 iso_pu_bacteria 2933594066 2933595020 276
127 iso_pu_bacteria 2978969890 2978973752 276
128 iso_pu_bacteria 2979089926 2979093673 276
129 iso_pu_bacteria 2979095461 2979098943 276
130 iso_pu_bacteria 650716007 650739486 276
131 iso_pu_bacteria 8003570095 8003570529 276
132 iso_pu_bacteria 8005658619 8005660018 276
133 iso_pu_bacteria 8018150411 8018152199 276
134 iso_pu_bacteria 8054460903 8054461853 276
135 iso_pu_bacteria 2510917028 2511182781 277
136 iso_pu_bacteria 2513237088 2513596206 277
137 iso_pu_bacteria 2534681796 2535515675 277
138 iso_pu_bacteria 2582581294 2585203035 277
139 iso_pu_bacteria 2582581299 2585231538 277
140 iso_pu_bacteria 2582581304 2585256657 277
141 iso_pu_bacteria 2585427594 2585847261 277
142 iso_pu_bacteria 2599185236 2599723127 277
143 iso_pu_bacteria 2600254933 2600375223 277
144 iso_pu_bacteria 2643221599 2644007881 277
145 iso_pu_bacteria 2643221634 2644196471 277
146 iso_pu_bacteria 2643221643 2644242842 277
147 iso_pu_bacteria 2643221653 2644296882 277
148 iso_pu_bacteria 2643221719 2644655136 277
149 iso_pu_bacteria 2738541293 2738802119 277
150 iso_pu_bacteria 2738541317 2738946604 277
151 iso_pu_bacteria 2818991272 2819242597 277
152 iso_pu_bacteria 2818991461 2819684187 277
153 iso_pu_bacteria 2821123053 2821124214 277
154 iso_pu_bacteria 2854896431 2854897117 277
155 iso_pu_bacteria 2854916844 2854918265 277
156 iso_pu_bacteria 2891048133 2891052079 277
157 iso_pu_bacteria 2913308742 2913311022 277
158 iso_pu_bacteria 2979100975 2979105651 277
159 iso_pu_bacteria 2984509177 2984512503 277
160 iso_pu_bacteria 2984518228 2984521136 277
161 iso_pu_bacteria 2984537506 2984540430 277
162 iso_pu_bacteria 2984601300 2984602627 277
163 iso_pu_bacteria 2989776772 2989778131 277
164 iso_pu_bacteria 2995392953 2995393830 277
165 iso_pu_bacteria 2996887358 2996891534 277
166 iso_pu_bacteria 8005246636 8005251372 277
167 iso_pu_bacteria 8005258706 8005261760 277
168 iso_pu_bacteria 8005321885 8005326061 277
169 iso_pu_bacteria 8005542996 8005544306 277
170 iso_pu_bacteria 2509276021 2509387758 278
171 iso_pu_bacteria 2509276033 2509443119 278
172 iso_pu_bacteria 2510065019 2510132259 278
173 iso_pu_bacteria 2510461069 2510840294 278
174 iso_pu_bacteria 2510461076 2510898597 278
175 iso_pu_bacteria 2510917022 2511133533 278
176 iso_pu_bacteria 2510917030 2511197214 278
177 iso_pu_bacteria 2513237084 2513569096 278
178 iso_pu_bacteria 2513237085 2513580761 278
179 iso_pu_bacteria 2513237093 2513632796 278
180 iso_pu_bacteria 2513237103 2513709247 278
181 iso_pu_bacteria 2513237144 2513907567 278
182 iso_pu_bacteria 2513237146 2513925666 278
183 iso_pu_bacteria 2513237162 2514020792 278
184 iso_pu_bacteria 2515075009 2515111243 278
185 iso_pu_bacteria 2515154113 2515635970 278
186 iso_pu_bacteria 2515154114 2515642622 278
187 iso_pu_bacteria 2515154116 2515659232 278
188 iso_pu_bacteria 2515154134 2515740421 278
189 iso_pu_bacteria 2516653077 2517039885 278
190 iso_pu_bacteria 2516653085 2517075426 278
191 iso_pu_bacteria 2517093000 2517094016 278
192 iso_pu_bacteria 2517287029 2517405829 278
193 iso_pu_bacteria 2519899620 2520375297 278
194 iso_pu_bacteria 2524023209 2524460693 278
195 iso_pu_bacteria 2529292951 2530643934 278
196 iso_pu_bacteria 2582581298 2585220953 278
197 iso_pu_bacteria 2582581307 2585273303 278
198 iso_pu_bacteria 2582581308 2585278862 278
199 iso_pu_bacteria 2582581315 2585325524 278
200 iso_pu_bacteria 2582581316 2585329678 278
201 iso_pu_bacteria 2582581867 2585400169 278
202 iso_pu_bacteria 2585427526 2585527923 278
203 iso_pu_bacteria 2585427527 2585530660 278
204 iso_pu_bacteria 2585427528 2585541473 278
205 iso_pu_bacteria 2585427529 2585549947 278
206 iso_pu_bacteria 2585427530 2585554840 278
207 iso_pu_bacteria 2585427531 2585559397 278
208 iso_pu_bacteria 2585427590 2585822728 278
