F472858

General Info

Members Datasets Scaffolds Average Seq Length
654 328 1308 105

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10032072|Ga0265334_100320722
Length 105
Sequence MSTVVVRYRTKPELADENQRLVQAVFASLAEEQPDGLRYVSLRLADDTFVHVAEVTADTNPLGALDAFAAFSAGVADRCEPGEGPNPQPATVVGSYRLPLGAAGS

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
186 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
187 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
219 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
225 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
226 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
227 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
228 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
229 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
230 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.8
Rhizosphere 90.98
Stem 0
Stem Tuber 0
Unclassified 18.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10032072 3300028573 Bacteria 2097
2 JGI24744J21845_10003533 3300002077 Bacteria 3214
3 Ga0070658_11691003 3300005327 Bacteria 548
4 Ga0070690_100121600 3300005330 Bacteria 1753
5 Ga0070666_10177455 3300005335 Bacteria 1493
6 Ga0070680_100330876 3300005336 Bacteria 1294
7 Ga0070680_100887989 3300005336 Unclassified 769
8 Ga0070680_101624026 3300005336 Unclassified 560
9 Ga0070682_100219695 3300005337 Bacteria 1352
10 Ga0070682_101855617 3300005337 Unclassified 527
11 Ga0068868_100381181 3300005338 Bacteria 1213
12 Ga0070660_100012041 3300005339 Bacteria 6170
13 Ga0070660_100249673 3300005339 Bacteria 1446
14 Ga0070660_100382712 3300005339 Bacteria 1162
15 Ga0070689_100005481 3300005340 Bacteria 8675
16 Ga0070691_10137116 3300005341 Bacteria 1244
17 Ga0070687_100056921 3300005343 Bacteria 2048
18 Ga0070661_100131357 3300005344 Bacteria 1881
19 Ga0070661_100386090 3300005344 Bacteria 1105
20 Ga0070692_10024384 3300005345 Bacteria 2972
21 Ga0070668_101744878 3300005347 Bacteria 572
22 Ga0070669_100191201 3300005353 Bacteria 1606
23 Ga0070675_100250135 3300005354 Bacteria 1551
24 Ga0070671_100042632 3300005355 Bacteria 3772
25 Ga0070674_100028448 3300005356 Bacteria 3671
26 Ga0070674_101532097 3300005356 Bacteria 600
27 Ga0070673_100040986 3300005364 Bacteria 3556
28 Ga0070688_100006744 3300005365 Bacteria 6156
29 Ga0070659_100029121 3300005366 Bacteria 4266
30 Ga0070703_10125332 3300005406 Bacteria 937
31 Ga0070709_10055955 3300005434 Bacteria 2493
32 Ga0070709_10486786 3300005434 Unclassified 935
33 Ga0070709_10796290 3300005434 Bacteria 741
34 Ga0070709_11273462 3300005434 Bacteria 592
35 Ga0070714_100134005 3300005435 Bacteria 2216
36 Ga0070714_100456834 3300005435 Bacteria 1214
37 Ga0070714_100568594 3300005435 Bacteria 1087
38 Ga0070714_100690509 3300005435 Bacteria 984
39 Ga0070714_101815099 3300005435 Unclassified 595
40 Ga0070714_102328209 3300005435 Bacteria 521
41 Ga0070713_100037741 3300005436 Bacteria 3907
42 Ga0070713_100263365 3300005436 Bacteria 1576
43 Ga0070713_101050571 3300005436 Bacteria 786
44 Ga0070713_101127394 3300005436 Bacteria 758
45 Ga0070710_10019468 3300005437 Bacteria 3507
46 Ga0070710_10087383 3300005437 Bacteria 1832
47 Ga0070701_10004738 3300005438 Bacteria 5552
48 Ga0070711_100004297 3300005439 Bacteria 8387
49 Ga0070711_100708459 3300005439 Unclassified 848
50 Ga0070711_100916604 3300005439 Bacteria 748
51 Ga0070705_100204848 3300005440 Bacteria 1355
52 Ga0070700_100040885 3300005441 Bacteria 2840
53 Ga0070694_100512327 3300005444 Bacteria 956
54 Ga0070708_100393568 3300005445 Unclassified 1307
55 Ga0070708_102160463 3300005445 Unclassified 514
56 Ga0070678_100028043 3300005456 Bacteria 3833
57 Ga0070662_100456187 3300005457 Bacteria 1062
58 Ga0070681_10247475 3300005458 Bacteria 1696
59 Ga0070681_11822295 3300005458 Unclassified 535
60 Ga0068867_100024067 3300005459 Bacteria 4363
61 Ga0070685_10004408 3300005466 Bacteria 7111
62 Ga0070685_10442854 3300005466 Unclassified 908
63 Ga0070706_100134014 3300005467 Unclassified 2312
64 Ga0070706_101225915 3300005467 Bacteria 689
65 Ga0070707_100316491 3300005468 Bacteria 1517
66 Ga0070707_100568767 3300005468 Bacteria 1096
67 Ga0070698_100016508 3300005471 Bacteria 7791
68 Ga0070698_100030092 3300005471 Bacteria 5633
69 Ga0070699_100018500 3300005518 Bacteria 5983
70 Ga0070699_100022157 3300005518 Bacteria 5474
71 Ga0070699_100023722 3300005518 Bacteria 5286
72 Ga0070699_100711239 3300005518 Bacteria 918
73 Ga0070679_100373506 3300005530 Bacteria 1373
74 Ga0070684_100071566 3300005535 Bacteria 3051
75 Ga0070684_100540207 3300005535 Bacteria 1081
76 Ga0070684_102211713 3300005535 Unclassified 519
77 Ga0070697_100048581 3300005536 Bacteria 3441
78 Ga0070697_100203979 3300005536 Unclassified 1681
79 Ga0070697_100350444 3300005536 Bacteria 1275
80 Ga0070697_100593377 3300005536 Bacteria 973
81 Ga0070697_101376573 3300005536 Unclassified 630
82 Ga0070697_101457246 3300005536 Bacteria 612
83 Ga0068853_100064656 3300005539 Bacteria 3173
84 Ga0068853_100455070 3300005539 Unclassified 1204
85 Ga0068853_102047149 3300005539 Unclassified 555
86 Ga0070672_102135869 3300005543 Bacteria 505
87 Ga0070686_100004819 3300005544 Bacteria 7449
88 Ga0070686_101533789 3300005544 Unclassified 562
89 Ga0070695_100087962 3300005545 Bacteria 2067
90 Ga0070695_100284792 3300005545 Bacteria 1216
91 Ga0070696_100033944 3300005546 Bacteria 3508
92 Ga0070665_100212833 3300005548 Bacteria 1934
93 Ga0070665_100868253 3300005548 Unclassified 915
94 Ga0070704_100008546 3300005549 Bacteria 6147
95 Ga0070704_100790233 3300005549 Bacteria 847
96 Ga0068855_100128260 3300005563 Bacteria 2899
97 Ga0068855_101758136 3300005563 Bacteria 631
98 Ga0070664_101309828 3300005564 Unclassified 684
99 Ga0068857_100023444 3300005577 Bacteria 5434
100 Ga0068857_100619292 3300005577 Bacteria 1024
101 Ga0068857_101336831 3300005577 Unclassified 696
102 Ga0068856_100022932 3300005614 Bacteria 6070
103 Ga0068856_101832451 3300005614 Unclassified 618
104 Ga0070702_100072615 3300005615 Bacteria 2036
105 Ga0068852_100259067 3300005616 Unclassified 1669
106 Ga0068852_100285393 3300005616 Bacteria 1593
107 Ga0068852_101345941 3300005616 Unclassified 736
