F472575

General Info

Members Datasets Scaffolds Average Seq Length
651 286 1302 187

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100135514|Ga0070680_1001355142
Length 217
Sequence MSWGDVYLTCFVIGFALSFVSFLLGSFHLHLPHMHFHGGAHVHFDLTHGTPTAMHPAPGHAHGASEQLSLFNFGTVAAFLAWFGGTGYLLTRYSGMWIGFVLMISAVVGFIGASIIFFFVAKVLMKYDSHLDPADYDMVGVLGAVTVPIREDGTGEIVFSQQGARRCAGARSDNAGPITKGTEVVVTRYERGIAYVQRWDELSGAAQESEQEKGSKQ

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.53
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 31.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100135514 3300005336 Unclassified 2062
2 MRS1b_contig_3590143 2162886011 Bacteria 1085
3 MBSR1b_contig_10696368 2162886012 Bacteria 1050
4 MBSR1b_contig_7172159 2162886012 Unclassified 1509
5 Ga0065704_10408488 3300005289 Unclassified 744
6 Ga0065712_10070525 3300005290 Bacteria 5928
7 Ga0065715_10002194 3300005293 Bacteria 6608
8 Ga0070658_10002655 3300005327 Bacteria 14879
9 Ga0070658_10513895 3300005327 Bacteria 1035
10 Ga0070676_10259972 3300005328 Unclassified 1162
11 Ga0070676_10271797 3300005328 Bacteria 1139
12 Ga0070683_100000011 3300005329 Bacteria 283682
13 Ga0070683_100021544 3300005329 Bacteria 5753
14 Ga0070683_100061088 3300005329 Unclassified 3503
15 Ga0070690_100014122 3300005330 Bacteria 4734
16 Ga0070690_100395570 3300005330 Bacteria 1014
17 Ga0070670_100004616 3300005331 Bacteria 11557
18 Ga0070670_100420297 3300005331 Bacteria 1182
19 Ga0070677_10431223 3300005333 Unclassified 701
20 Ga0068869_100000283 3300005334 Bacteria 26972
21 Ga0068869_100017274 3300005334 Bacteria 4887
22 Ga0070666_10011999 3300005335 Bacteria 5453
23 Ga0070666_10090058 3300005335 Bacteria 2106
24 Ga0070680_100007894 3300005336 Bacteria 8116
25 Ga0070680_100046689 3300005336 Bacteria 3524
26 Ga0070680_100360760 3300005336 Bacteria 1236
27 Ga0070680_100980885 3300005336 Bacteria 729
28 Ga0070682_100084521 3300005337 Bacteria 2062
29 Ga0070682_100239182 3300005337 Unclassified 1302
30 Ga0068868_100012551 3300005338 Bacteria 6195
31 Ga0068868_100015978 3300005338 Bacteria 5566
32 Ga0068868_100136527 3300005338 Bacteria 2011
33 Ga0068868_101360417 3300005338 Unclassified 661
34 Ga0070660_100023246 3300005339 Bacteria 4592
35 Ga0070660_100201458 3300005339 Bacteria 1614
36 Ga0070689_100000010 3300005340 Bacteria 222713
37 Ga0070687_100197362 3300005343 Unclassified 1217
38 Ga0070687_100416478 3300005343 Bacteria 885
39 Ga0070661_100372443 3300005344 Bacteria 1124
40 Ga0070669_100040509 3300005353 Bacteria 3386
41 Ga0070669_100252079 3300005353 Unclassified 1406
42 Ga0070675_100034798 3300005354 Bacteria 4089
43 Ga0070671_100028370 3300005355 Bacteria 4608
44 Ga0070673_100021628 3300005364 Bacteria 4668
45 Ga0070673_100315757 3300005364 Unclassified 1379
46 Ga0070688_100096357 3300005365 Unclassified 1943
47 Ga0070659_100021419 3300005366 Bacteria 4923
48 Ga0070659_100037480 3300005366 Unclassified 3779
49 Ga0070659_100137533 3300005366 Unclassified 1987
50 Ga0070667_100058765 3300005367 Bacteria 3251
51 Ga0070667_100400425 3300005367 Bacteria 1249
52 Ga0070667_100713329 3300005367 Bacteria 928
53 Ga0070709_10031685 3300005434 Unclassified 3182
54 Ga0070714_100383036 3300005435 Bacteria 1326
55 Ga0070713_100058870 3300005436 Bacteria 3205
56 Ga0070713_100074067 3300005436 Bacteria 2884
57 Ga0070713_100298782 3300005436 Unclassified 1482
58 Ga0070713_101060111 3300005436 Unclassified 783
59 Ga0070711_100550951 3300005439 Bacteria 957
60 Ga0070711_100998133 3300005439 Bacteria 718
61 Ga0070705_100124552 3300005440 Bacteria 1670
62 Ga0070705_100328955 3300005440 Unclassified 1106
63 Ga0070694_100025641 3300005444 Bacteria 3814
64 Ga0070694_100244682 3300005444 Bacteria 1354
65 Ga0070708_100008430 3300005445 Bacteria 8274
66 Ga0070708_100029786 3300005445 Bacteria 4711
67 Ga0070708_100087450 3300005445 Unclassified 2832
68 Ga0070663_100015276 3300005455 Bacteria 4951
69 Ga0070678_100024025 3300005456 Bacteria 4072
70 Ga0070678_100513754 3300005456 Bacteria 1059
71 Ga0070662_100032687 3300005457 Bacteria 3657
72 Ga0070681_10009604 3300005458 Bacteria 9513
73 Ga0070681_10098542 3300005458 Bacteria 2869
74 Ga0070681_10305424 3300005458 Bacteria 1500
75 Ga0070681_10356648 3300005458 Bacteria 1373
76 Ga0068867_100012417 3300005459 Bacteria 6025
77 Ga0068867_100041194 3300005459 Bacteria 3374
78 Ga0070706_100003994 3300005467 Bacteria 14354
79 Ga0070706_100052647 3300005467 Unclassified 3757
80 Ga0070706_100090333 3300005467 Unclassified 2840
81 Ga0070706_100164683 3300005467 Bacteria 2070
82 Ga0070707_100056320 3300005468 Unclassified 3770
83 Ga0070698_100000830 3300005471 Bacteria 33759
84 Ga0070698_101154920 3300005471 Bacteria 723
85 Ga0070679_100024956 3300005530 Bacteria 5860
86 Ga0070679_100069715 3300005530 Bacteria 3507
87 Ga0070679_100134124 3300005530 Bacteria 2457
88 Ga0070679_100688077 3300005530 Unclassified 965
89 Ga0070684_100000001 3300005535 Bacteria 300240
90 Ga0070684_100049730 3300005535 Unclassified 3639
91 Ga0070684_100099538 3300005535 Bacteria 2595
92 Ga0070684_100383892 3300005535 Unclassified 1294
93 Ga0070684_100458731 3300005535 Bacteria 1178
94 Ga0070697_100000183 3300005536 Bacteria 51905
95 Ga0070697_100066701 3300005536 Bacteria 2943
96 Ga0070697_100098899 3300005536 Unclassified 2421
97 Ga0070697_100294238 3300005536 Unclassified 1395
98 Ga0070697_100348852 3300005536 Unclassified 1278
99 Ga0068853_100485386 3300005539 Unclassified 1165
100 Ga0070672_100835865 3300005543 Bacteria 811
101 Ga0070686_100100291 3300005544 Bacteria 1955
102 Ga0070686_100191291 3300005544 Bacteria 1461
103 Ga0070686_100235657 3300005544 Bacteria 1330
104 Ga0070695_100028325 3300005545 Bacteria 3476
105 Ga0070696_100019540 3300005546 Bacteria 4588
106 Ga0070696_100083397 3300005546 Bacteria 2267
107 Ga0070696_100135501 3300005546 Bacteria 1795
108 Ga0070696_100222430 3300005546 Bacteria 1417
109 Ga0070665_100965163 3300005548 Bacteria 865
110 Ga0070704_100094961 3300005549 Unclassified 2232
111 Ga0070704_100247871 3300005549 Bacteria 1461