209 iso_pu_bacteria 2585427593 2585839394 278
210 iso_pu_bacteria 2585427608 2585902067 278
211 iso_pu_bacteria 2585427609 2585905227 278
212 iso_pu_bacteria 2585427634 2585999604 278
213 iso_pu_bacteria 2585428125 2587979658 278
214 iso_pu_bacteria 2599185170 2599418634 278
215 iso_pu_bacteria 2615840624 2616296253 278
216 iso_pu_bacteria 2615840626 2616305864 278
217 iso_pu_bacteria 2615840698 2616553894 278
218 iso_pu_bacteria 2617270742 2617383820 278
219 iso_pu_bacteria 2667528174 2671115356 278
220 iso_pu_bacteria 2718217882 2719180243 278
221 iso_pu_bacteria 2718217927 2719384813 278
222 iso_pu_bacteria 2718217997 2719664572 278
223 iso_pu_bacteria 2718218009 2719730992 278
224 iso_pu_bacteria 2718218199 2720490992 278
225 iso_pu_bacteria 2718218232 2720612354 278
226 iso_pu_bacteria 2718218233 2720619192 278
227 iso_pu_bacteria 2718218235 2720630594 278
228 iso_pu_bacteria 2718218269 2720774287 278
229 iso_pu_bacteria 2718218363 2721146337 278
230 iso_pu_bacteria 2718218365 2721157857 278
231 iso_pu_bacteria 2718218366 2721163216 278
232 iso_pu_bacteria 2718218423 2721398533 278
233 iso_pu_bacteria 2721755514 2722839386 278
234 iso_pu_bacteria 2721755556 2723026014 278
235 iso_pu_bacteria 2721755684 2723559558 278
236 iso_pu_bacteria 2721755685 2723566175 278
237 iso_pu_bacteria 2721755809 2724037346 278
238 iso_pu_bacteria 2721755810 2724043748 278
239 iso_pu_bacteria 2721755819 2724088894 278
240 iso_pu_bacteria 2721755822 2724103440 278
241 iso_pu_bacteria 2721755823 2724109285 278
242 iso_pu_bacteria 2724679232 2725948443 278
243 iso_pu_bacteria 2728369352 2730106950 278
244 iso_pu_bacteria 2728369365 2730163480 278
245 iso_pu_bacteria 2728369397 2730297489 278
246 iso_pu_bacteria 2738541333 2739035855 278
247 iso_pu_bacteria 2765235942 2766067644 278
248 iso_pu_bacteria 2775507049 2776912721 278
249 iso_pu_bacteria 2775507266 2778177420 278
250 iso_pu_bacteria 2791355256 2793296162 278
251 iso_pu_bacteria 2791355259 2793317483 278
252 iso_pu_bacteria 2791355260 2793321144 278
253 iso_pu_bacteria 2791355261 2793327173 278
254 iso_pu_bacteria 2791355262 2793333576 278
255 iso_pu_bacteria 2791355263 2793339845 278
256 iso_pu_bacteria 2791355264 2793347884 278
257 iso_pu_bacteria 2791355265 2793353530 278
258 iso_pu_bacteria 2791355266 2793358871 278
259 iso_pu_bacteria 2791355267 2793367806 278
260 iso_pu_bacteria 2802429605 2805926617 278
261 iso_pu_bacteria 2802429606 2805933424 278
262 iso_pu_bacteria 2802429633 2806046966 278
263 iso_pu_bacteria 2802429634 2806052549 278
264 iso_pu_bacteria 2802429635 2806058680 278
265 iso_pu_bacteria 2802429636 2806067552 278
266 iso_pu_bacteria 2802429637 2806073939 278
267 iso_pu_bacteria 2818991448 2819612253 278
268 iso_pu_bacteria 2818991453 2819639293 278
269 iso_pu_bacteria 2838016132 2838017243 278
270 iso_pu_bacteria 2838022645 2838023208 278
271 iso_pu_bacteria 2838029111 2838031376 278
272 iso_pu_bacteria 2838035591 2838037675 278
273 iso_pu_bacteria 2838042994 2838048032 278
274 iso_pu_bacteria 2838048938 2838049275 278
275 iso_pu_bacteria 2838061910 2838063280 278
276 iso_pu_bacteria 2838068647 2838074106 278
277 iso_pu_bacteria 2838661181 2838662682 278
278 iso_pu_bacteria 2838668709 2838670806 278
279 iso_pu_bacteria 2838680041 2838681297 278
280 iso_pu_bacteria 2838686498 2838688658 278
281 iso_pu_bacteria 2838694306 2838694668 278
282 iso_pu_bacteria 2838701080 2838703177 278
283 iso_pu_bacteria 2838707686 2838708046 278
284 iso_pu_bacteria 2838729681 2838730953 278
285 iso_pu_bacteria 2838736955 2838741295 278
286 iso_pu_bacteria 2838742623 2838744153 278
287 iso_pu_bacteria 2841840854 2841844808 278
288 iso_pu_bacteria 2841851746 2841856834 278
289 iso_pu_bacteria 2841864319 2841865523 278
290 iso_pu_bacteria 2842077413 2842080723 278