108 Ga0068859_100034549 3300005617 Bacteria 5073
109 Ga0068866_10032751 3300005718 Bacteria 2516
110 Ga0068861_100090128 3300005719 Bacteria 2418
111 Ga0068861_102345851 3300005719 Unclassified 536
112 Ga0068851_10550052 3300005834 Bacteria 697
113 Ga0068870_10251889 3300005840 Bacteria 1095
114 Ga0068863_100373255 3300005841 Bacteria 1392
115 Ga0068858_100188791 3300005842 Bacteria 1947
116 Ga0068860_100046687 3300005843 Bacteria 4130
117 Ga0068862_101271989 3300005844 Bacteria 736
118 Ga0081540_1029729 3300005983 Bacteria 3038
119 Ga0070717_10176492 3300006028 Bacteria 1860
120 Ga0070717_11361512 3300006028 Bacteria 645
121 Ga0070715_10215249 3300006163 Bacteria 984
122 Ga0070716_100214546 3300006173 Unclassified 1288
123 Ga0070716_100310347 3300006173 Bacteria 1101
124 Ga0070712_100405304 3300006175 Unclassified 1127
125 Ga0070712_100536644 3300006175 Bacteria 984
126 Ga0070712_100707278 3300006175 Bacteria 859
127 Ga0097621_100143120 3300006237 Bacteria 2045
128 Ga0068871_100154994 3300006358 Bacteria 1956
129 Ga0068871_100155943 3300006358 Bacteria 1950
130 Ga0075433_10095582 3300006852 Bacteria 2630
131 Ga0075433_10318563 3300006852 Bacteria 1376
132 Ga0075434_100301499 3300006871 Bacteria 1623
133 Ga0068865_100008809 3300006881 Bacteria 6239
134 Ga0075436_100058136 3300006914 Bacteria 2671
135 Ga0075436_100354376 3300006914 Bacteria 1058
136 Ga0097620_100034548 3300006931 Bacteria 5073
137 Ga0075435_100020721 3300007076 Bacteria 5045
138 Ga0075435_101085185 3300007076 Bacteria 700
139 Ga0099794_10303466 3300007265 Unclassified 827
140 Ga0105240_12179237 3300009093 Unclassified 575
141 Ga0111539_12292430 3300009094 Bacteria 626
142 Ga0105245_10013426 3300009098 Bacteria 7135
143 Ga0105245_10113218 3300009098 Unclassified 2526
144 Ga0105247_10555123 3300009101 Bacteria 845
145 Ga0114129_10157570 3300009147 Bacteria 3104
146 Ga0114129_10203296 3300009147 Unclassified 2681
147 Ga0114129_10342516 3300009147 Bacteria 1982
148 Ga0114129_11689410 3300009147 Unclassified 773
149 Ga0105243_10090840 3300009148 Bacteria 2514
150 Ga0105243_10353811 3300009148 Bacteria 1350
151 Ga0105243_11682336 3300009148 Bacteria 663
152 Ga0105243_12734022 3300009148 Bacteria 534
153 Ga0105241_10155970 3300009174 Bacteria 1872
154 Ga0105241_10199656 3300009174 Bacteria 1670
155 Ga0105241_12355702 3300009174 Unclassified 531
156 Ga0105242_10011189 3300009176 Bacteria 6893
157 Ga0105242_11137732 3300009176 Unclassified 797
158 Ga0105242_11910720 3300009176 Bacteria 634
159 Ga0105237_11576023 3300009545 Unclassified 664
160 Ga0105238_10096447 3300009551 Unclassified 2943
161 Ga0105238_10599529 3300009551 Bacteria 1109
162 Ga0105238_10669826 3300009551 Bacteria 1048
163 Ga0105238_11653331 3300009551 Bacteria 671
164 Ga0105249_10140421 3300009553 Bacteria 2316
165 Ga0105239_10005786 3300010375 Bacteria 14422
166 Ga0105246_10055821 3300011119 Bacteria 2727
167 Ga0105246_10820587 3300011119 Bacteria 827
168 Ga0105246_11554929 3300011119 Bacteria 623
169 Ga0105246_11738881 3300011119 Bacteria 594
170 Ga0157373_10231028 3300013100 Bacteria 1306
171 Ga0157373_11118996 3300013100 Unclassified 591
172 Ga0157370_10143172 3300013104 Bacteria 2227
173 Ga0157370_11457457 3300013104 Unclassified 616
174 Ga0157369_10086731 3300013105 Bacteria 3343
175 Ga0157369_10240690 3300013105 Bacteria 1890
176 Ga0157374_10029822 3300013296 Bacteria 4947
177 Ga0157374_10394730 3300013296 Bacteria 1379
178 Ga0157378_10332336 3300013297 Bacteria 1479
179 Ga0157378_10555714 3300013297 Bacteria 1154
180 Ga0157378_11524280 3300013297 Unclassified 713
181 Ga0163162_10021334 3300013306 Bacteria 6378
182 Ga0157375_10383817 3300013308 Bacteria 1571
183 Ga0157375_11490517 3300013308 Bacteria 798
184 Ga0157375_11491366 3300013308 Bacteria 798
185 Ga0157375_12512689 3300013308 Bacteria 615
186 Ga0163163_10654376 3300014325 Bacteria 1114
187 Ga0157377_10013904 3300014745 Bacteria 4084
188 Ga0157377_10036325 3300014745 Bacteria 2710
189 Ga0157379_10237395 3300014968 Bacteria 1653
190 Ga0157379_10423408 3300014968 Bacteria 1226
191 Ga0157376_10029405 3300014969 Bacteria 4377
192 Ga0157376_10327502 3300014969 Bacteria 1458
193 Ga0206356_11383271 3300020070 Unclassified 699
194 Ga0206354_10386881 3300020081 Bacteria 647
195 Ga0228598_1031632 3300024227 Bacteria 1042
196 Ga0207653_10051771 3300025885 Bacteria 1368
197 Ga0207692_10010514 3300025898 Bacteria 3904
198 Ga0207692_10170426 3300025898 Bacteria 1261
199 Ga0207680_10116021 3300025903 Bacteria 1744
200 Ga0207647_10023828 3300025904 Bacteria 4043
201 Ga0207685_10092638 3300025905 Bacteria 1276
202 Ga0207699_10026023 3300025906 Bacteria 3220
203 Ga0207699_10529386 3300025906 Bacteria 853
204 Ga0207643_10066481 3300025908 Bacteria 2067
205 Ga0207643_10466467 3300025908 Unclassified 805
206 Ga0207705_10116614 3300025909 Bacteria 1977
207 Ga0207684_10158783 3300025910 Bacteria 1946
208 Ga0207684_10379073 3300025910 Bacteria 1216
209 Ga0207654_10072271 3300025911 Bacteria 2053
210 Ga0207654_10763564 3300025911 Bacteria 697
211 Ga0207654_11239326 3300025911 Unclassified 544
212 Ga0207707_11574123 3300025912 Unclassified 518
213 Ga0207671_10545190 3300025914 Bacteria 925
214 Ga0207693_10003365 3300025915 Bacteria 13656
215 Ga0207693_10067964 3300025915 Bacteria 2790
216 Ga0207693_10153020 3300025915 Bacteria 1814
217 Ga0207693_10907341 3300025915 Unclassified 676
218 Ga0207663_10002096 3300025916 Bacteria 9503
219 Ga0207663_10003278 3300025916 Bacteria 7895
220 Ga0207663_10391347 3300025916 Unclassified 1061
221 Ga0207663_10699862 3300025916 Bacteria 802
222 Ga0207663_11094730 3300025916 Unclassified 640
223 Ga0207660_10034097 3300025917 Bacteria 3526
224 Ga0207662_10028767 3300025918 Bacteria 3215
225 Ga0207657_10017112 3300025919 Bacteria 6968
226 Ga0207657_10037958 3300025919 Bacteria 4295
227 Ga0207657_10338467 3300025919 Unclassified 1188
228 Ga0207649_10340902 3300025920 Bacteria 1107
229 Ga0207652_10420689 3300025921 Bacteria 1205
230 Ga0207652_11087166 3300025921 Unclassified 700
231 Ga0207652_11502071 3300025921 Bacteria 578
232 Ga0207646_10001949 3300025922 Bacteria 24766
233 Ga0207646_10276600 3300025922 Unclassified 1517