112 Ga0068855_100145874 3300005563 Bacteria 2694
113 Ga0068855_100157188 3300005563 Bacteria 2582
114 Ga0068855_100201000 3300005563 Unclassified 2243
115 Ga0068855_100210565 3300005563 Unclassified 2185
116 Ga0068855_100315225 3300005563 Bacteria 1730
117 Ga0068855_100446904 3300005563 Bacteria 1411
118 Ga0070664_100034964 3300005564 Bacteria 4217
119 Ga0070664_100194256 3300005564 Bacteria 1809
120 Ga0068857_100074794 3300005577 Bacteria 3019
121 Ga0068857_100214017 3300005577 Bacteria 1759
122 Ga0068857_100271942 3300005577 Unclassified 1557
123 Ga0068857_100502002 3300005577 Unclassified 1139
124 Ga0068854_100004383 3300005578 Bacteria 8904
125 Ga0068854_100009000 3300005578 Bacteria 6434
126 Ga0068856_100226556 3300005614 Unclassified 1885
127 Ga0068856_100273540 3300005614 Bacteria 1705
128 Ga0068856_100297754 3300005614 Unclassified 1630
129 Ga0068856_101022779 3300005614 Unclassified 844
130 Ga0068852_100021007 3300005616 Bacteria 5201
131 Ga0068859_100121014 3300005617 Unclassified 2684
132 Ga0068859_100127549 3300005617 Unclassified 2614
133 Ga0068859_100388571 3300005617 Unclassified 1491
134 Ga0068859_100593653 3300005617 Bacteria 1201
135 Ga0068864_100350957 3300005618 Unclassified 1392
136 Ga0068864_101098566 3300005618 Unclassified 791
137 Ga0068861_100520823 3300005719 Bacteria 1078
138 Ga0068870_10265138 3300005840 Bacteria 1071
139 Ga0068863_100046850 3300005841 Bacteria 4103
140 Ga0068863_100088869 3300005841 Unclassified 2929
141 Ga0068858_100007549 3300005842 Bacteria 10509
142 Ga0068858_100192244 3300005842 Unclassified 1928
143 Ga0068858_100209273 3300005842 Unclassified 1846
144 Ga0068858_100273922 3300005842 Bacteria 1606
145 Ga0068858_100660313 3300005842 Bacteria 1016
146 Ga0068860_100047715 3300005843 Bacteria 4081
147 Ga0068860_100070507 3300005843 Unclassified 3323
148 Ga0068860_100204570 3300005843 Bacteria 1914
149 Ga0068860_100362469 3300005843 Bacteria 1428
150 Ga0068860_100436015 3300005843 Bacteria 1301
151 Ga0068862_100096648 3300005844 Bacteria 2579
152 Ga0081455_10023072 3300005937 Bacteria 5797
153 Ga0081455_10086606 3300005937 Bacteria 2551
154 Ga0070717_10003732 3300006028 Bacteria 10941
155 Ga0070717_10006318 3300006028 Bacteria 8706
156 Ga0070717_10064888 3300006028 Bacteria 3034
157 Ga0070717_10131068 3300006028 Bacteria 2156
158 Ga0070717_10143124 3300006028 Unclassified 2064
159 Ga0070717_10410045 3300006028 Unclassified 1218
160 Ga0070715_10294750 3300006163 Unclassified 865
161 Ga0097621_100001499 3300006237 Bacteria 16025
162 Ga0097621_100059331 3300006237 Bacteria 3132
163 Ga0097621_100079470 3300006237 Bacteria 2727
164 Ga0097621_100197333 3300006237 Unclassified 1745
165 Ga0097621_100212532 3300006237 Bacteria 1683
166 Ga0097621_100370965 3300006237 Bacteria 1277
167 Ga0097621_100412870 3300006237 Unclassified 1210
168 Ga0068871_100001120 3300006358 Bacteria 17991
169 Ga0068871_100006145 3300006358 Bacteria 8463
170 Ga0068871_100007875 3300006358 Bacteria 7637
171 Ga0068871_100264682 3300006358 Unclassified 1501
172 Ga0068871_100713012 3300006358 Bacteria 920
173 Ga0075428_100036657 3300006844 Bacteria 5401
174 Ga0075430_100148655 3300006846 Bacteria 1951
175 Ga0075430_100340013 3300006846 Bacteria 1240
176 Ga0075431_100097671 3300006847 Bacteria 3033
177 Ga0075433_10099901 3300006852 Bacteria 2568
178 Ga0075433_10381453 3300006852 Unclassified 1244
179 Ga0075434_100078025 3300006871 Unclassified 3307
180 Ga0075434_100124202 3300006871 Unclassified 2598
181 Ga0075434_100464976 3300006871 Unclassified 1286
182 Ga0075434_100843427 3300006871 Bacteria 932
183 Ga0075429_100043479 3300006880 Unclassified 3909
184 Ga0075429_100211545 3300006880 Bacteria 1699
185 Ga0068865_100006668 3300006881 Bacteria 7062
186 Ga0068865_100012979 3300006881 Bacteria 5252
187 Ga0068865_100182351 3300006881 Unclassified 1618
188 Ga0075436_100038388 3300006914 Unclassified 3306
189 Ga0075436_100162904 3300006914 Unclassified 1573
190 Ga0075436_100328316 3300006914 Bacteria 1100
191 Ga0075436_100829026 3300006914 Bacteria 690
192 Ga0097620_100121017 3300006931 Unclassified 2684
193 Ga0097620_100127563 3300006931 Unclassified 2614
194 Ga0097620_100388556 3300006931 Unclassified 1491
195 Ga0097620_100593693 3300006931 Bacteria 1201
196 Ga0075435_100054691 3300007076 Bacteria 3222
197 Ga0099794_10191269 3300007265 Unclassified 1046
198 Ga0105240_10058912 3300009093 Bacteria 4793
199 Ga0105240_10425534 3300009093 Unclassified 1491
200 Ga0105240_10425672 3300009093 Unclassified 1490
201 Ga0105240_10718145 3300009093 Bacteria 1089
202 Ga0105240_11268294 3300009093 Bacteria 778
203 Ga0111539_10908097 3300009094 Bacteria 1024
204 Ga0105245_10003727 3300009098 Bacteria 13582
205 Ga0105245_10012108 3300009098 Bacteria 7502
206 Ga0105245_10024338 3300009098 Bacteria 5315
207 Ga0105245_10063457 3300009098 Bacteria 3335
208 Ga0105245_10133224 3300009098 Bacteria 2333
209 Ga0105245_10207617 3300009098 Bacteria 1884
210 Ga0105245_10308245 3300009098 Bacteria 1556
211 Ga0105247_10014437 3300009101 Bacteria 4738
212 Ga0114129_10374375 3300009147 Bacteria 1882
213 Ga0114129_10639527 3300009147 Unclassified 1374
214 Ga0105243_10804548 3300009148 Unclassified 927
215 Ga0105241_10029529 3300009174 Unclassified 4092
216 Ga0105241_10087259 3300009174 Bacteria 2456
217 Ga0105241_10284148 3300009174 Unclassified 1414
218 Ga0105242_10259329 3300009176 Bacteria 1570
219 Ga0105242_10280075 3300009176 Bacteria 1514
220 Ga0105242_10997700 3300009176 Unclassified 845
221 Ga0105248_10046481 3300009177 Bacteria 4865
222 Ga0105248_10078369 3300009177 Bacteria 3714
223 Ga0105248_10182923 3300009177 Bacteria 2362
224 Ga0105248_10205638 3300009177 Unclassified 2218
225 Ga0105248_10247611 3300009177 Bacteria 2006
226 Ga0105248_10559488 3300009177 Bacteria 1290
227 Ga0105248_10726356 3300009177 Unclassified 1121
228 Ga0105248_11105573 3300009177 Bacteria 896
229 Ga0105248_11191554 3300009177 Unclassified 861
230 Ga0105237_10006907 3300009545 Bacteria 12518
231 Ga0105237_10040299 3300009545 Bacteria 4711
