F472526

General Info

Members Datasets Scaffolds Average Seq Length
650 302 544 247

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10007744|Ga0207709_100077443
Length 294
Sequence MGLGDAGTQPLSDWRTTCFVQSPCGDGLSGLCHYASHSPVVGQSMNTHFSCVGCGKCCTDHHVPLTLAEARQWADDGGQVIVLVEAFLPDGTGITPQQREHAQRRSWGVPCGSTEARVAITFAAYNVGPCRNLDERLLCRIYKRRPLVXXXXPMEINPHIPLRPTAKECPPESWLTEQPLLISGGQLVDAGLARLIEDSRQADRDDIRAKQAICAHLGIHTTALKGDGFTAYLPQMNAFAQAIERVEQQSYWPAESEWAFHVSGHDIAEQLRAAGARVVSDTPLTYTFIPLRAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
4 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
5 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
6 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
7 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
8 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
9 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
10 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
11 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
12 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
13 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
14 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
15 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
16 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
17 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
18 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
19 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
20 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
21 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
22 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
23 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
24 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
25 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
26 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
27 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
28 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
29 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
30 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
31 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
32 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
33 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
34 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
35 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
36 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
37 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
38 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
39 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
40 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
41 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
42 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
43 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
44 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
45 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
46 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
47 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
48 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
49 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
50 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
51 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
52 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
53 2765235841 Pseudomonas putida AA7 Isolate Unclassified
54 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
55 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
56 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