234 Ga0207681_10279494 3300025923 Bacteria 1314
235 Ga0207659_10263951 3300025926 Bacteria 1402
236 Ga0207687_10779509 3300025927 Bacteria 815
237 Ga0207700_10012449 3300025928 Bacteria 5487
238 Ga0207700_10580620 3300025928 Bacteria 997
239 Ga0207700_10615045 3300025928 Bacteria 967
240 Ga0207700_11384269 3300025928 Bacteria 626
241 Ga0207664_10035686 3300025929 Bacteria 3838
242 Ga0207664_10126762 3300025929 Bacteria 2144
243 Ga0207664_10310504 3300025929 Bacteria 1389
244 Ga0207664_11499130 3300025929 Unclassified 596
245 Ga0207644_10066504 3300025931 Bacteria 2625
246 Ga0207644_10104387 3300025931 Bacteria 2134
247 Ga0207690_10804077 3300025932 Bacteria 777
248 Ga0207690_11073010 3300025932 Unclassified 671
249 Ga0207706_11213971 3300025933 Unclassified 626
250 Ga0207686_10006526 3300025934 Bacteria 6284
251 Ga0207686_10926408 3300025934 Bacteria 704
252 Ga0207686_10936680 3300025934 Bacteria 700
253 Ga0207709_10002755 3300025935 Bacteria 10833
254 Ga0207670_10039422 3300025936 Bacteria 3094
255 Ga0207669_10236665 3300025937 Unclassified 1351
256 Ga0207704_10038917 3300025938 Bacteria 2763
257 Ga0207665_10153928 3300025939 Bacteria 1649
258 Ga0207665_10263536 3300025939 Bacteria 1277
259 Ga0207691_10027765 3300025940 Bacteria 5305
260 Ga0207691_10852127 3300025940 Bacteria 764
261 Ga0207691_11026972 3300025940 Bacteria 687
262 Ga0207711_10178576 3300025941 Bacteria 1929
263 Ga0207679_10929189 3300025945 Bacteria 796
264 Ga0207679_12124131 3300025945 Unclassified 510
265 Ga0207667_10081349 3300025949 Bacteria 3355
266 Ga0207651_10604169 3300025960 Bacteria 959
267 Ga0207651_10918239 3300025960 Bacteria 780
268 Ga0207712_10020256 3300025961 Bacteria 4355
269 Ga0207668_10134284 3300025972 Bacteria 1894
270 Ga0207668_10745767 3300025972 Bacteria 864
271 Ga0207677_10057232 3300026023 Bacteria 2676
272 Ga0207677_10195608 3300026023 Bacteria 1603
273 Ga0207677_10327898 3300026023 Unclassified 1275
274 Ga0207677_10957333 3300026023 Bacteria 774
275 Ga0207703_11020322 3300026035 Bacteria 794
276 Ga0207639_10420317 3300026041 Bacteria 1208
277 Ga0207678_10026939 3300026067 Bacteria 5014
278 Ga0207708_10018871 3300026075 Bacteria 5194
279 Ga0207708_11507375 3300026075 Unclassified 591
280 Ga0207702_10042993 3300026078 Bacteria 3792
281 Ga0207702_10362710 3300026078 Bacteria 1389
282 Ga0207641_10357742 3300026088 Bacteria 1393
283 Ga0207648_10002129 3300026089 Bacteria 21539
284 Ga0207676_10808743 3300026095 Bacteria 915
285 Ga0207674_10074989 3300026116 Bacteria 3393
286 Ga0207674_11659745 3300026116 Bacteria 607
287 Ga0207675_100024936 3300026118 Bacteria 5565
288 Ga0207683_10006752 3300026121 Bacteria 9816
289 Ga0207683_10361924 3300026121 Bacteria 1332
290 Ga0207683_11644404 3300026121 Bacteria 591
291 Ga0207698_10371147 3300026142 Bacteria 1358
292 Ga0268266_10118855 3300028379 Bacteria 2350
293 Ga0268266_10202164 3300028379 Bacteria 1819
294 Ga0268266_12295163 3300028379 Bacteria 511
295 Ga0268265_10419082 3300028380 Bacteria 1243
296 Ga0268265_10435601 3300028380 Bacteria 1221
297 Ga0265337_1053480 3300028556 Bacteria 1132
298 Ga0265319_1003054 3300028563 Bacteria 8866
299 Ga0265334_10055766 3300028573 Bacteria 1502
300 Ga0265318_10010882 3300028577 Bacteria 3943
301 Ga0265318_10068732 3300028577 Bacteria 1314
302 Ga0265322_10025993 3300028654 Unclassified 1673
303 Ga0265336_10264232 3300028666 Unclassified 511
304 Ga0265338_10001061 3300028800 Bacteria 45726
305 Ga0265338_10003490 3300028800 Bacteria 22084
306 Ga0265338_10183495 3300028800 Bacteria 1593
307 Ga0265338_10228950 3300028800 Bacteria 1383
308 Ga0265338_10449666 3300028800 Unclassified 912
309 Ga0265338_10641783 3300028800 Unclassified 737
310 Ga0265338_10940977 3300028800 Unclassified 587
311 Ga0265770_1025333 3300030878 Bacteria 964
312 Ga0265760_10011728 3300031090 Bacteria 2504
313 Ga0265760_10051378 3300031090 Bacteria 1241
314 Ga0265330_10010056 3300031235 Bacteria 4471
315 Ga0265328_10111087 3300031239 Bacteria 1019
316 Ga0265320_10021117 3300031240 Bacteria 3512
317 Ga0265325_10000448 3300031241 Bacteria 29686
318 Ga0265340_10007075 3300031247 Bacteria 6116
319 Ga0265339_10007627 3300031249 Bacteria 6973
320 Ga0265331_10051717 3300031250 Bacteria 1966
321 Ga0265331_10133238 3300031250 Bacteria 1133
322 Ga0265327_10034991 3300031251 Bacteria 2781
323 Ga0265327_10040629 3300031251 Bacteria 2513
324 Ga0265316_10010929 3300031344 Bacteria 8241
325 Ga0265316_10090480 3300031344 Bacteria 2335
326 Ga0265316_10323489 3300031344 Bacteria 1120
327 Ga0265313_10000930 3300031595 Bacteria 29172
328 Ga0265313_10029864 3300031595 Bacteria 2814
329 Ga0265313_10206456 3300031595 Unclassified 815
330 Ga0265314_10061595 3300031711 Bacteria 2554
331 Ga0265314_10067739 3300031711 Bacteria 2402
332 Ga0265314_10232636 3300031711 Unclassified 1068
333 Ga0265314_10307455 3300031711 Bacteria 887
334 Ga0265342_10105710 3300031712 Unclassified 1598
335 Ga0373930_0042972 3300034816 Bacteria 968
336 Ga0373959_0094096 3300034820 Unclassified 706
337 Ga0373938_0025522 3300034957 Bacteria 1230
338 Ga0373926_0356291 3300035083 Unclassified 575
339 Ga0373926_0364168 3300035083 Unclassified 568
340 Ga0373928_0014430 3300035084 Bacteria 1597
341 Ga0373929_0005777 3300035085 Bacteria 2234
342 Ga0373934_0000004 3300035086 Bacteria 87334
343 Ga0373940_0019196 3300035088 Bacteria 1724
344 Ga0373949_0019882 3300035090 Bacteria 1533
345 Ga0373952_0023396 3300035092 Bacteria 1320
346 Ga0373923_0008241 3300035111 Bacteria 3706
347 Ga0373923_0023440 3300035111 Unclassified 2428
348 Ga0373932_0009159 3300035112 Bacteria 2376
349 Ga0373936_0130209 3300035113 Bacteria 1081
350 Ga0373936_0589653 3300035113 Unclassified 521
351 Ga0373941_0092801 3300035115 Bacteria 1038
352 Ga0373945_0329954 3300035116 Unclassified 658
353 Ga0373953_0000007 3300035117 Bacteria 53109
354 Ga0373953_0001053 3300035117 Bacteria 7794
355 Ga0373954_0020898 3300035118 Bacteria 2962
356 Ga0373954_0104466 3300035118 Bacteria 1368
357 Ga0373956_0001354 3300035119 Bacteria 10103
358 Ga0373956_0070561 3300035119 Bacteria 1594
359 Ga0373956_0076389 3300035119 Bacteria 1533
360 Ga0373957_0002027 3300035120 Bacteria 5669