232 Ga0105237_10221622 3300009545 Unclassified 1891
233 Ga0105237_10509266 3300009545 Bacteria 1210
234 Ga0105237_10701857 3300009545 Unclassified 1018
235 Ga0105237_10739651 3300009545 Bacteria 990
236 Ga0105238_10014699 3300009551 Bacteria 7914
237 Ga0105238_10015292 3300009551 Bacteria 7773
238 Ga0105238_10036955 3300009551 Bacteria 4966
239 Ga0105249_10074455 3300009553 Unclassified 3143
240 Ga0105249_10246124 3300009553 Unclassified 1770
241 Ga0105239_10022785 3300010375 Bacteria 6903
242 Ga0105239_10207315 3300010375 Bacteria 2197
243 Ga0105239_10922527 3300010375 Bacteria 1003
244 Ga0105246_10025895 3300011119 Bacteria 3826
245 Ga0105246_10087847 3300011119 Bacteria 2232
246 Ga0105246_10185256 3300011119 Unclassified 1606
247 Ga0105246_10208490 3300011119 Bacteria 1524
248 Ga0105246_10546236 3300011119 Bacteria 992
249 Ga0157373_10156251 3300013100 Bacteria 1604
250 Ga0157373_10157752 3300013100 Bacteria 1596
251 Ga0157370_10254223 3300013104 Bacteria 1625
252 Ga0157370_10761236 3300013104 Unclassified 882
253 Ga0157369_10076299 3300013105 Bacteria 3593
254 Ga0157369_10454718 3300013105 Bacteria 1326
255 Ga0157374_10007435 3300013296 Bacteria 9343
256 Ga0157374_10018562 3300013296 Bacteria 6141
257 Ga0157374_10069582 3300013296 Bacteria 3314
258 Ga0157374_10088094 3300013296 Bacteria 2956
259 Ga0157374_10117679 3300013296 Unclassified 2561
260 Ga0157374_10137259 3300013296 Unclassified 2372
261 Ga0157374_10187600 3300013296 Unclassified 2022
262 Ga0157374_10575785 3300013296 Unclassified 1135
263 Ga0157374_10582737 3300013296 Bacteria 1128
264 Ga0157378_10000260 3300013297 Bacteria 51886
265 Ga0157378_10000406 3300013297 Bacteria 42503
266 Ga0157378_10017369 3300013297 Bacteria 6314
267 Ga0157378_10046181 3300013297 Bacteria 3872
268 Ga0157378_10046601 3300013297 Bacteria 3853
269 Ga0157378_10203072 3300013297 Unclassified 1875
270 Ga0157378_10370909 3300013297 Bacteria 1403
271 Ga0157378_10838286 3300013297 Unclassified 947
272 Ga0157378_10924473 3300013297 Bacteria 904
273 Ga0163162_10027465 3300013306 Bacteria 5628
274 Ga0163162_10043813 3300013306 Bacteria 4480
275 Ga0163162_10350023 3300013306 Bacteria 1610
276 Ga0163162_10391125 3300013306 Unclassified 1523
277 Ga0163162_10623602 3300013306 Bacteria 1203
278 Ga0157372_10588019 3300013307 Bacteria 1298
279 Ga0157375_10000489 3300013308 Bacteria 35906
280 Ga0157375_10022655 3300013308 Bacteria 5784
281 Ga0157375_10036921 3300013308 Bacteria 4677
282 Ga0157375_10068756 3300013308 Bacteria 3545
283 Ga0157375_10155271 3300013308 Bacteria 2427
284 Ga0157375_10694393 3300013308 Bacteria 1171
285 Ga0157375_11411404 3300013308 Bacteria 820
286 Ga0157375_11815117 3300013308 Unclassified 723
287 Ga0163163_10042428 3300014325 Bacteria 4456
288 Ga0163163_10138829 3300014325 Bacteria 2472
289 Ga0163163_10142461 3300014325 Bacteria 2440
290 Ga0163163_10171110 3300014325 Bacteria 2219
291 Ga0163163_10440059 3300014325 Unclassified 1363
292 Ga0163163_10631548 3300014325 Unclassified 1134
293 Ga0163163_10730841 3300014325 Bacteria 1053
294 Ga0157379_10047567 3300014968 Unclassified 3827
295 Ga0157379_11378312 3300014968 Unclassified 683
296 Ga0157376_10031685 3300014969 Bacteria 4237
297 Ga0157376_10138932 3300014969 Bacteria 2177
298 Ga0157376_10203542 3300014969 Unclassified 1823
299 Ga0213874_10069803 3300021377 Bacteria 1118
300 Ga0213876_10441188 3300021384 Unclassified 692
301 Ga0213875_10111706 3300021388 Bacteria 1276
302 Ga0228598_1009796 3300024227 Bacteria 1915
303 Ga0207642_10164316 3300025899 Unclassified 1195
304 Ga0207688_10333000 3300025901 Unclassified 933
305 Ga0207680_10093024 3300025903 Bacteria 1922
306 Ga0207680_10149754 3300025903 Unclassified 1555
307 Ga0207699_10022860 3300025906 Unclassified 3394
308 Ga0207699_10068678 3300025906 Bacteria 2158
309 Ga0207645_10022165 3300025907 Bacteria 4134
310 Ga0207643_10275247 3300025908 Unclassified 1043
311 Ga0207705_10052721 3300025909 Bacteria 2929
312 Ga0207684_10001740 3300025910 Bacteria 23019
313 Ga0207684_10608556 3300025910 Unclassified 933
314 Ga0207654_10012222 3300025911 Bacteria 4395
315 Ga0207654_10020959 3300025911 Unclassified 3471
316 Ga0207654_10247902 3300025911 Unclassified 1193
317 Ga0207707_10017650 3300025912 Bacteria 6224
318 Ga0207707_10189666 3300025912 Bacteria 1793
319 Ga0207707_10726513 3300025912 Bacteria 832
320 Ga0207695_10045169 3300025913 Unclassified 4679
321 Ga0207695_10209291 3300025913 Unclassified 1862
322 Ga0207695_10305635 3300025913 Unclassified 1481
323 Ga0207695_10350423 3300025913 Unclassified 1364
324 Ga0207663_10230622 3300025916 Bacteria 1352
325 Ga0207663_10847509 3300025916 Bacteria 729
326 Ga0207660_10011893 3300025917 Bacteria 5677
327 Ga0207660_10060733 3300025917 Bacteria 2719
328 Ga0207660_10194351 3300025917 Bacteria 1582
329 Ga0207660_10867161 3300025917 Bacteria 737
330 Ga0207657_10001005 3300025919 Bacteria 30014
331 Ga0207657_10033933 3300025919 Bacteria 4595
332 Ga0207649_10070020 3300025920 Bacteria 2236
333 Ga0207649_10691755 3300025920 Unclassified 790
334 Ga0207652_10257447 3300025921 Bacteria 1574
335 Ga0207652_10313067 3300025921 Bacteria 1417
336 Ga0207652_10458367 3300025921 Bacteria 1149
337 Ga0207652_10623405 3300025921 Unclassified 966
338 Ga0207681_10076025 3300025923 Bacteria 2357
339 Ga0207681_10169030 3300025923 Unclassified 1656
340 Ga0207694_10002164 3300025924 Bacteria 16156
341 Ga0207694_10311259 3300025924 Bacteria 1298
342 Ga0207694_10324417 3300025924 Bacteria 1271
343 Ga0207650_10005601 3300025925 Bacteria 8582
344 Ga0207659_10183836 3300025926 Unclassified 1658
345 Ga0207687_10003552 3300025927 Bacteria 10490
346 Ga0207687_10008830 3300025927 Bacteria 6586
347 Ga0207687_10015297 3300025927 Bacteria 5028
348 Ga0207687_10022959 3300025927 Unclassified 4153
349 Ga0207687_10070586 3300025927 Bacteria 2494
350 Ga0207687_10103832 3300025927 Bacteria 2096
351 Ga0207687_11036456 3300025927 Bacteria 704
352 Ga0207700_10105549 3300025928 Bacteria 2256
353 Ga0207700_10503901 3300025928 Unclassified 1071