291 iso_pu_bacteria 2842110456 2842117803 278
292 iso_pu_bacteria 2842118031 2842121342 278
293 iso_pu_bacteria 2842140634 2842144530 278
294 iso_pu_bacteria 2842146304 2842147599 278
295 iso_pu_bacteria 2842156927 2842160004 278
296 iso_pu_bacteria 2842163707 2842168246 278
297 iso_pu_bacteria 2842180545 2842183379 278
298 iso_pu_bacteria 2842192696 2842197909 278
299 iso_pu_bacteria 2842198810 2842199636 278
300 iso_pu_bacteria 2842205361 2842207741 278
301 iso_pu_bacteria 2842217011 2842221162 278
302 iso_pu_bacteria 2842229732 2842235020 278
303 iso_pu_bacteria 2842237096 2842237457 278
304 iso_pu_bacteria 2842243621 2842245617 278
305 iso_pu_bacteria 2842250916 2842252665 278
306 iso_pu_bacteria 2842257432 2842259733 278
307 iso_pu_bacteria 2842264693 2842266974 278
308 iso_pu_bacteria 2842271015 2842274572 278
309 iso_pu_bacteria 2842278818 2842281464 278
310 iso_pu_bacteria 2842285085 2842287157 278
311 iso_pu_bacteria 2842291075 2842294379 278
312 iso_pu_bacteria 2842298080 2842302497 278
313 iso_pu_bacteria 2842304105 2842306816 278
314 iso_pu_bacteria 2842311132 2842314701 278
315 iso_pu_bacteria 2842317721 2842318693 278
316 iso_pu_bacteria 2842341865 2842343643 278
317 iso_pu_bacteria 2842357229 2842360770 278
318 iso_pu_bacteria 2842363717 2842365201 278
319 iso_pu_bacteria 2842370503 2842371760 278
320 iso_pu_bacteria 2842377471 2842380777 278
321 iso_pu_bacteria 2842384541 2842387848 278
322 iso_pu_bacteria 2842395702 2842398314 278
323 iso_pu_bacteria 2842402390 2842404425 278
324 iso_pu_bacteria 2842409023 2842410890 278
325 iso_pu_bacteria 2842415677 2842417654 278
326 iso_pu_bacteria 2842422224 2842427312 278
327 iso_pu_bacteria 2842428310 2842431105 278
328 iso_pu_bacteria 2842434925 2842436897 278
329 iso_pu_bacteria 2842441272 2842442975 278
330 iso_pu_bacteria 2842447887 2842453196 278
331 iso_pu_bacteria 2842462802 2842464986 278
332 iso_pu_bacteria 2842469257 2842471788 278
333 iso_pu_bacteria 2842475841 2842478029 278
334 iso_pu_bacteria 2842482326 2842482810 278
335 iso_pu_bacteria 2842489311 2842493717 278
336 iso_pu_bacteria 2842495871 2842497328 278
337 iso_pu_bacteria 2842502639 2842504838 278
338 iso_pu_bacteria 2842509118 2842509682 278
339 iso_pu_bacteria 2844454524 2844455175 278
340 iso_pu_bacteria 2852387548 2852389025 278
341 iso_pu_bacteria 2857516855 2857520333 278
342 iso_pu_bacteria 2857531043 2857531793 278
343 iso_pu_bacteria 2899803654 2899803734 278
344 iso_pu_bacteria 2919100787 2919103789 278
345 iso_pu_bacteria 2919171160 2919171485 278
346 iso_pu_bacteria 2919408235 2919409260 278
347 iso_pu_bacteria 2923556063 2923557614 278
348 iso_pu_bacteria 2933570622 2933573070 278
349 iso_pu_bacteria 2933586486 2933591332 278
350 iso_pu_bacteria 2933599457 2933604561 278
351 iso_pu_bacteria 2935894831 2935895190 278
352 iso_pu_bacteria 2935901341 2935904180 278
353 iso_pu_bacteria 2936367885 2936368168 278
354 iso_pu_bacteria 2936375103 2936381439 278
355 iso_pu_bacteria 2936381700 2936387433 278
356 iso_pu_bacteria 2996893221 2996896562 278
357 iso_pu_bacteria 3005409236 3005412401 278
358 iso_pu_bacteria 3005416602 3005417099 278
359 iso_pu_bacteria 3005445848 3005446717 278
360 iso_pu_bacteria 639633055 639647394 278
361 iso_pu_bacteria 8005275841 8005279532 278
362 iso_pu_bacteria 8005282627 8005284826 278
363 iso_pu_bacteria 8005289223 8005292751 278
364 iso_pu_bacteria 8005301065 8005304552 278
365 iso_pu_bacteria 8005307578 8005309124 278
366 iso_pu_bacteria 8005314921 8005315160 278
367 iso_pu_bacteria 8005376324 8005376655 278
368 iso_pu_bacteria 8005382845 8005386046 278
369 iso_pu_bacteria 8005395548 8005400170 278
370 iso_pu_bacteria 8005430974 8005432222 278
371 iso_pu_bacteria 8005460587 8005461887 278
372 iso_pu_bacteria 8005484373 8005485671 278
373 iso_pu_bacteria 8005497431 8005499287 278