361 Ga0373957_0059330 3300035120 Bacteria 1480
362 Ga0373960_0008696 3300035121 Bacteria 2441
363 Ga0373943_0369707 3300035170 Bacteria 824
364 Ga0373943_0381494 3300035170 Unclassified 811
365 Ga0373955_0000041 3300035172 Bacteria 51219
366 Ga0373955_0013219 3300035172 Bacteria 3984
367 Ga0373955_0191049 3300035172 Bacteria 1217
368 Ga0373955_0346576 3300035172 Bacteria 899
369 Ga0373942_0002427 3300035207 Bacteria 4527
370 Ga0373962_0013619 3300035242 Bacteria 2062
371 Ga0373924_0052724 3300035410 Bacteria 1688
372 Ga0373924_0063888 3300035410 Bacteria 1544
373 Ga0373924_0081315 3300035410 Bacteria 1378
374 Ga0373931_0173691 3300035691 Bacteria 1271
375 Ga0373935_0255910 3300035692 Bacteria 1226
376 Ga0373935_0412272 3300035692 Bacteria 971
377 Ga0373927_0306649 3300035695 Bacteria 1045
378 Ga0373927_0365283 3300035695 Bacteria 951
379 Ga0373933_0001832 3300035724 Bacteria 12304
380 Ga0373933_0023909 3300035724 Bacteria 3495
381 Ga0373933_0182171 3300035724 Bacteria 1340
382 Ga0373947_0034538 3300035725 Bacteria 2991
383 Ga0373947_0037526 3300035725 Bacteria 2875
384 Ga0373947_0317944 3300035725 Bacteria 1040
385 Ga0373937_0000172 3300036401 Bacteria 63213
386 Ga0373937_0065790 3300036401 Bacteria 3337
387 Ga0373937_0086554 3300036401 Bacteria 2899
388 Ga0373925_0245530 3300037068 Bacteria 1435
389 Ga0373925_0459260 3300037068 Bacteria 1043
390 Ga0373925_0908536 3300037068 Unclassified 725
391 Ga0436360_0864192 3300039438 Bacteria 1188
392 Ga0451789_0637134 3300041443 Unclassified 2039
393 Ga0451793_1381298 3300041452 Bacteria 2632
394 Ga0451800_1249945 3300041459 Unclassified 1774
395 Ga0451802_0609871 3300041460 Bacteria 687
396 Ga0451804_0928880 3300041463 Unclassified 1482
397 Ga0451807_1548530 3300041486 Unclassified 1461
398 Ga0451837_0195073 3300041494 Unclassified 540
399 Ga0451839_0728764 3300041496 Unclassified 1493
400 Ga0451845_0827931 3300041501 Unclassified 1850
401 Ga0451847_0988284 3300041503 Bacteria 2099
402 Ga0451849_0187053 3300041505 Unclassified 2025
403 Ga0451851_0996604 3300041507 Unclassified 2651
404 Ga0451855_0794922 3300041511 Unclassified 1484
405 Ga0451853_1760086 3300041512 Bacteria 5759
406 Ga0466957_0450499 3300044842 Bacteria 887
407 Ga0451576_2047501 3300045051 Bacteria 589
408 Ga0495592_0000569 3300046454 Bacteria 26145
409 Ga0495592_0015314 3300046454 Bacteria 5819
410 Ga0495592_0640495 3300046454 Bacteria 645
411 Ga0495603_0017011 3300046455 Bacteria 4400
412 Ga0495603_0021296 3300046455 Unclassified 3926
413 Ga0495603_0051086 3300046455 Bacteria 2457
414 Ga0495603_0058843 3300046455 Bacteria 2272
415 Ga0495629_0059468 3300046459 Unclassified 2671
416 Ga0495629_0067602 3300046459 Bacteria 2493
417 Ga0495629_0214541 3300046459 Bacteria 1329
418 Ga0495629_0737872 3300046459 Unclassified 652
419 Ga0495641_0013770 3300046461 Bacteria 4418
420 Ga0495641_0218579 3300046461 Bacteria 855
421 Ga0495641_0315220 3300046461 Bacteria 705
422 Ga0495641_0443430 3300046461 Unclassified 590
423 Ga0495651_0000118 3300046462 Bacteria 58414
424 Ga0495651_0090773 3300046462 Bacteria 2291
425 Ga0495651_0414657 3300046462 Bacteria 877
426 Ga0495651_0449797 3300046462 Bacteria 832
427 Ga0495651_0613021 3300046462 Bacteria 685
428 Ga0495653_0031854 3300046463 Bacteria 4189
429 Ga0495653_0036840 3300046463 Bacteria 3849
430 Ga0495653_0255004 3300046463 Bacteria 1162
431 Ga0495580_0149659 3300046472 Bacteria 1617
432 Ga0495580_0270935 3300046472 Bacteria 1159
433 Ga0495580_0957561 3300046472 Unclassified 547
434 Ga0495582_0011777 3300046473 Bacteria 4818
435 Ga0495582_0055384 3300046473 Bacteria 2186
436 Ga0495582_0115407 3300046473 Bacteria 1510
437 Ga0495582_0209366 3300046473 Bacteria 1114
438 Ga0495605_0139216 3300046474 Bacteria 1090
439 Ga0495639_0219940 3300046475 Bacteria 933
440 Ga0495662_0068609 3300046476 Bacteria 1717
441 Ga0495662_0095533 3300046476 Bacteria 1452
442 Ga0495662_0305815 3300046476 Unclassified 782
443 Ga0495664_0118393 3300046477 Bacteria 1601
444 Ga0495664_0642456 3300046477 Bacteria 629
445 Ga0495584_0063662 3300046491 Bacteria 1854
446 Ga0495584_0310204 3300046491 Bacteria 801
447 Ga0495585_0493307 3300046492 Bacteria 583
448 Ga0495594_0397602 3300046499 Bacteria 784
449 Ga0495594_0552422 3300046499 Bacteria 653
450 Ga0495607_0246075 3300046501 Bacteria 863
451 Ga0495608_0000156 3300046511 Bacteria 48856
452 Ga0495608_0033746 3300046511 Bacteria 3456
453 Ga0495616_0200272 3300046513 Bacteria 878
454 Ga0495618_0052480 3300046514 Bacteria 2577
455 Ga0495618_0107570 3300046514 Bacteria 1786
456 Ga0495618_0132252 3300046514 Bacteria 1596
457 Ga0495618_0209990 3300046514 Bacteria 1230
458 Ga0495628_0008076 3300046516 Bacteria 9054
459 Ga0495628_0145276 3300046516 Bacteria 1808
460 Ga0495630_0106166 3300046517 Bacteria 2127
461 Ga0495630_0235343 3300046517 Bacteria 1399
462 Ga0495630_0340450 3300046517 Bacteria 1147
463 Ga0495631_0125661 3300046518 Bacteria 1103
464 Ga0495631_0220801 3300046518 Unclassified 809
465 Ga0495637_0108515 3300046520 Bacteria 1078
466 Ga0495644_0035302 3300046523 Bacteria 1888
467 Ga0495644_0105064 3300046523 Bacteria 1070
468 Ga0495644_0247056 3300046523 Unclassified 693
469 Ga0495663_0007595 3300046525 Bacteria 3001
470 Ga0495663_0213139 3300046525 Bacteria 677
471 Ga0495666_0032159 3300046526 Unclassified 2569
472 Ga0495642_0168637 3300046528 Bacteria 951
473 Ga0495652_0000436 3300046529 Bacteria 48806
474 Ga0495652_0353029 3300046529 Bacteria 1053
475 Ga0495652_0503450 3300046529 Bacteria 839
476 Ga0495665_0059219 3300046531 Bacteria 2021
477 Ga0495665_0450970 3300046531 Unclassified 650
478 Ga0495640_0097896 3300046533 Bacteria 1928
479 Ga0495640_0277602 3300046533 Bacteria 1044
480 Ga0495640_0390277 3300046533 Bacteria 855
481 Ga0495640_0427270 3300046533 Bacteria 811
482 Ga0495640_0517746 3300046533 Bacteria 725
483 Ga0495586_0841828 3300046535 Unclassified 529
484 Ga0495587_0000045 3300046536 Bacteria 108362
485 Ga0495587_0026915 3300046536 Bacteria 3502
486 Ga0495609_0054783 3300046538 Bacteria 1770
487 Ga0495645_0214646 3300046543 Bacteria 1297
488 Ga0495645_0285514 3300046543 Bacteria 1084
489 Ga0495645_0387784 3300046543 Unclassified 892