354 Ga0207644_10098849 3300025931 Bacteria 2188
355 Ga0207690_10020371 3300025932 Bacteria 4097
356 Ga0207690_10103688 3300025932 Bacteria 2036
357 Ga0207706_10000139 3300025933 Bacteria 79096
358 Ga0207706_10086804 3300025933 Bacteria 2751
359 Ga0207686_10191792 3300025934 Unclassified 1457
360 Ga0207686_10410756 3300025934 Unclassified 1033
361 Ga0207709_10287988 3300025935 Bacteria 1216
362 Ga0207670_10000009 3300025936 Bacteria 293292
363 Ga0207704_10010246 3300025938 Bacteria 4563
364 Ga0207665_10876743 3300025939 Unclassified 711
365 Ga0207711_10011655 3300025941 Bacteria 7304
366 Ga0207711_10048362 3300025941 Bacteria 3639
367 Ga0207711_10150738 3300025941 Unclassified 2098
368 Ga0207711_10190092 3300025941 Bacteria 1871
369 Ga0207711_10198129 3300025941 Bacteria 1832
370 Ga0207711_10358481 3300025941 Bacteria 1351
371 Ga0207711_10475088 3300025941 Unclassified 1164
372 Ga0207711_10541834 3300025941 Unclassified 1085
373 Ga0207711_10905024 3300025941 Bacteria 820
374 Ga0207689_10000078 3300025942 Bacteria 79810
375 Ga0207689_10002934 3300025942 Bacteria 15747
376 Ga0207689_10104938 3300025942 Unclassified 2322
377 Ga0207661_10000016 3300025944 Bacteria 305159
378 Ga0207661_10064854 3300025944 Unclassified 2963
379 Ga0207661_10089881 3300025944 Bacteria 2556
380 Ga0207661_10406154 3300025944 Bacteria 1236
381 Ga0207661_10825195 3300025944 Unclassified 854
382 Ga0207679_10011857 3300025945 Bacteria 5665
383 Ga0207679_10354227 3300025945 Unclassified 1280
384 Ga0207667_10089376 3300025949 Bacteria 3184
385 Ga0207667_10237616 3300025949 Unclassified 1865
386 Ga0207667_10349193 3300025949 Bacteria 1509
387 Ga0207667_10391130 3300025949 Bacteria 1416
388 Ga0207651_10034427 3300025960 Bacteria 3280
389 Ga0207651_10315159 3300025960 Unclassified 1306
390 Ga0207640_10005387 3300025981 Bacteria 6975
391 Ga0207640_10126368 3300025981 Unclassified 1841
392 Ga0207658_10737335 3300025986 Bacteria 892
393 Ga0207677_10009003 3300026023 Bacteria 5601
394 Ga0207677_10082165 3300026023 Unclassified 2315
395 Ga0207703_10069927 3300026035 Bacteria 2896
396 Ga0207703_10389394 3300026035 Bacteria 1291
397 Ga0207703_10664143 3300026035 Bacteria 989
398 Ga0207639_10000051 3300026041 Bacteria 113927
399 Ga0207678_10000103 3300026067 Bacteria 69649
400 Ga0207702_10180354 3300026078 Unclassified 1944
401 Ga0207702_10957495 3300026078 Unclassified 849
402 Ga0207702_11163339 3300026078 Unclassified 765
403 Ga0207702_11198318 3300026078 Bacteria 753
404 Ga0207641_10015520 3300026088 Bacteria 6242
405 Ga0207641_10022346 3300026088 Bacteria 5207
406 Ga0207641_10500348 3300026088 Bacteria 1180
407 Ga0207648_10025558 3300026089 Bacteria 5258
408 Ga0207648_10058206 3300026089 Bacteria 3370
409 Ga0207648_10112572 3300026089 Unclassified 2390
410 Ga0207676_10450744 3300026095 Bacteria 1213
411 Ga0207676_10672649 3300026095 Bacteria 1001
412 Ga0207674_10045286 3300026116 Bacteria 4526
413 Ga0207674_10086285 3300026116 Bacteria 3133
414 Ga0207674_10208759 3300026116 Bacteria 1902
415 Ga0207674_10366345 3300026116 Bacteria 1393
416 Ga0207675_100026628 3300026118 Bacteria 5383
417 Ga0207683_10074033 3300026121 Bacteria 3013
418 Ga0207683_10130208 3300026121 Bacteria 2263
419 Ga0207683_10360208 3300026121 Unclassified 1336
420 Ga0268266_10306155 3300028379 Unclassified 1484
421 Ga0268265_10176408 3300028380 Bacteria 1832
422 Ga0268264_10011053 3300028381 Bacteria 7455
423 Ga0268264_10290845 3300028381 Unclassified 1534
424 Ga0268264_10413011 3300028381 Bacteria 1300
425 Ga0268264_10416209 3300028381 Bacteria 1295
426 Ga0265338_10444025 3300028800 Unclassified 919
427 Ga0265760_10044924 3300031090 Unclassified 1323
428 Ga0265332_10029863 3300031238 Unclassified 2382
429 Ga0265325_10004273 3300031241 Bacteria 9060
430 Ga0265325_10084851 3300031241 Bacteria 1569
431 Ga0265325_10097172 3300031241 Unclassified 1446
432 Ga0265325_10115646 3300031241 Unclassified 1298
433 Ga0265340_10010161 3300031247 Bacteria 5040
434 Ga0265316_10128196 3300031344 Bacteria 1912
435 Ga0265313_10053822 3300031595 Bacteria 1914
436 Ga0265314_10041638 3300031711 Bacteria 3285
437 Ga0265342_10121209 3300031712 Bacteria 1472
438 Ga0307416_101748536 3300032002 Bacteria 726
439 Ga0373944_0078730 3300035089 Unclassified 1085
440 Ga0373944_0307416 3300035089 Unclassified 596
441 Ga0373951_0013543 3300035091 Bacteria 1833
442 Ga0373923_0016185 3300035111 Unclassified 2828
443 Ga0373936_0052348 3300035113 Unclassified 1654
444 Ga0373939_0181508 3300035114 Unclassified 785
445 Ga0373945_0022444 3300035116 Bacteria 2174
446 Ga0373945_0098158 3300035116 Unclassified 1143
447 Ga0373954_0022754 3300035118 Bacteria 2846
448 Ga0373954_0117521 3300035118 Unclassified 1289
449 Ga0373956_0170923 3300035119 Unclassified 1026
450 Ga0373943_0035936 3300035170 Unclassified 2371
451 Ga0373943_0261348 3300035170 Bacteria 975
452 Ga0373946_0151094 3300035171 Bacteria 1083
453 Ga0373955_0333534 3300035172 Bacteria 917
454 Ga0373942_0024385 3300035207 Bacteria 1551
455 Ga0373935_0071597 3300035692 Bacteria 2237
456 Ga0373935_0111253 3300035692 Bacteria 1818
457 Ga0373935_0556683 3300035692 Unclassified 836
458 Ga0373927_0002182 3300035695 Bacteria 14382
459 Ga0373927_0009881 3300035695 Bacteria 6397
460 Ga0373927_0038453 3300035695 Bacteria 3106
461 Ga0373927_0059236 3300035695 Bacteria 2477
462 Ga0373947_0001524 3300035725 Bacteria 14206
463 Ga0373947_0117213 3300035725 Unclassified 1689
464 Ga0373947_0320167 3300035725 Unclassified 1037
465 Ga0373947_0458389 3300035725 Unclassified 864
466 Ga0373937_0131045 3300036401 Bacteria 2342
467 Ga0373937_0295063 3300036401 Unclassified 1532
468 Ga0373937_0388516 3300036401 Bacteria 1324
469 Ga0373925_0000437 3300037068 Bacteria 42142
470 Ga0373925_0025303 3300037068 Unclassified 4336
471 Ga0373925_0229038 3300037068 Bacteria 1485
472 Ga0436364_0976470 3300037853 Bacteria 1582
473 Ga0436365_0618115 3300039437 Bacteria 1622
474 Ga0436365_1395089 3300039437 Unclassified 707
475 Ga0436363_1386594 3300039450 Bacteria 1942