57 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
58 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
59 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
60 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
61 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
62 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
63 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
64 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
65 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
66 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
67 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
68 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
69 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
70 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
71 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
72 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
73 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
74 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
75 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
76 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
77 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
78 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
79 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
80 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
81 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
82 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
83 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
84 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
85 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
86 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
87 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
88 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
89 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
90 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
91 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
92 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
93 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
94 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
95 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
96 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
97 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
98 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
99 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
100 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
101 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
102 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
103 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
104 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
105 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
106 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
111 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
112 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
143 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
183 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
188 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
189 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
190 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
191 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
192 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
193 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
194 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
195 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
196 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
197 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
201 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
260 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
284 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
287 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
288 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
289 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
290 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
291 8052494512 Pseudomonas putida LD6 Isolate Unclassified
292 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
293 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
294 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
295 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
296 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
297 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
298 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
299 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
300 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
301 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
302 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.69
Metatranscriptomes 0
Isolates 16.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0.92
Rhizoplane 6.46
Rhizosphere 71.69
Stem 0
Stem Tuber 0.15
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1073037 2162886007 Bacteria 1098
2 SwRhRL2b_contig_3024960 2162886007 Bacteria 3724
3 SwRhRL2b_contig_451913 2162886007 Bacteria 2347
4 JGI25162J39368_1000491 3300002737 Bacteria 30089
5 JGI25163J39215_1000427 3300002771 Bacteria 13075
6 JGI25164J39214_1000334 3300002772 Bacteria 30089
7 JGI25165J46597_1000616 3300003214 Bacteria 30089
8 Ga0055538_1000036 3300003751 Bacteria 190579
9 Ga0055539_1000047 3300003752 Bacteria 190579
10 Ga0055533_1000058 3300003756 Bacteria 190579
11 Ga0055532_1000234 3300003758 Bacteria 40769
12 Ga0055525_1000113 3300003759 Bacteria 124686
13 Ga0055536_1000707 3300003781 Bacteria 22391
14 Ga0055530_10000626 3300003791 Bacteria 30520
15 Ga0055530_10004127 3300003791 Bacteria 7708
16 Ga0055540_1000484 3300003792 Bacteria 30520
17 Ga0055540_1003397 3300003792 Bacteria 7715
18 Ga0055541_1000034 3300003841 Bacteria 190579
19 Ga0065714_10013533 3300005288 Bacteria 2996
20 Ga0065714_10065221 3300005288 Bacteria 11758
21 Ga0065714_10065847 3300005288 Bacteria 8302
22 Ga0065704_10008515 3300005289 Bacteria 2929
23 Ga0065704_10078692 3300005289 Bacteria 4355
24 Ga0065712_10067964 3300005290 Bacteria 18936
25 Ga0070670_100002191 3300005331 Bacteria 16051
26 Ga0070661_100001513 3300005344 Bacteria 16157
27 Ga0070669_100000570 3300005353 Bacteria 27388
28 Ga0070662_100000950 3300005457 Bacteria 17741
29 Ga0068853_100001285 3300005539 Bacteria 17999
30 Ga0070665_100030810 3300005548 Bacteria 5398
31 Ga0070664_100002049 3300005564 Bacteria 16138
32 Ga0068854_100033903 3300005578 Bacteria 3562
33 Ga0068851_10000006 3300005834 Bacteria 258116
34 Ga0075432_10000364 3300006058 Bacteria 13054
35 Ga0075436_100025206 3300006914 Bacteria 4091
36 Ga0075436_100222764 3300006914 Bacteria 1339
37 Ga0099823_1000082 3300006944 Bacteria 45197
38 Ga0099823_1062356 3300006944 Bacteria 1894
39 Ga0105251_10000580 3300009011 Bacteria 33722
40 Ga0105251_10000702 3300009011 Bacteria 30884
41 Ga0105251_10000933 3300009011 Bacteria 26175
42 Ga0105251_10001234 3300009011 Bacteria 22139
43 Ga0105251_10004637 3300009011 Bacteria 9264
44 Ga0105251_10005126 3300009011 Bacteria 8666
45 Ga0105251_10052398 3300009011 Bacteria 1943