490 Ga0495645_0588989 3300046543 Unclassified 685
491 Ga0495633_0474117 3300046558 Unclassified 565
492 Ga0495667_0000051 3300046559 Bacteria 109277
493 Ga0495667_0008659 3300046559 Bacteria 6907
494 Ga0495667_0042260 3300046559 Bacteria 3022
495 Ga0495656_0073977 3300046615 Unclassified 1521
496 Ga0495656_0139389 3300046615 Unclassified 1162
497 Ga0495656_0331174 3300046615 Bacteria 786
498 Ga0495656_0633781 3300046615 Bacteria 573
499 Ga0495668_0227360 3300046616 Bacteria 1022
500 Ga0495634_0028168 3300046642 Bacteria 3902
501 Ga0495634_0142074 3300046642 Bacteria 1523
502 Ga0495634_0144226 3300046642 Unclassified 1509
503 Ga0495611_0184043 3300046648 Unclassified 976
504 Ga0495635_0012840 3300046663 Bacteria 5867
505 Ga0495635_0082243 3300046663 Bacteria 2203
506 Ga0495635_0189040 3300046663 Bacteria 1398
507 Ga0495635_0417210 3300046663 Bacteria 890
508 Ga0495635_0516104 3300046663 Bacteria 786
509 Ga0495659_0123608 3300046664 Bacteria 1021
510 Ga0495659_0331289 3300046664 Bacteria 648
511 Ga0495661_0458289 3300046665 Unclassified 613
512 Ga0495588_0056232 3300046674 Bacteria 2031
513 Ga0495588_0245726 3300046674 Bacteria 944
514 Ga0495657_0000044 3300046675 Bacteria 108383
515 Ga0495657_0065317 3300046675 Bacteria 2393
516 Ga0495657_0827757 3300046675 Bacteria 528
517 Ga0495599_0000127 3300046678 Bacteria 48710
518 Ga0495599_0093451 3300046678 Bacteria 1876
519 Ga0495599_0328131 3300046678 Unclassified 920
520 Ga0495623_0000361 3300046679 Bacteria 29762
521 Ga0495623_0099314 3300046679 Bacteria 1775
522 Ga0495646_0008063 3300046680 Bacteria 6694
523 Ga0495646_0101084 3300046680 Bacteria 1653
524 Ga0495646_0160767 3300046680 Bacteria 1244
525 Ga0495647_0229860 3300046681 Bacteria 821
526 Ga0495647_0253834 3300046681 Bacteria 783
527 Ga0495658_0132717 3300046683 Bacteria 1517
528 Ga0495658_0185827 3300046683 Bacteria 1290
529 Ga0495658_0433446 3300046683 Unclassified 839
530 Ga0495669_0316501 3300046684 Bacteria 753
531 Ga0495613_0146755 3300046689 Bacteria 1683
532 Ga0495613_0357892 3300046689 Bacteria 1001
533 Ga0495624_0345046 3300046690 Bacteria 895
534 Ga0495624_0348009 3300046690 Bacteria 891
535 Ga0495624_0440920 3300046690 Unclassified 780
536 Ga0495624_0817812 3300046690 Bacteria 550
537 Ga0495670_0359047 3300046691 Bacteria 785
538 Ga0495670_0639830 3300046691 Unclassified 580
539 Ga0495671_0042773 3300046692 Bacteria 2276
540 Ga0495671_0632320 3300046692 Unclassified 509
541 Ga0495649_0358799 3300046694 Bacteria 736
542 Ga0495600_0028533 3300046809 Bacteria 3611
543 Ga0495600_0033832 3300046809 Bacteria 3318
544 Ga0495600_0048762 3300046809 Bacteria 2762
545 Ga0495600_0234233 3300046809 Bacteria 1171
546 Ga0495581_0001527 3300047315 Bacteria 12903
547 Ga0495581_0141684 3300047315 Bacteria 1402
548 Ga0495581_0377325 3300047315 Bacteria 827
549 Ga0495581_0847479 3300047315 Bacteria 523
550 Ga0495604_0000046 3300047317 Bacteria 110553
551 Ga0495604_0026930 3300047317 Bacteria 4574
552 Ga0495604_0066136 3300047317 Bacteria 2751
553 Ga0495604_0628888 3300047317 Unclassified 686
554 Ga0495636_0070906 3300047318 Unclassified 1487
555 Ga0495636_0093038 3300047318 Bacteria 1311
556 Ga0495674_0010703 3300047319 Bacteria 8678
557 Ga0495674_0067425 3300047319 Bacteria 3100
558 Ga0495674_0607937 3300047319 Bacteria 865
559 Ga0495674_0950931 3300047319 Unclassified 661
560 Ga0495676_0095095 3300047321 Bacteria 2218
561 Ga0495676_0135394 3300047321 Bacteria 1772
562 Ga0495680_0000108 3300047322 Bacteria 77095
563 Ga0495680_0009002 3300047322 Bacteria 9019
564 Ga0495680_0063861 3300047322 Bacteria 2826
565 Ga0495680_0121957 3300047322 Bacteria 1923
566 Ga0495680_0404023 3300047322 Bacteria 942
567 Ga0495680_0604638 3300047322 Bacteria 733
568 Ga0495680_0954712 3300047322 Unclassified 550
569 Ga0495675_0000119 3300047444 Bacteria 57079
570 Ga0495675_0096650 3300047444 Bacteria 1852
571 Ga0495675_0222542 3300047444 Bacteria 1141
572 Ga0495684_0023693 3300047471 Bacteria 4720
573 Ga0495684_0125896 3300047471 Bacteria 1928
574 Ga0495684_0212808 3300047471 Unclassified 1420
575 Ga0495684_0510968 3300047471 Bacteria 824
576 Ga0495684_0749975 3300047471 Bacteria 642
577 Ga0495684_0768922 3300047471 Bacteria 632
578 Ga0495593_0039675 3300047673 Bacteria 2537
579 Ga0495602_0000167 3300048088 Bacteria 61216
580 Ga0495602_0093854 3300048088 Bacteria 2481
581 Ga0495602_0280850 3300048088 Bacteria 1227
582 Ga0495614_0052147 3300048089 Unclassified 1753
583 Ga0495615_0158061 3300048090 Bacteria 679
584 Ga0495615_0180010 3300048090 Unclassified 644
585 Ga0496100_0020015 3300048903 Bacteria 4005
586 Ga0496100_0456155 3300048903 Bacteria 980
587 Ga0496100_0881428 3300048903 Bacteria 702
588 Ga0496100_1009489 3300048903 Bacteria 655
589 Ga0496101_0004277 3300048904 Bacteria 8954
590 Ga0496102_0305079 3300048905 Bacteria 1500
591 Ga0496102_0507812 3300048905 Bacteria 1128
592 Ga0496103_0002672 3300048906 Bacteria 11151
593 Ga0496103_0157776 3300048906 Bacteria 1455
594 Ga0496104_0033253 3300048907 Bacteria 4803
595 Ga0496104_0252038 3300048907 Bacteria 1678
596 Ga0496104_0317575 3300048907 Bacteria 1471
597 Ga0496104_0326046 3300048907 Bacteria 1449
598 Ga0496104_0363064 3300048907 Bacteria 1360
599 Ga0496105_0160857 3300048908 Bacteria 1843
600 Ga0496105_0502554 3300048908 Bacteria 951
601 Ga0496105_0529684 3300048908 Bacteria 922
602 Ga0496105_0669539 3300048908 Bacteria 799
603 Ga0496106_0000840 3300048909 Bacteria 22293
604 Ga0496106_0031234 3300048909 Bacteria 3968
605 Ga0496106_0055123 3300048909 Bacteria 3004
606 Ga0496107_0003308 3300048910 Bacteria 10769
607 Ga0496108_0119912 3300048911 Bacteria 2255
608 Ga0496108_0289841 3300048911 Bacteria 1425
609 Ga0496109_0507385 3300048912 Bacteria 1138
610 Ga0496109_0583583 3300048912 Unclassified 1053
611 Ga0496110_0024435 3300048913 Bacteria 5150
612 Ga0496110_1104869 3300048913 Unclassified 701
613 Ga0496111_0765728 3300048914 Bacteria 700
614 Ga0496111_0965999 3300048914 Bacteria 611
615 Ga0496112_0032783 3300048915 Bacteria 5044
616 Ga0496112_0237665 3300048915 Unclassified 1775
617 Ga0496112_0335544 3300048915 Bacteria 1455
618 Ga0496112_0353688 3300048915 Bacteria 1411