476 Ga0436363_1536091 3300039450 Bacteria 2651
477 Ga0436362_1235085 3300039453 Unclassified 1332
478 Ga0451577_0558969 3300042876 Bacteria 1039
479 Ga0451577_0687391 3300042876 Bacteria 927
480 Ga0466963_0054757 3300044694 Bacteria 2652
481 Ga0466964_0045140 3300044706 Bacteria 1793
482 Ga0451576_0038100 3300045051 Bacteria 5089
483 Ga0451576_0254588 3300045051 Bacteria 1835
484 Ga0466967_0064770 3300045976 Bacteria 3251
485 Ga0466967_0180000 3300045976 Unclassified 1994
486 Ga0466967_1057924 3300045976 Unclassified 808
487 Ga0495592_0010792 3300046454 Bacteria 6889
488 Ga0495651_0082235 3300046462 Unclassified 2430
489 Ga0495651_0180207 3300046462 Bacteria 1496
490 Ga0495651_0188867 3300046462 Bacteria 1451
491 Ga0495653_0050649 3300046463 Bacteria 3193
492 Ga0495580_0000195 3300046472 Bacteria 46323
493 Ga0495580_0017197 3300046472 Bacteria 5413
494 Ga0495580_0020647 3300046472 Bacteria 4872
495 Ga0495580_0055463 3300046472 Unclassified 2793
496 Ga0495580_0074082 3300046472 Bacteria 2377
497 Ga0495580_0120491 3300046472 Bacteria 1822
498 Ga0495580_0253571 3300046472 Unclassified 1204
499 Ga0495580_0289021 3300046472 Bacteria 1118
500 Ga0495580_0304091 3300046472 Bacteria 1086
501 Ga0495580_0620530 3300046472 Bacteria 713
502 Ga0495582_0290710 3300046473 Bacteria 939
503 Ga0495662_0027601 3300046476 Bacteria 2742
504 Ga0495662_0248648 3300046476 Unclassified 876
505 Ga0495664_0025498 3300046477 Bacteria 3442
506 Ga0495664_0208907 3300046477 Bacteria 1182
507 Ga0495608_0018061 3300046511 Bacteria 4873
508 Ga0495608_0655489 3300046511 Unclassified 627
509 Ga0495628_0359978 3300046516 Bacteria 1068
510 Ga0495630_0072333 3300046517 Bacteria 2595
511 Ga0495630_0101995 3300046517 Bacteria 2170
512 Ga0495666_0286796 3300046526 Bacteria 746
513 Ga0495652_0172895 3300046529 Bacteria 1666
514 Ga0495652_0232298 3300046529 Bacteria 1378
515 Ga0495665_0164156 3300046531 Bacteria 1157
516 Ga0495640_0078828 3300046533 Bacteria 2194
517 Ga0495640_0154709 3300046533 Unclassified 1472
518 Ga0495586_0032791 3300046535 Bacteria 2786
519 Ga0495586_0068015 3300046535 Unclassified 1943
520 Ga0495586_0263962 3300046535 Bacteria 983
521 Ga0495587_0077381 3300046536 Bacteria 1931
522 Ga0495587_0138510 3300046536 Unclassified 1390
523 Ga0495587_0143463 3300046536 Bacteria 1362
524 Ga0495587_0165295 3300046536 Bacteria 1258
525 Ga0495587_0351696 3300046536 Unclassified 821
526 Ga0495645_0009103 3300046543 Bacteria 6937
527 Ga0495645_0016382 3300046543 Bacteria 5290
528 Ga0495645_0203728 3300046543 Bacteria 1340
529 Ga0495622_0084519 3300046557 Bacteria 1460
530 Ga0495633_0275383 3300046558 Unclassified 766
531 Ga0495667_0067859 3300046559 Unclassified 2330
532 Ga0495667_0075205 3300046559 Unclassified 2198
533 Ga0495667_0113741 3300046559 Bacteria 1749
534 Ga0495667_0221098 3300046559 Unclassified 1209
535 Ga0495667_0317787 3300046559 Unclassified 985
536 Ga0495634_0045723 3300046642 Unclassified 2958
537 Ga0495634_0092006 3300046642 Bacteria 1968
538 Ga0495635_0132545 3300046663 Bacteria 1699
539 Ga0495635_0166353 3300046663 Unclassified 1500
540 Ga0495635_0264109 3300046663 Unclassified 1159
541 Ga0495657_0149924 3300046675 Bacteria 1448
542 Ga0495599_0098136 3300046678 Bacteria 1826
543 Ga0495599_0157226 3300046678 Unclassified 1406
544 Ga0495599_0484703 3300046678 Unclassified 729
545 Ga0495623_0011538 3300046679 Bacteria 5719
546 Ga0495623_0168498 3300046679 Bacteria 1281
547 Ga0495646_0067749 3300046680 Bacteria 2109
548 Ga0495647_0081274 3300046681 Unclassified 1315
549 Ga0495658_0272215 3300046683 Bacteria 1068
550 Ga0495613_0025959 3300046689 Bacteria 4365
551 Ga0495613_0184671 3300046689 Unclassified 1476
552 Ga0495613_0227110 3300046689 Bacteria 1309
553 Ga0495613_0298141 3300046689 Bacteria 1116
554 Ga0495624_0492658 3300046690 Unclassified 733
555 Ga0495600_0068500 3300046809 Bacteria 2319
556 Ga0495581_0058040 3300047315 Bacteria 2234
557 Ga0495604_0235188 3300047317 Bacteria 1255
558 Ga0495674_0055535 3300047319 Bacteria 3472
559 Ga0495674_0132366 3300047319 Bacteria 2101
560 Ga0495674_0149721 3300047319 Unclassified 1957
561 Ga0495674_0202063 3300047319 Bacteria 1648
562 Ga0495674_0469312 3300047319 Unclassified 1009
563 Ga0495674_1156692 3300047319 Unclassified 587
564 Ga0495680_0061702 3300047322 Bacteria 2883
565 Ga0495680_0221137 3300047322 Bacteria 1352
566 Ga0495675_0030593 3300047444 Bacteria 3435
567 Ga0495675_0040452 3300047444 Bacteria 2971
568 Ga0495675_0237412 3300047444 Unclassified 1098
569 Ga0495675_0296325 3300047444 Bacteria 961
570 Ga0495675_0495289 3300047444 Bacteria 702
571 Ga0495679_044245 3300047446 Bacteria 1364
572 Ga0495684_0001262 3300047471 Bacteria 20364
573 Ga0495684_0019426 3300047471 Bacteria 5232
574 Ga0495684_0403181 3300047471 Unclassified 959
575 Ga0495602_0022709 3300048088 Bacteria 6135
576 Ga0495602_0033675 3300048088 Bacteria 4803
577 Ga0495602_0111384 3300048088 Bacteria 2223
578 Ga0496100_0208014 3300048903 Unclassified 1430
579 Ga0496101_0551111 3300048904 Unclassified 912
580 Ga0496102_0624411 3300048905 Unclassified 1001
581 Ga0496103_0152384 3300048906 Bacteria 1481
582 Ga0496103_0710135 3300048906 Unclassified 637
583 Ga0496104_0382020 3300048907 Bacteria 1321
584 Ga0496105_0086701 3300048908 Unclassified 2587
585 Ga0496107_0154822 3300048910 Unclassified 1697
586 Ga0496107_0448133 3300048910 Bacteria 959
587 Ga0496108_0328659 3300048911 Bacteria 1333
588 Ga0496108_0583859 3300048911 Bacteria 974
589 Ga0496109_0042984 3300048912 Bacteria 4096
590 Ga0496109_0150148 3300048912 Unclassified 2182
591 Ga0496109_0353963 3300048912 Bacteria 1387
592 Ga0496112_0005770 3300048915 Bacteria 10768
593 Ga0496112_0075072 3300048915 Bacteria 3343
594 Ga0496112_0183153 3300048915 Bacteria 2058
595 Ga0496112_0653184 3300048915 Unclassified 981
596 Ga0496113_0021354 3300048916 Bacteria 4566
597 Ga0496113_0470985 3300048916 Bacteria 1009
598 Ga0496114_0723410 3300048917 Bacteria 872
599 Ga0496115_0298571 3300048918 Bacteria 1320
600 Ga0496115_0833319 3300048918 Unclassified 716