374 iso_pu_bacteria 8005556819 8005558966 278
375 iso_pu_bacteria 8005563573 8005570396 278
376 iso_pu_bacteria 8005570704 8005572641 278
377 iso_pu_bacteria 8005619151 8005620482 278
378 iso_pu_bacteria 8005626139 8005627552 278
379 iso_pu_bacteria 8005645114 8005648310 278
380 iso_pu_bacteria 8005668836 8005670703 278
381 iso_pu_bacteria 8005682033 8005684619 278
382 iso_pu_bacteria 8005688590 8005690975 278
383 iso_pu_bacteria 8005695170 8005698839 278
384 iso_pu_bacteria 8018127388 8018131289 278
385 iso_pu_bacteria 8018163183 8018169117 278
386 iso_pu_bacteria 8018176218 8018177293 278
387 iso_pu_bacteria 8023680758 8023687000 278
388 iso_pu_bacteria 8024479707 8024481062 278
389 iso_pu_bacteria 8024486573 8024489792 278
390 iso_pu_bacteria 8024501048 8024503292 278
391 iso_pu_bacteria 8046767195 8046767634 278
392 iso_pu_bacteria 8056375014 8056380687 278
393 iso_pu_bacteria 8056382006 8056384796 278
394 iso_pu_bacteria 8056875544 8056876622 278
395 iso_pu_bacteria 8057575449 8057582245 278
396 iso_pu_bacteria 8057874678 8057879547 278
397 3300003856 Ga0058692_1000888 Ga0058692_10008883 280
398 3300005347 Ga0070668_100227358 Ga0070668_1002273582 280
399 3300006042 Ga0075368_10030015 Ga0075368_100300152 280
400 3300006178 Ga0075367_10157209 Ga0075367_101572092 280
401 3300006186 Ga0075369_10076060 Ga0075369_100760602 280
402 3300006948 Ga0099826_10018485 Ga0099826_100184853 280
403 3300013105 Ga0157369_10159075 Ga0157369_101590753 280
404 3300013105 Ga0157369_10312927 Ga0157369_103129272 280
405 3300025294 Ga0209025_1000074 Ga0209025_1000074207 280
406 3300025294 Ga0209025_1000080 Ga0209025_100008086 280
407 3300027312 Ga0209371_1000021 Ga0209371_1000021530 280
408 3300027312 Ga0209371_1014964 Ga0209371_10149642 280
409 3300030500 Ga0268256_1000020 Ga0268256_1000020536 280
410 3300030500 Ga0268256_1002522 Ga0268256_10025225 280
411 3300046460 Ga0495638_0000353 Ga0495638_0000353_30821_31672 280
412 3300046474 Ga0495605_0004628 Ga0495605_0004628_2942_3793 280
413 3300046492 Ga0495585_0014518 Ga0495585_0014518_3055_3906 280
414 3300046501 Ga0495607_0091871 Ga0495607_0091871_521_1372 280
415 3300046513 Ga0495616_0019290 Ga0495616_0019290_2038_2889 280
416 3300046515 Ga0495620_0043030 Ga0495620_0043030_947_1798 280
417 3300046518 Ga0495631_0001313 Ga0495631_0001313_4273_5124 280
418 3300046616 Ga0495668_0005184 Ga0495668_0005184_4685_5536 280
419 3300046648 Ga0495611_0003016 Ga0495611_0003016_3852_4703 280
420 3300046660 Ga0495625_0002953 Ga0495625_0002953_11135_11986 280
421 3300047318 Ga0495636_0020148 Ga0495636_0020148_378_1229 280
422 3300047320 Ga0495672_0015235 Ga0495672_0015235_915_1766 280
423 3300047323 Ga0495683_0077096 Ga0495683_0077096_20_871 280
424 3300048919 Ga0496116_0000036 Ga0496116_0000036_229985_230830 280
425 3300048919 Ga0496116_0114086 Ga0496116_0114086_305_1150 280
426 3300048922 Ga0496119_0143550 Ga0496119_0143550_128_973 280
427 3300048923 Ga0496120_0026522 Ga0496120_0026522_1268_2113 280
428 3300048924 Ga0496121_0000001 Ga0496121_0000001_842992_843837 280
429 3300048925 Ga0496122_0003139 Ga0496122_0003139_1028_1873 280
430 3300048926 Ga0496123_0037069 Ga0496123_0037069_272_1117 280
431 3300048926 Ga0496123_0038964 Ga0496123_0038964_1203_2048 280
432 3300048927 Ga0496124_0000133 Ga0496124_0000133_10968_11831 280
433 3300048928 Ga0496125_0000001 Ga0496125_0000001_956925_957770 280
434 3300048929 Ga0496126_0000156 Ga0496126_0000156_143408_144253 280
435 3300050491 nmdc:mga00v17_1425_c1 nmdc:mga00v17_1425_c1_3840_4685 280
436 3300050494 nmdc:mga06z11_21036_c1 nmdc:mga06z11_21036_c1_2141_2983 280
437 3300050516 nmdc:mga0sz30_3539_c1 nmdc:mga0sz30_3539_c1_4758_5600 280
438 3300053105 Ga0500557_000339 Ga0500557_000339_81_932 280
439 3300053111 Ga0500572_001399 Ga0500572_001399_2827_3672 280