619 Ga0496112_1511864 3300048915 Unclassified 585
620 Ga0496113_0411680 3300048916 Bacteria 1086
621 Ga0496113_1571934 3300048916 Unclassified 506
622 Ga0496114_0040180 3300048917 Bacteria 3871
623 Ga0496114_0939169 3300048917 Unclassified 747
624 Ga0496114_1111077 3300048917 Unclassified 675
625 Ga0496114_1180659 3300048917 Bacteria 651
626 Ga0496114_1219143 3300048917 Bacteria 639
627 Ga0496114_1476274 3300048917 Unclassified 568
628 Ga0496115_0001231 3300048918 Bacteria 18389
629 Ga0496115_0695767 3300048918 Bacteria 799
630 Ga0501067_0063035 3300049583 Bacteria 2053
631 nmdc:mga05p37_1324361_c1 3300050507 Bacteria 732
632 nmdc:mga05p37_152087_c1 3300050507 Bacteria 2830
633 nmdc:mga05p37_176083_c1 3300050507 Bacteria 2606
634 nmdc:mga0n895_1361507_c1 3300050512 Bacteria 679
635 nmdc:mga0n895_281099_c1 3300050512 Bacteria 1688
636 nmdc:mga0rr50_388716_c1 3300050513 Bacteria 1177
637 nmdc:mga0rr50_556346_c1 3300050513 Bacteria 977
638 nmdc:mga0rr50_794454_c1 3300050513 Unclassified 807
639 nmdc:mga0rr50_83512_c1 3300050513 Bacteria 2470
640 nmdc:mga08x19_337808_c1 3300050514 Bacteria 1050
641 nmdc:mga08x19_511441_c1 3300050514 Unclassified 848
642 nmdc:mga0a205_628932_c1 3300050515 Bacteria 925
643 nmdc:mga0a205_77158_c1 3300050515 Bacteria 3219
644 Ga0495601_0058129 3300053077 Bacteria 2450
645 Ga0495601_0097889 3300053077 Bacteria 1893
646 Ga0495601_0533226 3300053077 Unclassified 756
647 Ga0495612_0229793 3300053078 Bacteria 823
648 Ga0495595_0012910 3300053084 Bacteria 3523
649 Ga0495595_0083823 3300053084 Bacteria 1522
650 Ga0495595_0177247 3300053084 Bacteria 1056
651 Ga0495619_0058713 3300053085 Bacteria 2554
652 Ga0495619_0094194 3300053085 Bacteria 2031
653 Ga0495619_0468611 3300053085 Bacteria 867
654 Ga0495619_0694903 3300053085 Bacteria 692
655 Ga0265334_10032072
656 JGI24744J21845_10003533
657 Ga0070658_11691003
658 Ga0070690_100121600
659 Ga0070666_10177455
660 Ga0070680_100330876
661 Ga0070680_100887989
662 Ga0070680_101624026
663 Ga0070682_100219695
664 Ga0070682_101855617
665 Ga0068868_100381181
666 Ga0070660_100012041
667 Ga0070660_100249673
668 Ga0070660_100382712
669 Ga0070689_100005481
670 Ga0070691_10137116
671 Ga0070687_100056921
672 Ga0070661_100131357
673 Ga0070661_100386090
674 Ga0070692_10024384
675 Ga0070668_101744878
676 Ga0070669_100191201
677 Ga0070675_100250135
678 Ga0070671_100042632
679 Ga0070674_100028448
680 Ga0070674_101532097
681 Ga0070673_100040986
682 Ga0070688_100006744
683 Ga0070659_100029121
684 Ga0070703_10125332
685 Ga0070709_10055955
686 Ga0070709_10486786
687 Ga0070709_10796290
688 Ga0070709_11273462
689 Ga0070714_100134005
690 Ga0070714_100456834
691 Ga0070714_100568594
692 Ga0070714_100690509
693 Ga0070714_101815099
694 Ga0070714_102328209
695 Ga0070713_100037741
696 Ga0070713_100263365
697 Ga0070713_101050571
698 Ga0070713_101127394
699 Ga0070710_10019468
700 Ga0070710_10087383
701 Ga0070701_10004738
702 Ga0070711_100004297
703 Ga0070711_100708459
704 Ga0070711_100916604
705 Ga0070705_100204848
706 Ga0070700_100040885
707 Ga0070694_100512327
708 Ga0070708_100393568
709 Ga0070708_102160463
710 Ga0070678_100028043
711 Ga0070662_100456187
712 Ga0070681_10247475
713 Ga0070681_11822295
714 Ga0068867_100024067
715 Ga0070685_10004408
716 Ga0070685_10442854
717 Ga0070706_100134014
718 Ga0070706_101225915
719 Ga0070707_100316491
720 Ga0070707_100568767
721 Ga0070698_100016508
722 Ga0070698_100030092
723 Ga0070699_100018500
724 Ga0070699_100022157
725 Ga0070699_100023722
726 Ga0070699_100711239
727 Ga0070679_100373506
728 Ga0070684_100071566
729 Ga0070684_100540207
730 Ga0070684_102211713
731 Ga0070697_100048581
732 Ga0070697_100203979
733 Ga0070697_100350444
734 Ga0070697_100593377
735 Ga0070697_101376573
736 Ga0070697_101457246
737 Ga0068853_100064656
738 Ga0068853_100455070
739 Ga0068853_102047149
740 Ga0070672_102135869
741 Ga0070686_100004819
742 Ga0070686_101533789
743 Ga0070695_100087962
744 Ga0070695_100284792
745 Ga0070696_100033944
746 Ga0070665_100212833
747 Ga0070665_100868253
748 Ga0070704_100008546
749 Ga0070704_100790233
750 Ga0068855_100128260
751 Ga0068855_101758136
752 Ga0070664_101309828
753 Ga0068857_100023444
754 Ga0068857_100619292
755 Ga0068857_101336831
756 Ga0068856_100022932
757 Ga0068856_101832451
758 Ga0070702_100072615
759 Ga0068852_100259067
760 Ga0068852_100285393
761 Ga0068852_101345941
762 Ga0068859_100034549
763 Ga0068866_10032751
764 Ga0068861_100090128
765 Ga0068861_102345851
766 Ga0068851_10550052
767 Ga0068870_10251889
768 Ga0068863_100373255
769 Ga0068858_100188791
770 Ga0068860_100046687
771 Ga0068862_101271989
772 Ga0081540_1029729
773 Ga0070717_10176492
774 Ga0070717_11361512
775 Ga0070715_10215249
776 Ga0070716_100214546
777 Ga0070716_100310347
778 Ga0070712_100405304
779 Ga0070712_100536644
780 Ga0070712_100707278
781 Ga0097621_100143120
782 Ga0068871_100154994
783 Ga0068871_100155943
784 Ga0075433_10095582
785 Ga0075433_10318563
786 Ga0075434_100301499
787 Ga0068865_100008809
788 Ga0075436_100058136
789 Ga0075436_100354376
790 Ga0097620_100034548
791 Ga0075435_100020721
792 Ga0075435_101085185
793 Ga0099794_10303466
794 Ga0105240_12179237
795 Ga0111539_12292430
796 Ga0105245_10013426
797 Ga0105245_10113218
798 Ga0105247_10555123
799 Ga0114129_10157570
800 Ga0114129_10203296
801 Ga0114129_10342516
802 Ga0114129_11689410
803 Ga0105243_10090840
804 Ga0105243_10353811
805 Ga0105243_11682336
806 Ga0105243_12734022
807 Ga0105241_10155970
808 Ga0105241_10199656
809 Ga0105241_12355702
810 Ga0105242_10011189
811 Ga0105242_11137732
812 Ga0105242_11910720
813 Ga0105237_11576023
814 Ga0105238_10096447
815 Ga0105238_10599529
816 Ga0105238_10669826
817 Ga0105238_11653331
818 Ga0105249_10140421
819 Ga0105239_10005786
820 Ga0105246_10055821
821 Ga0105246_10820587
822 Ga0105246_11554929
823 Ga0105246_11738881
824 Ga0157373_10231028
825 Ga0157373_11118996
826 Ga0157370_10143172
827 Ga0157370_11457457
828 Ga0157369_10086731
829 Ga0157369_10240690
830 Ga0157374_10029822
831 Ga0157374_10394730
832 Ga0157378_10332336
833 Ga0157378_10555714
834 Ga0157378_11524280
835 Ga0163162_10021334
836 Ga0157375_10383817
837 Ga0157375_11490517