601 Ga0501031_0025457 3300049568 Bacteria 3858
602 Ga0501032_0001129 3300049569 Bacteria 21346
603 Ga0501033_0003504 3300049570 Bacteria 12863
604 Ga0501034_0067324 3300049571 Bacteria 3594
605 Ga0501036_0000754 3300049572 Bacteria 23971
606 Ga0501037_0002378 3300049573 Bacteria 13582
607 Ga0501038_0003812 3300049574 Bacteria 14019
608 Ga0501039_0003317 3300049575 Bacteria 12041
609 Ga0501043_0008597 3300049579 Bacteria 8047
610 Ga0501046_0002933 3300049580 Bacteria 15779
611 Ga0501047_0098179 3300049581 Bacteria 2807
612 Ga0501047_0865880 3300049581 Bacteria 717
613 Ga0501048_0050348 3300049582 Bacteria 2967
614 Ga0501067_0004070 3300049583 Bacteria 8065
615 Ga0501068_0001857 3300049584 Bacteria 11215
616 Ga0501068_0557436 3300049584 Unclassified 745
617 Ga0501069_0002347 3300049585 Bacteria 9584
618 Ga0501070_0006464 3300049586 Bacteria 9976
619 Ga0501072_0005933 3300049588 Bacteria 9306
620 Ga0501073_0033595 3300049589 Bacteria 3651
621 Ga0501076_0145471 3300049592 Bacteria 1927
622 Ga0501077_0056816 3300049593 Unclassified 2484
623 Ga0501079_0003914 3300049741 Bacteria 10998
624 Ga0501080_0000221 3300049742 Bacteria 42495
625 Ga0501083_0000648 3300049744 Bacteria 22482
626 Ga0501035_0013979 3300049822 Bacteria 7405
627 nmdc:mga05p37_11828_c1 3300050507 Bacteria 10403
628 nmdc:mga05p37_470862_c1 3300050507 Bacteria 1450
629 nmdc:mga05p37_672382_c1 3300050507 Bacteria 1156
630 nmdc:mga0qj67_241560_c1 3300050509 Bacteria 1465
631 nmdc:mga0qj67_55689_c1 3300050509 Unclassified 3133
632 nmdc:mga06r32_1451189_c1 3300050510 Unclassified 627
633 nmdc:mga06r32_150203_c1 3300050510 Bacteria 2308
634 nmdc:mga06r32_99807_c1 3300050510 Unclassified 2848
635 nmdc:mga08y16_810679_c1 3300050511 Unclassified 928
636 nmdc:mga0n895_274320_c1 3300050512 Bacteria 1710
637 nmdc:mga0n895_316758_c1 3300050512 Bacteria 1581
638 nmdc:mga0n895_317260_c1 3300050512 Bacteria 1579
639 nmdc:mga0n895_39853_c1 3300050512 Unclassified 4562
640 nmdc:mga0n895_414697_c1 3300050512 Unclassified 1361
641 nmdc:mga08x19_169730_c1 3300050514 Unclassified 1485
642 nmdc:mga08x19_57578_c1 3300050514 Unclassified 2512
643 nmdc:mga08x19_76339_c1 3300050514 Unclassified 2192
644 nmdc:mga08x19_800563_c1 3300050514 Bacteria 669
645 nmdc:mga0a205_164055_c1 3300050515 Unclassified 2118
646 nmdc:mga0a205_22970_c2 3300050515 Bacteria 2089
647 nmdc:mga0a205_281688_c1 3300050515 Bacteria 1538
648 Ga0495612_0131875 3300053078 Bacteria 1080
649 Ga0495595_0327243 3300053084 Bacteria 772
650 Ga0501084_0001446 3300054114 Bacteria 18876
651 Ga0530510_0228404 3300061734 Bacteria 1384
652 Ga0070680_100135514
653 MRS1b_contig_3590143
654 MBSR1b_contig_10696368
655 MBSR1b_contig_7172159
656 Ga0065704_10408488
657 Ga0065712_10070525
658 Ga0065715_10002194
659 Ga0070658_10002655
660 Ga0070658_10513895
661 Ga0070676_10259972
662 Ga0070676_10271797
663 Ga0070683_100000011
664 Ga0070683_100021544
665 Ga0070683_100061088
666 Ga0070690_100014122
667 Ga0070690_100395570
668 Ga0070670_100004616
669 Ga0070670_100420297
670 Ga0070677_10431223
671 Ga0068869_100000283
672 Ga0068869_100017274
673 Ga0070666_10011999
674 Ga0070666_10090058
675 Ga0070680_100007894
676 Ga0070680_100046689
677 Ga0070680_100360760
678 Ga0070680_100980885
679 Ga0070682_100084521
680 Ga0070682_100239182
681 Ga0068868_100012551
682 Ga0068868_100015978
683 Ga0068868_100136527
684 Ga0068868_101360417
685 Ga0070660_100023246
686 Ga0070660_100201458
687 Ga0070689_100000010
688 Ga0070687_100197362
689 Ga0070687_100416478
690 Ga0070661_100372443
691 Ga0070669_100040509
692 Ga0070669_100252079
693 Ga0070675_100034798
694 Ga0070671_100028370
695 Ga0070673_100021628
696 Ga0070673_100315757
697 Ga0070688_100096357
698 Ga0070659_100021419
699 Ga0070659_100037480
700 Ga0070659_100137533
701 Ga0070667_100058765
702 Ga0070667_100400425
703 Ga0070667_100713329
704 Ga0070709_10031685
705 Ga0070714_100383036
706 Ga0070713_100058870
707 Ga0070713_100074067
708 Ga0070713_100298782
709 Ga0070713_101060111
710 Ga0070711_100550951
711 Ga0070711_100998133
712 Ga0070705_100124552
713 Ga0070705_100328955
714 Ga0070694_100025641
715 Ga0070694_100244682
716 Ga0070708_100008430
717 Ga0070708_100029786
718 Ga0070708_100087450
719 Ga0070663_100015276
720 Ga0070678_100024025
721 Ga0070678_100513754
722 Ga0070662_100032687
723 Ga0070681_10009604
724 Ga0070681_10098542
725 Ga0070681_10305424
726 Ga0070681_10356648
727 Ga0068867_100012417
728 Ga0068867_100041194
729 Ga0070706_100003994
730 Ga0070706_100052647
731 Ga0070706_100090333
732 Ga0070706_100164683
733 Ga0070707_100056320
734 Ga0070698_100000830
735 Ga0070698_101154920
736 Ga0070679_100024956
737 Ga0070679_100069715
738 Ga0070679_100134124
739 Ga0070679_100688077
740 Ga0070684_100000001
741 Ga0070684_100049730
742 Ga0070684_100099538
743 Ga0070684_100383892
744 Ga0070684_100458731
745 Ga0070697_100000183
746 Ga0070697_100066701
747 Ga0070697_100098899
748 Ga0070697_100294238
749 Ga0070697_100348852
750 Ga0068853_100485386
751 Ga0070672_100835865
752 Ga0070686_100100291
753 Ga0070686_100191291
754 Ga0070686_100235657
755 Ga0070695_100028325
756 Ga0070696_100019540
757 Ga0070696_100083397
758 Ga0070696_100135501
759 Ga0070696_100222430
760 Ga0070665_100965163
761 Ga0070704_100094961
762 Ga0070704_100247871
763 Ga0068855_100145874
764 Ga0068855_100157188
765 Ga0068855_100201000
766 Ga0068855_100210565
767 Ga0068855_100315225
768 Ga0068855_100446904
769 Ga0070664_100034964
770 Ga0070664_100194256
771 Ga0068857_100074794
772 Ga0068857_100214017
773 Ga0068857_100271942
774 Ga0068857_100502002
775 Ga0068854_100004383
776 Ga0068854_100009000
777 Ga0068856_100226556
778 Ga0068856_100273540
779 Ga0068856_100297754
780 Ga0068856_101022779
781 Ga0068852_100021007
782 Ga0068859_100121014
783 Ga0068859_100127549
784 Ga0068859_100388571
785 Ga0068859_100593653
786 Ga0068864_100350957
787 Ga0068864_101098566
788 Ga0068861_100520823
789 Ga0068870_10265138
790 Ga0068863_100046850
791 Ga0068863_100088869
792 Ga0068858_100007549
793 Ga0068858_100192244
794 Ga0068858_100209273