46 Ga0105251_10238448 3300009011 Bacteria 819
47 Ga0105244_10000303 3300009036 Bacteria 47776
48 Ga0105244_10000703 3300009036 Bacteria 29061
49 Ga0105244_10001491 3300009036 Bacteria 18784
50 Ga0105244_10003141 3300009036 Bacteria 12025
51 Ga0105244_10008483 3300009036 Bacteria 6412
52 Ga0105244_10017940 3300009036 Bacteria 3985
53 Ga0105244_10024563 3300009036 Bacteria 3287
54 Ga0105244_10030567 3300009036 Bacteria 2865
55 Ga0105244_10039976 3300009036 Bacteria 2438
56 Ga0105244_10107981 3300009036 Bacteria 1357
57 Ga0105244_10111522 3300009036 Bacteria 1330
58 Ga0105250_10000216 3300009092 Bacteria 47921
59 Ga0105250_10006186 3300009092 Bacteria 5256
60 Ga0105250_10014872 3300009092 Bacteria 3192
61 Ga0105243_10000797 3300009148 Bacteria 30148
62 Ga0105243_10006057 3300009148 Bacteria 9355
63 Ga0105243_10006863 3300009148 Bacteria 8776
64 Ga0105243_10041234 3300009148 Bacteria 3610
65 Ga0105243_10125741 3300009148 Bacteria 2168
66 Ga0105242_10003570 3300009176 Bacteria 12100
67 Ga0105248_10036588 3300009177 Bacteria 5490
68 Ga0105237_10001380 3300009545 Bacteria 32072
69 Ga0105237_10371849 3300009545 Bacteria 1434
70 Ga0105249_10044565 3300009553 Bacteria 4033
71 Ga0105246_10000391 3300011119 Bacteria 23473
72 Ga0157373_10003948 3300013100 Bacteria 11198
73 Ga0157373_10008434 3300013100 Bacteria 7651
74 Ga0157373_10009036 3300013100 Bacteria 7374
75 Ga0157373_10029552 3300013100 Bacteria 3947
76 Ga0157373_10036047 3300013100 Bacteria 3551
77 Ga0157373_10039586 3300013100 Bacteria 3375
78 Ga0157371_10001815 3300013102 Bacteria 21543
79 Ga0157370_10064655 3300013104 Bacteria 3463
80 Ga0157369_10003869 3300013105 Bacteria 17782
81 Ga0157369_10008334 3300013105 Bacteria 11881
82 Ga0157369_10010281 3300013105 Bacteria 10675
83 Ga0157369_10230491 3300013105 Bacteria 1936
84 Ga0163162_10224732 3300013306 Bacteria 2007
85 Ga0157372_10008728 3300013307 Bacteria 10762
86 Ga0157375_10001660 3300013308 Bacteria 19146
87 Ga0157375_10015584 3300013308 Bacteria 6807
88 Ga0182008_10001819 3300014497 Bacteria 13896
89 Ga0182008_10004237 3300014497 Bacteria 8411
90 Ga0182008_10004590 3300014497 Bacteria 8041
91 Ga0182008_10009338 3300014497 Bacteria 5298
92 Ga0182008_10199034 3300014497 Bacteria 1019
93 Ga0182006_1000460 3300015261 Bacteria 32021
94 Ga0182007_10006306 3300015262 Bacteria 5101
95 Ga0182005_1028637 3300015265 Bacteria 1519
96 Ga0182005_1031895 3300015265 Bacteria 1434
97 Ga0163161_10017002 3300017792 Bacteria 5085
98 Ga0163161_10024982 3300017792 Bacteria 4224
99 Ga0209435_100990 3300025206 Bacteria 4094
100 Ga0209760_100232 3300025207 Bacteria 23924
101 Ga0209784_100050 3300025224 Bacteria 191780
102 Ga0209566_100063 3300025225 Bacteria 191780
103 Ga0209674_100084 3300025226 Bacteria 191780
104 Ga0209147_100083 3300025229 Bacteria 191212
105 Ga0209563_100084 3300025230 Bacteria 191780
106 Ga0207427_100007 3300025231 Bacteria 746220
107 Ga0209437_100006 3300025233 Bacteria 1042724
108 Ga0209437_105507 3300025233 Bacteria 2152
109 Ga0209258_100113 3300025242 Bacteria 191178
110 Ga0209646_1000463 3300025246 Bacteria 20587
111 Ga0209677_100047 3300025253 Bacteria 191780
112 Ga0209759_1002349 3300025256 Bacteria 8447
113 Ga0209759_1034646 3300025256 Bacteria 940
114 Ga0209233_1000059 3300025261 Bacteria 414562
115 Ga0209676_1000006 3300025292 Bacteria 1039588
116 Ga0209676_1000306 3300025292 Bacteria 97332
117 Ga0209050_1000027 3300025298 Bacteria 483261
118 Ga0209050_1000065 3300025298 Bacteria 313668
119 Ga0209051_1000102 3300025303 Bacteria 162911
120 Ga0209051_1000504 3300025303 Bacteria 49506