838 Ga0157375_11491366
839 Ga0157375_12512689
840 Ga0163163_10654376
841 Ga0157377_10013904
842 Ga0157377_10036325
843 Ga0157379_10237395
844 Ga0157379_10423408
845 Ga0157376_10029405
846 Ga0157376_10327502
847 Ga0206356_11383271
848 Ga0206354_10386881
849 Ga0228598_1031632
850 Ga0207653_10051771
851 Ga0207692_10010514
852 Ga0207692_10170426
853 Ga0207680_10116021
854 Ga0207647_10023828
855 Ga0207685_10092638
856 Ga0207699_10026023
857 Ga0207699_10529386
858 Ga0207643_10066481
859 Ga0207643_10466467
860 Ga0207705_10116614
861 Ga0207684_10158783
862 Ga0207684_10379073
863 Ga0207654_10072271
864 Ga0207654_10763564
865 Ga0207654_11239326
866 Ga0207707_11574123
867 Ga0207671_10545190
868 Ga0207693_10003365
869 Ga0207693_10067964
870 Ga0207693_10153020
871 Ga0207693_10907341
872 Ga0207663_10002096
873 Ga0207663_10003278
874 Ga0207663_10391347
875 Ga0207663_10699862
876 Ga0207663_11094730
877 Ga0207660_10034097
878 Ga0207662_10028767
879 Ga0207657_10017112
880 Ga0207657_10037958
881 Ga0207657_10338467
882 Ga0207649_10340902
883 Ga0207652_10420689
884 Ga0207652_11087166
885 Ga0207652_11502071
886 Ga0207646_10001949
887 Ga0207646_10276600
888 Ga0207681_10279494
889 Ga0207659_10263951
890 Ga0207687_10779509
891 Ga0207700_10012449
892 Ga0207700_10580620
893 Ga0207700_10615045
894 Ga0207700_11384269
895 Ga0207664_10035686
896 Ga0207664_10126762
897 Ga0207664_10310504
898 Ga0207664_11499130
899 Ga0207644_10066504
900 Ga0207644_10104387
901 Ga0207690_10804077
902 Ga0207690_11073010
903 Ga0207706_11213971
904 Ga0207686_10006526
905 Ga0207686_10926408
906 Ga0207686_10936680
907 Ga0207709_10002755
908 Ga0207670_10039422
909 Ga0207669_10236665
910 Ga0207704_10038917
911 Ga0207665_10153928
912 Ga0207665_10263536
913 Ga0207691_10027765
914 Ga0207691_10852127
915 Ga0207691_11026972
916 Ga0207711_10178576
917 Ga0207679_10929189
918 Ga0207679_12124131
919 Ga0207667_10081349
920 Ga0207651_10604169
921 Ga0207651_10918239
922 Ga0207712_10020256
923 Ga0207668_10134284
924 Ga0207668_10745767
925 Ga0207677_10057232
926 Ga0207677_10195608
927 Ga0207677_10327898
928 Ga0207677_10957333
929 Ga0207703_11020322
930 Ga0207639_10420317
931 Ga0207678_10026939
932 Ga0207708_10018871
933 Ga0207708_11507375
934 Ga0207702_10042993
935 Ga0207702_10362710
936 Ga0207641_10357742
937 Ga0207648_10002129
938 Ga0207676_10808743
939 Ga0207674_10074989
940 Ga0207674_11659745
941 Ga0207675_100024936
942 Ga0207683_10006752
943 Ga0207683_10361924
944 Ga0207683_11644404
945 Ga0207698_10371147
946 Ga0268266_10118855
947 Ga0268266_10202164
948 Ga0268266_12295163
949 Ga0268265_10419082
950 Ga0268265_10435601
951 Ga0265337_1053480
952 Ga0265319_1003054
953 Ga0265334_10055766
954 Ga0265318_10010882
955 Ga0265318_10068732
956 Ga0265322_10025993
957 Ga0265336_10264232
958 Ga0265338_10001061
959 Ga0265338_10003490
960 Ga0265338_10183495
961 Ga0265338_10228950
962 Ga0265338_10449666
963 Ga0265338_10641783
964 Ga0265338_10940977
965 Ga0265770_1025333
966 Ga0265760_10011728
967 Ga0265760_10051378
968 Ga0265330_10010056
969 Ga0265328_10111087
970 Ga0265320_10021117
971 Ga0265325_10000448
972 Ga0265340_10007075
973 Ga0265339_10007627
974 Ga0265331_10051717
975 Ga0265331_10133238
976 Ga0265327_10034991
977 Ga0265327_10040629
978 Ga0265316_10010929
979 Ga0265316_10090480
980 Ga0265316_10323489
981 Ga0265313_10000930
982 Ga0265313_10029864
983 Ga0265313_10206456
984 Ga0265314_10061595
985 Ga0265314_10067739
986 Ga0265314_10232636
987 Ga0265314_10307455
988 Ga0265342_10105710
989 Ga0373930_0042972
990 Ga0373959_0094096
991 Ga0373938_0025522
992 Ga0373926_0356291
993 Ga0373926_0364168
994 Ga0373928_0014430
995 Ga0373929_0005777
996 Ga0373934_0000004
997 Ga0373940_0019196
998 Ga0373949_0019882
999 Ga0373952_0023396
1000 Ga0373923_0008241
1001 Ga0373923_0023440
1002 Ga0373932_0009159
1003 Ga0373936_0130209
1004 Ga0373936_0589653
1005 Ga0373941_0092801
1006 Ga0373945_0329954
1007 Ga0373953_0000007
1008 Ga0373953_0001053
1009 Ga0373954_0020898
1010 Ga0373954_0104466
1011 Ga0373956_0001354
1012 Ga0373956_0070561
1013 Ga0373956_0076389
1014 Ga0373957_0002027
1015 Ga0373957_0059330
1016 Ga0373960_0008696
1017 Ga0373943_0369707
1018 Ga0373943_0381494
1019 Ga0373955_0000041
1020 Ga0373955_0013219
1021 Ga0373955_0191049
1022 Ga0373955_0346576
1023 Ga0373942_0002427
1024 Ga0373962_0013619
1025 Ga0373924_0052724
1026 Ga0373924_0063888
1027 Ga0373924_0081315
1028 Ga0373931_0173691
1029 Ga0373935_0255910
1030 Ga0373935_0412272
1031 Ga0373927_0306649
1032 Ga0373927_0365283
1033 Ga0373933_0001832
1034 Ga0373933_0023909
1035 Ga0373933_0182171
1036 Ga0373947_0034538
1037 Ga0373947_0037526
1038 Ga0373947_0317944
1039 Ga0373937_0000172
1040 Ga0373937_0065790
1041 Ga0373937_0086554
1042 Ga0373925_0245530
1043 Ga0373925_0459260
1044 Ga0373925_0908536
1045 Ga0436360_0864192
1046 Ga0451789_0637134
1047 Ga0451793_1381298
1048 Ga0451800_1249945
1049 Ga0451802_0609871
1050 Ga0451804_0928880
1051 Ga0451807_1548530
1052 Ga0451837_0195073
1053 Ga0451839_0728764
1054 Ga0451845_0827931
1055 Ga0451847_0988284
1056 Ga0451849_0187053
1057 Ga0451851_0996604
1058 Ga0451855_0794922
1059 Ga0451853_1760086
1060 Ga0466957_0450499
1061 Ga0451576_2047501
1062 Ga0495592_0000569
1063 Ga0495592_0015314
1064 Ga0495592_0640495
1065 Ga0495603_0017011
1066 Ga0495603_0021296
1067 Ga0495603_0051086
1068 Ga0495603_0058843
1069 Ga0495629_0059468
1070 Ga0495629_0067602
1071 Ga0495629_0214541
1072 Ga0495629_0737872
1073 Ga0495641_0013770
1074 Ga0495641_0218579
1075 Ga0495641_0315220
1076 Ga0495641_0443430
1077 Ga0495651_0000118
1078 Ga0495651_0090773
1079 Ga0495651_0414657
1080 Ga0495651_0449797
1081 Ga0495651_0613021
1082 Ga0495653_0031854
1083 Ga0495653_0036840
1084 Ga0495653_0255004
1085 Ga0495580_0149659
1086 Ga0495580_0270935
1087 Ga0495580_0957561
1088 Ga0495582_0011777
1089 Ga0495582_0055384
1090 Ga0495582_0115407
1091 Ga0495582_0209366
1092 Ga0495605_0139216
1093 Ga0495639_0219940
1094 Ga0495662_0068609
1095 Ga0495662_0095533
1096 Ga0495662_0305815
1097 Ga0495664_0118393
1098 Ga0495664_0642456
1099 Ga0495584_0063662
1100 Ga0495584_0310204
1101 Ga0495585_0493307
1102 Ga0495594_0397602
1103 Ga0495594_0552422
1104 Ga0495607_0246075