795 Ga0068858_100273922
796 Ga0068858_100660313
797 Ga0068860_100047715
798 Ga0068860_100070507
799 Ga0068860_100204570
800 Ga0068860_100362469
801 Ga0068860_100436015
802 Ga0068862_100096648
803 Ga0081455_10023072
804 Ga0081455_10086606
805 Ga0070717_10003732
806 Ga0070717_10006318
807 Ga0070717_10064888
808 Ga0070717_10131068
809 Ga0070717_10143124
810 Ga0070717_10410045
811 Ga0070715_10294750
812 Ga0097621_100001499
813 Ga0097621_100059331
814 Ga0097621_100079470
815 Ga0097621_100197333
816 Ga0097621_100212532
817 Ga0097621_100370965
818 Ga0097621_100412870
819 Ga0068871_100001120
820 Ga0068871_100006145
821 Ga0068871_100007875
822 Ga0068871_100264682
823 Ga0068871_100713012
824 Ga0075428_100036657
825 Ga0075430_100148655
826 Ga0075430_100340013
827 Ga0075431_100097671
828 Ga0075433_10099901
829 Ga0075433_10381453
830 Ga0075434_100078025
831 Ga0075434_100124202
832 Ga0075434_100464976
833 Ga0075434_100843427
834 Ga0075429_100043479
835 Ga0075429_100211545
836 Ga0068865_100006668
837 Ga0068865_100012979
838 Ga0068865_100182351
839 Ga0075436_100038388
840 Ga0075436_100162904
841 Ga0075436_100328316
842 Ga0075436_100829026
843 Ga0097620_100121017
844 Ga0097620_100127563
845 Ga0097620_100388556
846 Ga0097620_100593693
847 Ga0075435_100054691
848 Ga0099794_10191269
849 Ga0105240_10058912
850 Ga0105240_10425534
851 Ga0105240_10425672
852 Ga0105240_10718145
853 Ga0105240_11268294
854 Ga0111539_10908097
855 Ga0105245_10003727
856 Ga0105245_10012108
857 Ga0105245_10024338
858 Ga0105245_10063457
859 Ga0105245_10133224
860 Ga0105245_10207617
861 Ga0105245_10308245
862 Ga0105247_10014437
863 Ga0114129_10374375
864 Ga0114129_10639527
865 Ga0105243_10804548
866 Ga0105241_10029529
867 Ga0105241_10087259
868 Ga0105241_10284148
869 Ga0105242_10259329
870 Ga0105242_10280075
871 Ga0105242_10997700
872 Ga0105248_10046481
873 Ga0105248_10078369
874 Ga0105248_10182923
875 Ga0105248_10205638
876 Ga0105248_10247611
877 Ga0105248_10559488
878 Ga0105248_10726356
879 Ga0105248_11105573
880 Ga0105248_11191554
881 Ga0105237_10006907
882 Ga0105237_10040299
883 Ga0105237_10221622
884 Ga0105237_10509266
885 Ga0105237_10701857
886 Ga0105237_10739651
887 Ga0105238_10014699
888 Ga0105238_10015292
889 Ga0105238_10036955
890 Ga0105249_10074455
891 Ga0105249_10246124
892 Ga0105239_10022785
893 Ga0105239_10207315
894 Ga0105239_10922527
895 Ga0105246_10025895
896 Ga0105246_10087847
897 Ga0105246_10185256
898 Ga0105246_10208490
899 Ga0105246_10546236
900 Ga0157373_10156251
901 Ga0157373_10157752
902 Ga0157370_10254223
903 Ga0157370_10761236
904 Ga0157369_10076299
905 Ga0157369_10454718
906 Ga0157374_10007435
907 Ga0157374_10018562
908 Ga0157374_10069582
909 Ga0157374_10088094
910 Ga0157374_10117679
911 Ga0157374_10137259
912 Ga0157374_10187600
913 Ga0157374_10575785
914 Ga0157374_10582737
915 Ga0157378_10000260
916 Ga0157378_10000406
917 Ga0157378_10017369
918 Ga0157378_10046181
919 Ga0157378_10046601
920 Ga0157378_10203072
921 Ga0157378_10370909
922 Ga0157378_10838286
923 Ga0157378_10924473
924 Ga0163162_10027465
925 Ga0163162_10043813
926 Ga0163162_10350023
927 Ga0163162_10391125
928 Ga0163162_10623602
929 Ga0157372_10588019
930 Ga0157375_10000489
931 Ga0157375_10022655
932 Ga0157375_10036921
933 Ga0157375_10068756
934 Ga0157375_10155271
935 Ga0157375_10694393
936 Ga0157375_11411404
937 Ga0157375_11815117
938 Ga0163163_10042428
939 Ga0163163_10138829
940 Ga0163163_10142461
941 Ga0163163_10171110
942 Ga0163163_10440059
943 Ga0163163_10631548
944 Ga0163163_10730841
945 Ga0157379_10047567
946 Ga0157379_11378312
947 Ga0157376_10031685
948 Ga0157376_10138932
949 Ga0157376_10203542
950 Ga0213874_10069803
951 Ga0213876_10441188
952 Ga0213875_10111706
953 Ga0228598_1009796
954 Ga0207642_10164316
955 Ga0207688_10333000
956 Ga0207680_10093024
957 Ga0207680_10149754
958 Ga0207699_10022860
959 Ga0207699_10068678
960 Ga0207645_10022165
961 Ga0207643_10275247
962 Ga0207705_10052721
963 Ga0207684_10001740
964 Ga0207684_10608556
965 Ga0207654_10012222
966 Ga0207654_10020959
967 Ga0207654_10247902
968 Ga0207707_10017650
969 Ga0207707_10189666
970 Ga0207707_10726513
971 Ga0207695_10045169
972 Ga0207695_10209291
973 Ga0207695_10305635
974 Ga0207695_10350423
975 Ga0207663_10230622
976 Ga0207663_10847509
977 Ga0207660_10011893
978 Ga0207660_10060733
979 Ga0207660_10194351
980 Ga0207660_10867161
981 Ga0207657_10001005
982 Ga0207657_10033933
983 Ga0207649_10070020
984 Ga0207649_10691755
985 Ga0207652_10257447
986 Ga0207652_10313067
987 Ga0207652_10458367
988 Ga0207652_10623405
989 Ga0207681_10076025
990 Ga0207681_10169030
991 Ga0207694_10002164
992 Ga0207694_10311259
993 Ga0207694_10324417
994 Ga0207650_10005601
995 Ga0207659_10183836
996 Ga0207687_10003552
997 Ga0207687_10008830
998 Ga0207687_10015297
999 Ga0207687_10022959
1000 Ga0207687_10070586
1001 Ga0207687_10103832
1002 Ga0207687_11036456
1003 Ga0207700_10105549
1004 Ga0207700_10503901
1005 Ga0207644_10098849
1006 Ga0207690_10020371
1007 Ga0207690_10103688
1008 Ga0207706_10000139
1009 Ga0207706_10086804
1010 Ga0207686_10191792
1011 Ga0207686_10410756
1012 Ga0207709_10287988
1013 Ga0207670_10000009
1014 Ga0207704_10010246
1015 Ga0207665_10876743
1016 Ga0207711_10011655
1017 Ga0207711_10048362
1018 Ga0207711_10150738
1019 Ga0207711_10190092
1020 Ga0207711_10198129
1021 Ga0207711_10358481
1022 Ga0207711_10475088
1023 Ga0207711_10541834
1024 Ga0207711_10905024
1025 Ga0207689_10000078
1026 Ga0207689_10002934
1027 Ga0207689_10104938
1028 Ga0207661_10000016
1029 Ga0207661_10064854
1030 Ga0207661_10089881
1031 Ga0207661_10406154
1032 Ga0207661_10825195
1033 Ga0207679_10011857
1034 Ga0207679_10354227
1035 Ga0207667_10089376
1036 Ga0207667_10237616
1037 Ga0207667_10349193
1038 Ga0207667_10391130
1039 Ga0207651_10034427
1040 Ga0207651_10315159
1041 Ga0207640_10005387
1042 Ga0207640_10126368
1043 Ga0207658_10737335
1044 Ga0207677_10009003
1045 Ga0207677_10082165
1046 Ga0207703_10069927
1047 Ga0207703_10389394
1048 Ga0207703_10664143
1049 Ga0207639_10000051
1050 Ga0207678_10000103
1051 Ga0207702_10180354