121 Ga0209257_1013653 3300025304 Bacteria 3583
122 Ga0207656_10000023 3300025321 Bacteria 98957
123 Ga0207696_1000210 3300025711 Bacteria 88330
124 Ga0207696_1000248 3300025711 Bacteria 72501
125 Ga0207696_1010241 3300025711 Bacteria 3449
126 Ga0207696_1023886 3300025711 Bacteria 1923
127 Ga0207696_1025108 3300025711 Bacteria 1862
128 Ga0207696_1032526 3300025711 Bacteria 1569
129 Ga0207655_1000005 3300025728 Bacteria 917277
130 Ga0207655_1000015 3300025728 Bacteria 600662
131 Ga0207655_1000311 3300025728 Bacteria 72337
132 Ga0207655_1000430 3300025728 Bacteria 56432
133 Ga0207655_1000630 3300025728 Bacteria 42308
134 Ga0207655_1002309 3300025728 Bacteria 15671
135 Ga0207655_1002514 3300025728 Bacteria 14766
136 Ga0207655_1009300 3300025728 Bacteria 6118
137 Ga0207655_1018288 3300025728 Bacteria 3728
138 Ga0207655_1018347 3300025728 Bacteria 3716
139 Ga0207655_1031644 3300025728 Bacteria 2433
140 Ga0207655_1055056 3300025728 Bacteria 1577
141 Ga0207713_1000138 3300025735 Bacteria 111150
142 Ga0207713_1000244 3300025735 Bacteria 69698
143 Ga0207713_1000604 3300025735 Bacteria 35350
144 Ga0207713_1000728 3300025735 Bacteria 30769
145 Ga0207713_1001356 3300025735 Bacteria 19952
146 Ga0207713_1005679 3300025735 Bacteria 7749
147 Ga0207713_1011342 3300025735 Bacteria 4857
148 Ga0207713_1019303 3300025735 Bacteria 3341
149 Ga0207713_1033555 3300025735 Bacteria 2241
150 Ga0207713_1042400 3300025735 Bacteria 1890
151 Ga0207671_10001052 3300025914 Bacteria 33499
152 Ga0207671_10337135 3300025914 Bacteria 1194
153 Ga0207649_10000004 3300025920 Bacteria 360726
154 Ga0207681_10000474 3300025923 Bacteria 28140
155 Ga0207650_10000183 3300025925 Bacteria 72930
156 Ga0207650_10000393 3300025925 Bacteria 39925
157 Ga0207706_10002563 3300025933 Bacteria 17721
158 Ga0207686_10002963 3300025934 Bacteria 9152
159 Ga0207709_10000827 3300025935 Bacteria 23857
160 Ga0207709_10002785 3300025935 Bacteria 10768
161 Ga0207709_10007744 3300025935 Bacteria 5955
162 Ga0207709_10026801 3300025935 Bacteria 3313
163 Ga0207711_10075591 3300025941 Bacteria 2932
164 Ga0207679_10000043 3300025945 Bacteria 123125
165 Ga0207639_10001525 3300026041 Bacteria 15560
166 Ga0209389_1000082 3300027296 Bacteria 89351
167 Ga0209389_1088974 3300027296 Bacteria 1329
168 Ga0209371_1002332 3300027312 Bacteria 10798
169 Ga0207428_10013408 3300027907 Bacteria 7161
170 Ga0268256_1002399 3300030500 Bacteria 9603
171 Ga0307408_100012772 3300031548 Bacteria 5568
172 Ga0307405_10000606 3300031731 Bacteria 13779
173 Ga0307412_10320973 3300031911 Bacteria 1232
174 Ga0307510_10144294 3300033180 Bacteria 2017
175 Ga0439438_001822 3300041405 Bacteria 9346
176 Ga0439438_002973 3300041405 Bacteria 7010
177 Ga0439438_021420 3300041405 Bacteria 1803
178 Ga0439447_007010 3300041407 Bacteria 3611
179 Ga0439447_019163 3300041407 Bacteria 1827
180 Ga0439466_0000907 3300041411 Bacteria 11278
181 Ga0439466_0001146 3300041411 Bacteria 10302
182 Ga0439431_0000561 3300041997 Bacteria 7882
183 Ga0439432_000157 3300042006 Bacteria 23222
184 Ga0439432_002114 3300042006 Bacteria 7490
185 Ga0439432_008900 3300042006 Bacteria 3508
186 Ga0439432_031210 3300042006 Bacteria 1724
187 Ga0439451_004573 3300042009 Bacteria 2815
188 Ga0439452_002394 3300042010 Bacteria 6951
189 Ga0439452_016436 3300042010 Bacteria 2010
190 Ga0439452_031110 3300042010 Bacteria 1311
191 Ga0439456_000018 3300042013 Bacteria 62369
192 Ga0439456_006901 3300042013 Bacteria 2324
193 Ga0439463_000258 3300042016 Bacteria 14542
194 Ga0439463_001422 3300042016 Bacteria 6354
195 Ga0439463_002096 3300042016 Bacteria 5160