1105 Ga0495608_0000156
1106 Ga0495608_0033746
1107 Ga0495616_0200272
1108 Ga0495618_0052480
1109 Ga0495618_0107570
1110 Ga0495618_0132252
1111 Ga0495618_0209990
1112 Ga0495628_0008076
1113 Ga0495628_0145276
1114 Ga0495630_0106166
1115 Ga0495630_0235343
1116 Ga0495630_0340450
1117 Ga0495631_0125661
1118 Ga0495631_0220801
1119 Ga0495637_0108515
1120 Ga0495644_0035302
1121 Ga0495644_0105064
1122 Ga0495644_0247056
1123 Ga0495663_0007595
1124 Ga0495663_0213139
1125 Ga0495666_0032159
1126 Ga0495642_0168637
1127 Ga0495652_0000436
1128 Ga0495652_0353029
1129 Ga0495652_0503450
1130 Ga0495665_0059219
1131 Ga0495665_0450970
1132 Ga0495640_0097896
1133 Ga0495640_0277602
1134 Ga0495640_0390277
1135 Ga0495640_0427270
1136 Ga0495640_0517746
1137 Ga0495586_0841828
1138 Ga0495587_0000045
1139 Ga0495587_0026915
1140 Ga0495609_0054783
1141 Ga0495645_0214646
1142 Ga0495645_0285514
1143 Ga0495645_0387784
1144 Ga0495645_0588989
1145 Ga0495633_0474117
1146 Ga0495667_0000051
1147 Ga0495667_0008659
1148 Ga0495667_0042260
1149 Ga0495656_0073977
1150 Ga0495656_0139389
1151 Ga0495656_0331174
1152 Ga0495656_0633781
1153 Ga0495668_0227360
1154 Ga0495634_0028168
1155 Ga0495634_0142074
1156 Ga0495634_0144226
1157 Ga0495611_0184043
1158 Ga0495635_0012840
1159 Ga0495635_0082243
1160 Ga0495635_0189040
1161 Ga0495635_0417210
1162 Ga0495635_0516104
1163 Ga0495659_0123608
1164 Ga0495659_0331289
1165 Ga0495661_0458289
1166 Ga0495588_0056232
1167 Ga0495588_0245726
1168 Ga0495657_0000044
1169 Ga0495657_0065317
1170 Ga0495657_0827757
1171 Ga0495599_0000127
1172 Ga0495599_0093451
1173 Ga0495599_0328131
1174 Ga0495623_0000361
1175 Ga0495623_0099314
1176 Ga0495646_0008063
1177 Ga0495646_0101084
1178 Ga0495646_0160767
1179 Ga0495647_0229860
1180 Ga0495647_0253834
1181 Ga0495658_0132717
1182 Ga0495658_0185827
1183 Ga0495658_0433446
1184 Ga0495669_0316501
1185 Ga0495613_0146755
1186 Ga0495613_0357892
1187 Ga0495624_0345046
1188 Ga0495624_0348009
1189 Ga0495624_0440920
1190 Ga0495624_0817812
1191 Ga0495670_0359047
1192 Ga0495670_0639830
1193 Ga0495671_0042773
1194 Ga0495671_0632320
1195 Ga0495649_0358799
1196 Ga0495600_0028533
1197 Ga0495600_0033832
1198 Ga0495600_0048762
1199 Ga0495600_0234233
1200 Ga0495581_0001527
1201 Ga0495581_0141684
1202 Ga0495581_0377325
1203 Ga0495581_0847479
1204 Ga0495604_0000046
1205 Ga0495604_0026930
1206 Ga0495604_0066136
1207 Ga0495604_0628888
1208 Ga0495636_0070906
1209 Ga0495636_0093038
1210 Ga0495674_0010703
1211 Ga0495674_0067425
1212 Ga0495674_0607937
1213 Ga0495674_0950931
1214 Ga0495676_0095095
1215 Ga0495676_0135394
1216 Ga0495680_0000108
1217 Ga0495680_0009002
1218 Ga0495680_0063861
1219 Ga0495680_0121957
1220 Ga0495680_0404023
1221 Ga0495680_0604638
1222 Ga0495680_0954712
1223 Ga0495675_0000119
1224 Ga0495675_0096650
1225 Ga0495675_0222542
1226 Ga0495684_0023693
1227 Ga0495684_0125896
1228 Ga0495684_0212808
1229 Ga0495684_0510968
1230 Ga0495684_0749975
1231 Ga0495684_0768922
1232 Ga0495593_0039675
1233 Ga0495602_0000167
1234 Ga0495602_0093854
1235 Ga0495602_0280850
1236 Ga0495614_0052147
1237 Ga0495615_0158061
1238 Ga0495615_0180010
1239 Ga0496100_0020015
1240 Ga0496100_0456155
1241 Ga0496100_0881428
1242 Ga0496100_1009489
1243 Ga0496101_0004277
1244 Ga0496102_0305079
1245 Ga0496102_0507812
1246 Ga0496103_0002672
1247 Ga0496103_0157776
1248 Ga0496104_0033253
1249 Ga0496104_0252038
1250 Ga0496104_0317575
1251 Ga0496104_0326046
1252 Ga0496104_0363064
1253 Ga0496105_0160857
1254 Ga0496105_0502554
1255 Ga0496105_0529684
1256 Ga0496105_0669539
1257 Ga0496106_0000840
1258 Ga0496106_0031234
1259 Ga0496106_0055123
1260 Ga0496107_0003308
1261 Ga0496108_0119912
1262 Ga0496108_0289841
1263 Ga0496109_0507385
1264 Ga0496109_0583583
1265 Ga0496110_0024435
1266 Ga0496110_1104869
1267 Ga0496111_0765728
1268 Ga0496111_0965999
1269 Ga0496112_0032783
1270 Ga0496112_0237665
1271 Ga0496112_0335544
1272 Ga0496112_0353688
1273 Ga0496112_1511864
1274 Ga0496113_0411680
1275 Ga0496113_1571934
1276 Ga0496114_0040180
1277 Ga0496114_0939169
1278 Ga0496114_1111077
1279 Ga0496114_1180659
1280 Ga0496114_1219143
1281 Ga0496114_1476274
1282 Ga0496115_0001231
1283 Ga0496115_0695767
1284 Ga0501067_0063035
1285 nmdc:mga05p37_1324361_c1
1286 nmdc:mga05p37_152087_c1
1287 nmdc:mga05p37_176083_c1
1288 nmdc:mga0n895_1361507_c1
1289 nmdc:mga0n895_281099_c1
1290 nmdc:mga0rr50_388716_c1
1291 nmdc:mga0rr50_556346_c1
1292 nmdc:mga0rr50_794454_c1
1293 nmdc:mga0rr50_83512_c1
1294 nmdc:mga08x19_337808_c1
1295 nmdc:mga08x19_511441_c1
1296 nmdc:mga0a205_628932_c1
1297 nmdc:mga0a205_77158_c1
1298 Ga0495601_0058129
1299 Ga0495601_0097889
1300 Ga0495601_0533226
1301 Ga0495612_0229793
1302 Ga0495595_0012910
1303 Ga0495595_0083823
1304 Ga0495595_0177247
1305 Ga0495619_0058713
1306 Ga0495619_0094194
1307 Ga0495619_0468611
1308 Ga0495619_0694903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f44-assembly1.cif.gz_A crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution 0.7959 4 92
3kkf-assembly1.cif.gz_A crystal structure of putative antibiotic biosynthesis monooxygenase (np_810307.1) from bacteriodes thetaiotaomicron vpi-5482 at 1.30 a resolution 0.7797 3 102
3qmq-assembly2.cif.gz_B crystal structure of e. coli lsrg 0.7669 4 98
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.7649 4 93
4hl9-assembly3.cif.gz_F crystal structure of antibiotic biosynthesis monooxygenase 0.751 4 97
ID Description Score Start End Superfamily
af_A3KQL1_329_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7813 5 95 3.30.70.100
af_A3KQL1_329_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7669 5 95 3.30.70.100
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7669 4 98 3.30.70.100
af_P78833_2_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7552 4 94 3.30.70.100
af_A4HXF6_1_104_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7535 1 98 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A534AED7-F1-model_v4 Uncharacterized protein 0.9561 3 97
AF-X5QU88-F1-model_v4 Uncharacterized protein 0.9523 3 99
AF-A0A068DD52-F1-model_v4 deleted 0.9492 3 99
AF-A0A023X965-F1-model_v4 deleted 0.9452 3 99
AF-A0A538GUS2-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9445 1 104

Map