440 3300053118 Ga0500594_0004922 Ga0500594_0004922_1986_2837 280
441 3300053121 Ga0500607_098564 Ga0500607_098564_20_883 280
442 3300053139 Ga0500568_0000565 Ga0500568_0000565_4171_5022 280
443 3300053153 Ga0500616_0002376 Ga0500616_0002376_8072_8923 280
444 3300053158 Ga0500627_0031130 Ga0500627_0031130_322_1173 280
445 3300053161 Ga0500634_0007390 Ga0500634_0007390_902_1765 280
446 3300053177 Ga0500636_0000004 Ga0500636_0000004_34239_35081 280
447 3300059643 Ga0587072_006949 Ga0587072_006949_208_1050 280
448 3300002773 JGI25152J39213_1007132 JGI25152J39213_10071322 281
449 3300003775 Ga0055524_1011837 Ga0055524_10118372 281
450 3300005262 Ga0065165_1002487 Ga0065165_100248712 281
451 3300005331 Ga0070670_100649415 Ga0070670_1006494151 281
452 3300005355 Ga0070671_100058184 Ga0070671_1000581841 281
453 3300005455 Ga0070663_100059259 Ga0070663_1000592592 281
454 3300006038 Ga0075365_10000250 Ga0075365_1000025012 281
455 3300006038 Ga0075365_10242454 Ga0075365_102424542 281
456 3300006178 Ga0075367_10071575 Ga0075367_100715752 281
457 3300006186 Ga0075369_10000922 Ga0075369_1000092212 281
458 3300006946 Ga0079104_1000032 Ga0079104_100003215 281
459 3300009177 Ga0105248_10146700 Ga0105248_101467003 281
460 3300009553 Ga0105249_10164591 Ga0105249_101645912 281
461 3300013102 Ga0157371_10322701 Ga0157371_103227011 281
462 3300013105 Ga0157369_10328664 Ga0157369_103286642 281
463 3300025258 Ga0209129_1002959 Ga0209129_10029596 281
464 3300025294 Ga0209025_1016585 Ga0209025_10165853 281
465 3300025295 Ga0209564_1003413 Ga0209564_10034136 281
466 3300025297 Ga0209758_1047729 Ga0209758_10477292 281
467 3300025931 Ga0207644_10039006 Ga0207644_100390062 281
468 3300026067 Ga0207678_10039421 Ga0207678_100394213 281
469 3300027111 Ga0209281_1000053 Ga0209281_1000053128 281
470 3300031731 Ga0307405_10029256 Ga0307405_100292562 281
471 3300031901 Ga0307406_10018142 Ga0307406_100181423 281
472 3300031911 Ga0307412_10018618 Ga0307412_100186183 281
473 3300046471 Ga0495650_0069153 Ga0495650_0069153_354_1199 281
474 3300046492 Ga0495585_0052437 Ga0495585_0052437_525_1379 281
475 3300046501 Ga0495607_0060526 Ga0495607_0060526_749_1597 281
476 3300046506 Ga0495583_0002283 Ga0495583_0002283_1911_2765 281
477 3300046512 Ga0495610_0002783 Ga0495610_0002783_8942_9796 281
478 3300046512 Ga0495610_0083417 Ga0495610_0083417_390_1244 281
479 3300046515 Ga0495620_0015946 Ga0495620_0015946_1731_2585 281
480 3300046558 Ga0495633_0008369 Ga0495633_0008369_4262_5116 281
481 3300046615 Ga0495656_0031453 Ga0495656_0031453_1031_1885 281
482 3300046660 Ga0495625_0135407 Ga0495625_0135407_27_881 281
483 3300046674 Ga0495588_0075851 Ga0495588_0075851_602_1456 281
484 3300047446 Ga0495679_046487 Ga0495679_046487_379_1233 281
485 3300047472 Ga0495686_0016885 Ga0495686_0016885_812_1666 281
486 3300048904 Ga0496101_0146855 Ga0496101_0146855_296_1150 281
487 3300048905 Ga0496102_0173098 Ga0496102_0173098_245_1099 281
488 3300048908 Ga0496105_0023236 Ga0496105_0023236_3752_4606 281
489 3300048913 Ga0496110_0135081 Ga0496110_0135081_1277_2131 281
490 3300048914 Ga0496111_0001122 Ga0496111_0001122_4464_5312 281
491 3300048914 Ga0496111_0061087 Ga0496111_0061087_1427_2281 281
492 3300048916 Ga0496113_0027859 Ga0496113_0027859_1064_1918 281
493 3300048917 Ga0496114_0071964 Ga0496114_0071964_642_1496 281
494 3300048919 Ga0496116_0006978 Ga0496116_0006978_4352_5206 281
495 3300048919 Ga0496116_0011699 Ga0496116_0011699_1508_2362 281
496 3300048919 Ga0496116_0017796 Ga0496116_0017796_372_1226 281
497 3300048919 Ga0496116_0068102 Ga0496116_0068102_757_1611 281
498 3300048920 Ga0496117_0024145 Ga0496117_0024145_2372_3226 281
499 3300048920 Ga0496117_0055859 Ga0496117_0055859_787_1641 281
500 3300048921 Ga0496118_0009296 Ga0496118_0009296_8007_8861 281
501 3300048922 Ga0496119_0056642 Ga0496119_0056642_1099_1953 281