1052 Ga0207702_10957495
1053 Ga0207702_11163339
1054 Ga0207702_11198318
1055 Ga0207641_10015520
1056 Ga0207641_10022346
1057 Ga0207641_10500348
1058 Ga0207648_10025558
1059 Ga0207648_10058206
1060 Ga0207648_10112572
1061 Ga0207676_10450744
1062 Ga0207676_10672649
1063 Ga0207674_10045286
1064 Ga0207674_10086285
1065 Ga0207674_10208759
1066 Ga0207674_10366345
1067 Ga0207675_100026628
1068 Ga0207683_10074033
1069 Ga0207683_10130208
1070 Ga0207683_10360208
1071 Ga0268266_10306155
1072 Ga0268265_10176408
1073 Ga0268264_10011053
1074 Ga0268264_10290845
1075 Ga0268264_10413011
1076 Ga0268264_10416209
1077 Ga0265338_10444025
1078 Ga0265760_10044924
1079 Ga0265332_10029863
1080 Ga0265325_10004273
1081 Ga0265325_10084851
1082 Ga0265325_10097172
1083 Ga0265325_10115646
1084 Ga0265340_10010161
1085 Ga0265316_10128196
1086 Ga0265313_10053822
1087 Ga0265314_10041638
1088 Ga0265342_10121209
1089 Ga0307416_101748536
1090 Ga0373944_0078730
1091 Ga0373944_0307416
1092 Ga0373951_0013543
1093 Ga0373923_0016185
1094 Ga0373936_0052348
1095 Ga0373939_0181508
1096 Ga0373945_0022444
1097 Ga0373945_0098158
1098 Ga0373954_0022754
1099 Ga0373954_0117521
1100 Ga0373956_0170923
1101 Ga0373943_0035936
1102 Ga0373943_0261348
1103 Ga0373946_0151094
1104 Ga0373955_0333534
1105 Ga0373942_0024385
1106 Ga0373935_0071597
1107 Ga0373935_0111253
1108 Ga0373935_0556683
1109 Ga0373927_0002182
1110 Ga0373927_0009881
1111 Ga0373927_0038453
1112 Ga0373927_0059236
1113 Ga0373947_0001524
1114 Ga0373947_0117213
1115 Ga0373947_0320167
1116 Ga0373947_0458389
1117 Ga0373937_0131045
1118 Ga0373937_0295063
1119 Ga0373937_0388516
1120 Ga0373925_0000437
1121 Ga0373925_0025303
1122 Ga0373925_0229038
1123 Ga0436364_0976470
1124 Ga0436365_0618115
1125 Ga0436365_1395089
1126 Ga0436363_1386594
1127 Ga0436363_1536091
1128 Ga0436362_1235085
1129 Ga0451577_0558969
1130 Ga0451577_0687391
1131 Ga0466963_0054757
1132 Ga0466964_0045140
1133 Ga0451576_0038100
1134 Ga0451576_0254588
1135 Ga0466967_0064770
1136 Ga0466967_0180000
1137 Ga0466967_1057924
1138 Ga0495592_0010792
1139 Ga0495651_0082235
1140 Ga0495651_0180207
1141 Ga0495651_0188867
1142 Ga0495653_0050649
1143 Ga0495580_0000195
1144 Ga0495580_0017197
1145 Ga0495580_0020647
1146 Ga0495580_0055463
1147 Ga0495580_0074082
1148 Ga0495580_0120491
1149 Ga0495580_0253571
1150 Ga0495580_0289021
1151 Ga0495580_0304091
1152 Ga0495580_0620530
1153 Ga0495582_0290710
1154 Ga0495662_0027601
1155 Ga0495662_0248648
1156 Ga0495664_0025498
1157 Ga0495664_0208907
1158 Ga0495608_0018061
1159 Ga0495608_0655489
1160 Ga0495628_0359978
1161 Ga0495630_0072333
1162 Ga0495630_0101995
1163 Ga0495666_0286796
1164 Ga0495652_0172895
1165 Ga0495652_0232298
1166 Ga0495665_0164156
1167 Ga0495640_0078828
1168 Ga0495640_0154709
1169 Ga0495586_0032791
1170 Ga0495586_0068015
1171 Ga0495586_0263962
1172 Ga0495587_0077381
1173 Ga0495587_0138510
1174 Ga0495587_0143463
1175 Ga0495587_0165295
1176 Ga0495587_0351696
1177 Ga0495645_0009103
1178 Ga0495645_0016382
1179 Ga0495645_0203728
1180 Ga0495622_0084519
1181 Ga0495633_0275383
1182 Ga0495667_0067859
1183 Ga0495667_0075205
1184 Ga0495667_0113741
1185 Ga0495667_0221098
1186 Ga0495667_0317787
1187 Ga0495634_0045723
1188 Ga0495634_0092006
1189 Ga0495635_0132545
1190 Ga0495635_0166353
1191 Ga0495635_0264109
1192 Ga0495657_0149924
1193 Ga0495599_0098136
1194 Ga0495599_0157226
1195 Ga0495599_0484703
1196 Ga0495623_0011538
1197 Ga0495623_0168498
1198 Ga0495646_0067749
1199 Ga0495647_0081274
1200 Ga0495658_0272215
1201 Ga0495613_0025959
1202 Ga0495613_0184671
1203 Ga0495613_0227110
1204 Ga0495613_0298141
1205 Ga0495624_0492658
1206 Ga0495600_0068500
1207 Ga0495581_0058040
1208 Ga0495604_0235188
1209 Ga0495674_0055535
1210 Ga0495674_0132366
1211 Ga0495674_0149721
1212 Ga0495674_0202063
1213 Ga0495674_0469312
1214 Ga0495674_1156692
1215 Ga0495680_0061702
1216 Ga0495680_0221137
1217 Ga0495675_0030593
1218 Ga0495675_0040452
1219 Ga0495675_0237412
1220 Ga0495675_0296325
1221 Ga0495675_0495289
1222 Ga0495679_044245
1223 Ga0495684_0001262
1224 Ga0495684_0019426
1225 Ga0495684_0403181
1226 Ga0495602_0022709
1227 Ga0495602_0033675
1228 Ga0495602_0111384
1229 Ga0496100_0208014
1230 Ga0496101_0551111
1231 Ga0496102_0624411
1232 Ga0496103_0152384
1233 Ga0496103_0710135
1234 Ga0496104_0382020
1235 Ga0496105_0086701
1236 Ga0496107_0154822
1237 Ga0496107_0448133
1238 Ga0496108_0328659
1239 Ga0496108_0583859
1240 Ga0496109_0042984
1241 Ga0496109_0150148
1242 Ga0496109_0353963
1243 Ga0496112_0005770
1244 Ga0496112_0075072
1245 Ga0496112_0183153
1246 Ga0496112_0653184
1247 Ga0496113_0021354
1248 Ga0496113_0470985
1249 Ga0496114_0723410
1250 Ga0496115_0298571
1251 Ga0496115_0833319
1252 Ga0501031_0025457
1253 Ga0501032_0001129
1254 Ga0501033_0003504
1255 Ga0501034_0067324
1256 Ga0501036_0000754
1257 Ga0501037_0002378
1258 Ga0501038_0003812
1259 Ga0501039_0003317
1260 Ga0501043_0008597
1261 Ga0501046_0002933
1262 Ga0501047_0098179
1263 Ga0501047_0865880
1264 Ga0501048_0050348
1265 Ga0501067_0004070
1266 Ga0501068_0001857
1267 Ga0501068_0557436
1268 Ga0501069_0002347
1269 Ga0501070_0006464
1270 Ga0501072_0005933
1271 Ga0501073_0033595
1272 Ga0501076_0145471
1273 Ga0501077_0056816
1274 Ga0501079_0003914
1275 Ga0501080_0000221
1276 Ga0501083_0000648
1277 Ga0501035_0013979
1278 nmdc:mga05p37_11828_c1
1279 nmdc:mga05p37_470862_c1
1280 nmdc:mga05p37_672382_c1
1281 nmdc:mga0qj67_241560_c1
1282 nmdc:mga0qj67_55689_c1
1283 nmdc:mga06r32_1451189_c1
1284 nmdc:mga06r32_150203_c1
1285 nmdc:mga06r32_99807_c1
1286 nmdc:mga08y16_810679_c1
1287 nmdc:mga0n895_274320_c1
1288 nmdc:mga0n895_316758_c1
1289 nmdc:mga0n895_317260_c1
1290 nmdc:mga0n895_39853_c1
1291 nmdc:mga0n895_414697_c1
1292 nmdc:mga08x19_169730_c1
1293 nmdc:mga08x19_57578_c1
1294 nmdc:mga08x19_76339_c1
1295 nmdc:mga08x19_800563_c1
1296 nmdc:mga0a205_164055_c1
1297 nmdc:mga0a205_22970_c2
1298 nmdc:mga0a205_281688_c1
1299 Ga0495612_0131875
1300 Ga0495595_0327243
1301 Ga0501084_0001446
1302 Ga0530510_0228404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map