196 Ga0450900_005270 3300042136 Bacteria 1521
197 Ga0450902_000670 3300042137 Bacteria 4366
198 Ga0450902_004725 3300042137 Bacteria 2033
199 Ga0450902_017270 3300042137 Bacteria 1178
200 Ga0450903_005889 3300042138 Bacteria 2046
201 Ga0450905_000235 3300042142 Bacteria 6398
202 Ga0450905_003415 3300042142 Bacteria 2087
203 Ga0450905_006953 3300042142 Bacteria 1535
204 Ga0450910_003292 3300042147 Bacteria 2144
205 Ga0450908_017691 3300042184 Bacteria 1264
206 Ga0450908_038060 3300042184 Bacteria 834
207 Ga0450909_003241 3300042185 Bacteria 2316
208 Ga0439464_0018643 3300042439 Bacteria 1889
209 Ga0439460_0019019 3300042461 Bacteria 1855
210 Ga0450901_000405 3300042533 Bacteria 5186
211 Ga0439440_0005229 3300042993 Bacteria 2572
212 Ga0495617_004541 3300046452 Bacteria 5030
213 Ga0495627_000021 3300046453 Bacteria 282454
214 Ga0495627_000064 3300046453 Bacteria 132648
215 Ga0495627_001424 3300046453 Bacteria 14069
216 Ga0495627_002927 3300046453 Bacteria 7845
217 Ga0495627_040630 3300046453 Bacteria 1431
218 Ga0495627_081682 3300046453 Bacteria 936
219 Ga0495590_0002234 3300046457 Bacteria 8092
220 Ga0495590_0007655 3300046457 Bacteria 4148
221 Ga0495590_0024873 3300046457 Bacteria 2108
222 Ga0495590_0171628 3300046457 Bacteria 791
223 Ga0495591_000085 3300046458 Bacteria 105096
224 Ga0495591_000675 3300046458 Bacteria 25029
225 Ga0495591_000775 3300046458 Bacteria 23014
226 Ga0495591_001575 3300046458 Bacteria 13869
227 Ga0495591_002044 3300046458 Bacteria 11706
228 Ga0495591_002143 3300046458 Bacteria 11314
229 Ga0495591_011276 3300046458 Bacteria 3396
230 Ga0495591_025184 3300046458 Bacteria 1870
231 Ga0495591_027711 3300046458 Bacteria 1743
232 Ga0495638_0000675 3300046460 Bacteria 37081
233 Ga0495638_0000678 3300046460 Bacteria 36996
234 Ga0495638_0022180 3300046460 Bacteria 4170
235 Ga0495638_0022948 3300046460 Bacteria 4089
236 Ga0495638_0092648 3300046460 Bacteria 1818
237 Ga0495653_0024413 3300046463 Bacteria 4872
238 Ga0495650_0001687 3300046471 Bacteria 20348
239 Ga0495650_0003322 3300046471 Bacteria 11854
240 Ga0495650_0009261 3300046471 Bacteria 5624
241 Ga0495650_0011729 3300046471 Bacteria 4770
242 Ga0495650_0014055 3300046471 Bacteria 4193
243 Ga0495650_0091802 3300046471 Bacteria 1154
244 Ga0495582_0062713 3300046473 Bacteria 2053
245 Ga0495605_0000014 3300046474 Bacteria 305393
246 Ga0495605_0000678 3300046474 Bacteria 25640
247 Ga0495605_0001107 3300046474 Bacteria 17963
248 Ga0495605_0001698 3300046474 Bacteria 14136
249 Ga0495605_0009223 3300046474 Bacteria 5545
250 Ga0495605_0029161 3300046474 Bacteria 2843
251 Ga0495605_0029471 3300046474 Bacteria 2823
252 Ga0495605_0038104 3300046474 Bacteria 2414
253 Ga0495605_0041983 3300046474 Bacteria 2276
254 Ga0495605_0052726 3300046474 Bacteria 1975
255 Ga0495639_0067777 3300046475 Bacteria 1644
256 Ga0495584_0004354 3300046491 Bacteria 7622
257 Ga0495584_0009959 3300046491 Bacteria 4882
258 Ga0495584_0016905 3300046491 Bacteria 3718
259 Ga0495585_0002507 3300046492 Bacteria 13063
260 Ga0495585_0031053 3300046492 Bacteria 3036
261 Ga0495585_0043036 3300046492 Bacteria 2527
262 Ga0495585_0055246 3300046492 Bacteria 2194
263 Ga0495594_0076195 3300046499 Bacteria 1870
264 Ga0495596_0036003 3300046500 Bacteria 1961
265 Ga0495596_0093306 3300046500 Bacteria 1169
266 Ga0495607_0000533 3300046501 Bacteria 37381
267 Ga0495607_0000913 3300046501 Bacteria 27527
268 Ga0495607_0001218 3300046501 Bacteria 23124
269 Ga0495607_0002484 3300046501 Bacteria 14951
270 Ga0495607_0002741 3300046501 Bacteria 14046
271 Ga0495607_0010820 3300046501 Bacteria 6104