502 3300048922 Ga0496119_0081267 Ga0496119_0081267_441_1295 281
503 3300048923 Ga0496120_0041901 Ga0496120_0041901_1323_2177 281
504 3300048924 Ga0496121_0031339 Ga0496121_0031339_1083_1937 281
505 3300048924 Ga0496121_0080174 Ga0496121_0080174_1073_1927 281
506 3300048925 Ga0496122_0000009 Ga0496122_0000009_7251_8099 281
507 3300048925 Ga0496122_0009743 Ga0496122_0009743_8027_8881 281
508 3300048925 Ga0496122_0017735 Ga0496122_0017735_3080_3928 281
509 3300048925 Ga0496122_0028863 Ga0496122_0028863_2629_3483 281
510 3300048925 Ga0496122_0029765 Ga0496122_0029765_2654_3508 281
511 3300048925 Ga0496122_0031879 Ga0496122_0031879_2297_3151 281
512 3300048926 Ga0496123_0000034 Ga0496123_0000034_196136_196984 281
513 3300048926 Ga0496123_0010652 Ga0496123_0010652_4143_4997 281
514 3300048926 Ga0496123_0044310 Ga0496123_0044310_1136_1990 281
515 3300048926 Ga0496123_0044526 Ga0496123_0044526_1590_2438 281
516 3300048927 Ga0496124_0003191 Ga0496124_0003191_8257_9111 281
517 3300048927 Ga0496124_0031384 Ga0496124_0031384_2673_3527 281
518 3300048927 Ga0496124_0032219 Ga0496124_0032219_952_1800 281
519 3300048927 Ga0496124_0046921 Ga0496124_0046921_1714_2565 281
520 3300048927 Ga0496124_0086493 Ga0496124_0086493_378_1232 281
521 3300048927 Ga0496124_0097216 Ga0496124_0097216_489_1337 281
522 3300048927 Ga0496124_0143113 Ga0496124_0143113_654_1505 281
523 3300048927 Ga0496124_0290509 Ga0496124_0290509_273_1118 281
524 3300048929 Ga0496126_0149041 Ga0496126_0149041_489_1343 281
525 3300050492 nmdc:mga0yw44_153355_c1 nmdc:mga0yw44_153355_c1_525_1379 281
526 3300050492 nmdc:mga0yw44_320376_c1 nmdc:mga0yw44_320376_c1_39_893 281
527 3300050516 nmdc:mga0sz30_34607_c1 nmdc:mga0sz30_34607_c1_1128_1982 281
528 3300053125 Ga0500618_000560 Ga0500618_000560_17540_18388 281
529 3300053125 Ga0500618_011030 Ga0500618_011030_1377_2225 281
530 3300001979 JGI24740J21852_10001537 JGI24740J21852_100015372 282
531 3300002704 JGI25155J39150_1000032 JGI25155J39150_1000032100 282
532 3300002705 JGI25156J39149_1000153 JGI25156J39149_100015349 282
533 3300002737 JGI25162J39368_1001013 JGI25162J39368_100101319 282
534 3300002737 JGI25162J39368_1001557 JGI25162J39368_10015573 282
535 3300002738 JGI25154J39366_1000152 JGI25154J39366_100015252 282
536 3300002739 JGI25158J39367_1000020 JGI25158J39367_100002023 282
537 3300002741 JGI25157J39369_1000061 JGI25157J39369_1000061100 282
538 3300002773 JGI25152J39213_1000618 JGI25152J39213_100061813 282
539 3300002987 JGI25159J45721_1000361 JGI25159J45721_10003613 282
540 3300002987 JGI25159J45721_1000998 JGI25159J45721_10009989 282
541 3300003187 JGI25151J46595_10009223 JGI25151J46595_100092232 282
542 3300003187 JGI25151J46595_10010883 JGI25151J46595_100108832 282
543 3300003214 JGI25165J46597_1001133 JGI25165J46597_100113312 282
544 3300003214 JGI25165J46597_1001496 JGI25165J46597_100149614 282
545 3300003215 JGI25153J46596_10002832 JGI25153J46596_1000283211 282
546 3300003320 rootH2_10017238 rootH2_100172382 282
547 3300003322 rootL2_10045393 rootL2_100453937 282
548 3300003354 JGI25160J50197_1000052 JGI25160J50197_100005279 282
549 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005282 282
550 3300003374 JGI25161J50226_1000113 JGI25161J50226_100011323 282
551 3300003374 JGI25161J50226_1000133 JGI25161J50226_100013327 282
552 3300003771 Ga0055526_1001219 Ga0055526_10012193 282
553 3300003775 Ga0055524_1011374 Ga0055524_10113742 282
554 3300003791 Ga0055530_10018212 Ga0055530_100182122 282
555 3300003792 Ga0055540_1009491 Ga0055540_10094913 282
556 3300003792 Ga0055540_1017734 Ga0055540_10177343 282
557 3300003794 Ga0055531_10006375 Ga0055531_100063754 282
558 3300004625 Ga0055543_1000035 Ga0055543_100003542 282
559 3300004625 Ga0055543_1000048 Ga0055543_100004841 282
560 3300005262 Ga0065165_1000253 Ga0065165_100025353 282