272 Ga0495607_0011228 3300046501 Bacteria 5975
273 Ga0495607_0017427 3300046501 Bacteria 4610
274 Ga0495607_0027689 3300046501 Bacteria 3501
275 Ga0495607_0043718 3300046501 Bacteria 2647
276 Ga0495607_0057290 3300046501 Bacteria 2233
277 Ga0495607_0094169 3300046501 Bacteria 1616
278 Ga0495607_0148645 3300046501 Bacteria 1201
279 Ga0495607_0227206 3300046501 Bacteria 909
280 Ga0495583_0000066 3300046506 Bacteria 191372
281 Ga0495583_0000168 3300046506 Bacteria 111781
282 Ga0495583_0001270 3300046506 Bacteria 26433
283 Ga0495583_0001467 3300046506 Bacteria 23652
284 Ga0495583_0001499 3300046506 Bacteria 23250
285 Ga0495583_0002420 3300046506 Bacteria 16014
286 Ga0495606_0000482 3300046507 Bacteria 65236
287 Ga0495606_0001118 3300046507 Bacteria 38331
288 Ga0495606_0024761 3300046507 Bacteria 4316
289 Ga0495606_0185005 3300046507 Bacteria 1198
290 Ga0495610_0002330 3300046512 Bacteria 16053
291 Ga0495610_0005737 3300046512 Bacteria 8745
292 Ga0495610_0015161 3300046512 Bacteria 4491
293 Ga0495610_0016545 3300046512 Bacteria 4239
294 Ga0495610_0020028 3300046512 Bacteria 3725
295 Ga0495610_0021408 3300046512 Bacteria 3557
296 Ga0495610_0073176 3300046512 Bacteria 1593
297 Ga0495616_0005088 3300046513 Bacteria 8175
298 Ga0495616_0015760 3300046513 Bacteria 4195
299 Ga0495616_0019325 3300046513 Bacteria 3718
300 Ga0495616_0064849 3300046513 Bacteria 1781
301 Ga0495620_0000027 3300046515 Bacteria 123465
302 Ga0495620_0000048 3300046515 Bacteria 106392
303 Ga0495620_0000935 3300046515 Bacteria 17974
304 Ga0495620_0005363 3300046515 Bacteria 7165
305 Ga0495620_0042982 3300046515 Bacteria 1970
306 Ga0495620_0066980 3300046515 Bacteria 1478
307 Ga0495628_0114688 3300046516 Bacteria 2070
308 Ga0495630_0038210 3300046517 Bacteria 3591
309 Ga0495631_0000628 3300046518 Bacteria 23207
310 Ga0495631_0003784 3300046518 Bacteria 8232
311 Ga0495631_0008161 3300046518 Bacteria 5285
312 Ga0495631_0010772 3300046518 Bacteria 4519
313 Ga0495631_0136476 3300046518 Bacteria 1053
314 Ga0495632_0000299 3300046519 Bacteria 47952
315 Ga0495632_0001675 3300046519 Bacteria 18148
316 Ga0495632_0003846 3300046519 Bacteria 10445
317 Ga0495632_0005143 3300046519 Bacteria 8732
318 Ga0495632_0006735 3300046519 Bacteria 7345
319 Ga0495632_0009564 3300046519 Bacteria 5831
320 Ga0495632_0015552 3300046519 Bacteria 4260
321 Ga0495632_0021247 3300046519 Bacteria 3500
322 Ga0495632_0033368 3300046519 Bacteria 2643
323 Ga0495632_0034845 3300046519 Bacteria 2573
324 Ga0495632_0069004 3300046519 Bacteria 1702
325 Ga0495637_0000609 3300046520 Bacteria 25502
326 Ga0495637_0000765 3300046520 Bacteria 21683
327 Ga0495637_0010628 3300046520 Bacteria 4445
328 Ga0495637_0012821 3300046520 Bacteria 3999
329 Ga0495637_0053112 3300046520 Bacteria 1688
330 Ga0495643_0000457 3300046522 Bacteria 51945
331 Ga0495643_0001019 3300046522 Bacteria 28587
332 Ga0495643_0012325 3300046522 Bacteria 5163
333 Ga0495643_0019641 3300046522 Bacteria 3906
334 Ga0495643_0047259 3300046522 Bacteria 2331
335 Ga0495643_0052575 3300046522 Bacteria 2186
336 Ga0495644_0000328 3300046523 Bacteria 21687
337 Ga0495644_0000955 3300046523 Bacteria 11951
338 Ga0495644_0152606 3300046523 Bacteria 884
339 Ga0495648_0000393 3300046524 Bacteria 47938
340 Ga0495648_0002990 3300046524 Bacteria 15166
341 Ga0495648_0002998 3300046524 Bacteria 15136
342 Ga0495648_0005368 3300046524 Bacteria 10666
343 Ga0495648_0042013 3300046524 Bacteria 2880
344 Ga0495648_0131632 3300046524 Bacteria 1329
345 Ga0495642_0002058 3300046528 Bacteria 8362
346 Ga0495654_0000534 3300046530 Bacteria 30682