561 3300005262 Ga0065165_1036225 Ga0065165_10362252 282
562 3300005331 Ga0070670_100004253 Ga0070670_10000425314 282
563 3300005548 Ga0070665_100048021 Ga0070665_1000480216 282
564 3300005563 Ga0068855_100171268 Ga0068855_1001712683 282
565 3300005614 Ga0068856_100031643 Ga0068856_1000316432 282
566 3300006178 Ga0075367_10194215 Ga0075367_101942152 282
567 3300009093 Ga0105240_10000032 Ga0105240_10000032260 282
568 3300009545 Ga0105237_10001967 Ga0105237_1000196710 282
569 3300010375 Ga0105239_10004104 Ga0105239_100041044 282
570 3300013104 Ga0157370_10000986 Ga0157370_1000098631 282
571 3300015262 Ga0182007_10001327 Ga0182007_100013274 282
572 3300015265 Ga0182005_1003450 Ga0182005_10034505 282
573 3300025206 Ga0209435_100042 Ga0209435_100042101 282
574 3300025208 Ga0209436_100064 Ga0209436_10006435 282
575 3300025208 Ga0209436_105847 Ga0209436_1058471 282
576 3300025233 Ga0209437_100033 Ga0209437_100033232 282
577 3300025233 Ga0209437_100075 Ga0209437_100075280 282
578 3300025246 Ga0209646_1000145 Ga0209646_1000145101 282
579 3300025250 Ga0209026_1000160 Ga0209026_1000160101 282
580 3300025253 Ga0209677_104902 Ga0209677_1049022 282
581 3300025256 Ga0209759_1000177 Ga0209759_1000177101 282
582 3300025258 Ga0209129_1000362 Ga0209129_100036217 282
583 3300025258 Ga0209129_1000592 Ga0209129_10005921 282
584 3300025261 Ga0209233_1000056 Ga0209233_1000056104 282
585 3300025261 Ga0209233_1000064 Ga0209233_1000064190 282
586 3300025261 Ga0209233_1000209 Ga0209233_100020919 282
587 3300025273 Ga0209673_1002450 Ga0209673_10024503 282
588 3300025284 Ga0209130_1000006 Ga0209130_1000006577 282
589 3300025284 Ga0209130_1000018 Ga0209130_1000018311 282
590 3300025292 Ga0209676_1011847 Ga0209676_10118471 282
591 3300025294 Ga0209025_1001310 Ga0209025_10013108 282
592 3300025295 Ga0209564_1000399 Ga0209564_100039959 282
593 3300025297 Ga0209758_1000121 Ga0209758_1000121218 282
594 3300025297 Ga0209758_1000737 Ga0209758_100073742 282
595 3300025298 Ga0209050_1004350 Ga0209050_10043502 282
596 3300025299 Ga0209256_1006397 Ga0209256_10063977 282
597 3300025302 Ga0207426_1000044 Ga0207426_100004478 282
598 3300025302 Ga0207426_1000106 Ga0207426_1000106154 282
599 3300025303 Ga0209051_1002851 Ga0209051_10028518 282
600 3300025303 Ga0209051_1026551 Ga0209051_10265512 282
601 3300025304 Ga0209257_1002587 Ga0209257_100258719 282
602 3300025913 Ga0207695_10000024 Ga0207695_10000024261 282
603 3300025914 Ga0207671_10000548 Ga0207671_1000054836 282
604 3300025925 Ga0207650_10027479 Ga0207650_100274795 282
605 3300026078 Ga0207702_10105350 Ga0207702_101053502 282
606 3300027312 Ga0209371_1002143 Ga0209371_100214313 282
607 3300028794 Ga0307515_10062680 Ga0307515_100626805 282
608 3300030500 Ga0268256_1001181 Ga0268256_10011812 282
609 3300041413 Ga0439465_0005020 Ga0439465_0005020_2954_3811 282
610 3300041413 Ga0439465_0009454 Ga0439465_0009454_1462_2319 282
611 3300041413 Ga0439465_0030864 Ga0439465_0030864_113_973 282
612 3300041413 Ga0439465_0042314 Ga0439465_0042314_228_1088 282
613 3300042007 Ga0439449_0042451 Ga0439449_0042451_479_1336 282
614 3300044694 Ga0466963_0003021 Ga0466963_0003021_1397_2245 282
615 3300044719 Ga0466971_0037283 Ga0466971_0037283_659_1507 282
616 3300044765 Ga0466970_0000377 Ga0466970_0000377_2794_3642 282
617 3300044842 Ga0466957_0021660 Ga0466957_0021660_810_1658 282
618 3300045836 Ga0466958_0118022 Ga0466958_0118022_763_1611 282
619 3300046507 Ga0495606_0017496 Ga0495606_0017496_1500_2348 282
620 3300046507 Ga0495606_0065512 Ga0495606_0065512_121_969 282
621 3300046512 Ga0495610_0019250 Ga0495610_0019250_102_962 282
622 3300046557 Ga0495622_0124670 Ga0495622_0124670_191_1045 282
623 3300046675 Ga0495657_0043799 Ga0495657_0043799_363_1217 282
624 3300047317 Ga0495604_0043543 Ga0495604_0043543_1296_2150 282
625 3300048903 Ga0496100_0003910 Ga0496100_0003910_2124_2972 282
626 3300048905 Ga0496102_0008391 Ga0496102_0008391_5207_6055 282
627 3300048906 Ga0496103_0027637 Ga0496103_0027637_304_1152 282
628 3300048909 Ga0496106_0048400 Ga0496106_0048400_1459_2307 282
629 3300048910 Ga0496107_0042291 Ga0496107_0042291_1131_1988 282
630 3300048916 Ga0496113_0133720 Ga0496113_0133720_980_1828 282
631 3300048917 Ga0496114_0195856 Ga0496114_0195856_687_1535 282
632 3300048919 Ga0496116_0107458 Ga0496116_0107458_486_1334 282
633 3300048920 Ga0496117_0002153 Ga0496117_0002153_17891_18739 282
634 3300048921 Ga0496118_0000695 Ga0496118_0000695_29676_30524 282
635 3300048922 Ga0496119_0005012 Ga0496119_0005012_3002_3850 282
636 3300048922 Ga0496119_0019046 Ga0496119_0019046_1167_2015 282
637 3300048923 Ga0496120_0016315 Ga0496120_0016315_1209_2057 282
638 3300048923 Ga0496120_0166865 Ga0496120_0166865_75_923 282
639 3300048924 Ga0496121_0001632 Ga0496121_0001632_8390_9238 282
640 3300048924 Ga0496121_0005867 Ga0496121_0005867_7671_8519 282
641 3300048924 Ga0496121_0022682 Ga0496121_0022682_2613_3470 282
642 3300048925 Ga0496122_0154485 Ga0496122_0154485_484_1341 282
643 3300048926 Ga0496123_0007403 Ga0496123_0007403_6769_7617 282
644 3300048926 Ga0496123_0119140 Ga0496123_0119140_322_1179 282
645 3300048928 Ga0496125_0006310 Ga0496125_0006310_4204_5052 282
646 3300048928 Ga0496125_0027121 Ga0496125_0027121_3814_4662 282
647 3300048929 Ga0496126_0048613 Ga0496126_0048613_2985_3833 282
648 3300048929 Ga0496126_0137143 Ga0496126_0137143_1168_2025 282
649 3300049569 Ga0501032_0104204 Ga0501032_0104204_32_889 282
650 3300049571 Ga0501034_0210410 Ga0501034_0210410_420_1277 282
651 3300049574 Ga0501038_0294085 Ga0501038_0294085_240_1097 282
652 3300049581 Ga0501047_0080246 Ga0501047_0080246_2215_3072 282
653 3300049583 Ga0501067_0050133 Ga0501067_0050133_855_1712 282
654 3300053125 Ga0500618_003950 Ga0500618_003950_2687_3556 282
655 3300053140 Ga0500573_0036492 Ga0500573_0036492_1228_2076 282
656 3300053148 Ga0500590_010975 Ga0500590_010975_68_922 282
657 3300053156 Ga0500622_0000322 Ga0500622_0000322_26725_27585 282
658 3300053177 Ga0500636_0080075 Ga0500636_0080075_566_1420 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03476

MOSC_N

MOSC N-terminal beta barrel domain

7

122

0.95

PF03473

MOSC

MOSC domain

144

275

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p41-assembly1.cif.gz_D crystal structure of human marc1 a165t variant 0.8898 2 270
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.8863 2 270
7p41-assembly1.cif.gz_D crystal structure of human marc1 a165t variant 0.848 2 270
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.8445 2 270
2y6q-assembly4.cif.gz_D structure of the tetx monooxygenase in complex with the substrate 7- iodtetracycline 0.7619 57 76
ID Description Score Start End Superfamily
af_Q58EJ9_194_321_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9057 144 268 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8904 139 268 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8704 139 268 2.40.33.20
af_U4PC34_202_334_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8699 144 268 2.40.33.20
af_Q54JB6_217_359_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8534 144 257 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A5C7U2N0-F1-model_v4 deleted 0.9926 1 119
AF-A0A5C7U2N0-F1-model_v4 deleted 0.9843 1 119
AF-A0A1X7FCW8-F1-model_v4 MOSC domain-containing protein 0.9779 1 282 GO:0003824
GO:0030151
GO:0030170
AF-A0A7Y2QCA3-F1-model_v4 MOSC domain-containing protein 0.9758 1 221 GO:0003824
GO:0030151
GO:0030170
AF-A0A7Y2QCA3-F1-model_v4 MOSC domain-containing protein 0.9714 1 221 GO:0003824
GO:0030151
GO:0030170

Feature Viewer

pLDDT pTM Quality
90.21 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map