347 Ga0495654_0000761 3300046530 Bacteria 24924
348 Ga0495654_0002174 3300046530 Bacteria 12751
349 Ga0495654_0002337 3300046530 Bacteria 12246
350 Ga0495654_0004633 3300046530 Bacteria 8114
351 Ga0495654_0005574 3300046530 Bacteria 7288
352 Ga0495654_0017603 3300046530 Bacteria 3752
353 Ga0495654_0030699 3300046530 Bacteria 2733
354 Ga0495654_0031125 3300046530 Bacteria 2709
355 Ga0495654_0039365 3300046530 Bacteria 2361
356 Ga0495654_0131228 3300046530 Bacteria 1124
357 Ga0495586_0001717 3300046535 Bacteria 11964
358 Ga0495587_0003152 3300046536 Bacteria 11022
359 Ga0495609_0000006 3300046538 Bacteria 431833
360 Ga0495609_0000024 3300046538 Bacteria 264100
361 Ga0495609_0000099 3300046538 Bacteria 101070
362 Ga0495597_0000005 3300046542 Bacteria 286580
363 Ga0495597_0001399 3300046542 Bacteria 17432
364 Ga0495597_0016624 3300046542 Bacteria 3472
365 Ga0495597_0026126 3300046542 Bacteria 2683
366 Ga0495597_0144108 3300046542 Bacteria 981
367 Ga0495645_0100312 3300046543 Bacteria 2059
368 Ga0495622_0012465 3300046557 Bacteria 3936
369 Ga0495622_0012621 3300046557 Bacteria 3914
370 Ga0495633_0000030 3300046558 Bacteria 197184
371 Ga0495633_0061059 3300046558 Bacteria 1765
372 Ga0495656_0093930 3300046615 Bacteria 1376
373 Ga0495668_0007494 3300046616 Bacteria 6968
374 Ga0495668_0041202 3300046616 Bacteria 2573
375 Ga0495611_0000524 3300046648 Bacteria 22786
376 Ga0495611_0003621 3300046648 Bacteria 6768
377 Ga0495611_0004277 3300046648 Bacteria 6207
378 Ga0495611_0017751 3300046648 Bacteria 3047
379 Ga0495611_0028318 3300046648 Bacteria 2452
380 Ga0495611_0137483 3300046648 Bacteria 1141
381 Ga0495625_0000050 3300046660 Bacteria 197065
382 Ga0495625_0130901 3300046660 Bacteria 1699
383 Ga0495635_0003890 3300046663 Bacteria 10377
384 Ga0495659_0009040 3300046664 Bacteria 3175
385 Ga0495659_0072384 3300046664 Bacteria 1293
386 Ga0495661_0000015 3300046665 Bacteria 223740
387 Ga0495661_0000216 3300046665 Bacteria 66437
388 Ga0495661_0000331 3300046665 Bacteria 51388
389 Ga0495661_0002477 3300046665 Bacteria 14198
390 Ga0495661_0006019 3300046665 Bacteria 8556
391 Ga0495661_0006600 3300046665 Bacteria 8150
392 Ga0495661_0006867 3300046665 Bacteria 7963
393 Ga0495661_0074005 3300046665 Bacteria 1983
394 Ga0495646_0005403 3300046680 Bacteria 8068
395 Ga0495613_0006853 3300046689 Bacteria 8506
396 Ga0495670_0004917 3300046691 Bacteria 6565
397 Ga0495670_0018082 3300046691 Bacteria 3472
398 Ga0495671_0001516 3300046692 Bacteria 15522
399 Ga0495671_0001670 3300046692 Bacteria 14516
400 Ga0495671_0004153 3300046692 Bacteria 8725
401 Ga0495671_0009596 3300046692 Bacteria 5402
402 Ga0495671_0046510 3300046692 Bacteria 2169
403 Ga0495671_0101559 3300046692 Bacteria 1406
404 Ga0495649_0002863 3300046694 Bacteria 11961
405 Ga0495649_0060942 3300046694 Bacteria 2029
406 Ga0495589_0000639 3300046794 Bacteria 22912
407 Ga0495589_0006973 3300046794 Bacteria 5927
408 Ga0495660_0000853 3300046810 Bacteria 22502
409 Ga0495660_0006329 3300046810 Bacteria 7018
410 Ga0495660_0006636 3300046810 Bacteria 6840
411 Ga0495660_0007640 3300046810 Bacteria 6350
412 Ga0495660_0011667 3300046810 Bacteria 5097
413 Ga0495660_0072202 3300046810 Bacteria 1828
414 Ga0495581_0080508 3300047315 Bacteria 1885
415 Ga0495672_0001802 3300047320 Bacteria 20541
416 Ga0495672_0002307 3300047320 Bacteria 17695
417 Ga0495672_0002703 3300047320 Bacteria 15918
418 Ga0495672_0008170 3300047320 Bacteria 7763
419 Ga0495672_0009355 3300047320 Bacteria 7109
420 Ga0495672_0050102 3300047320 Bacteria 2468
421 Ga0495672_0054357 3300047320 Bacteria 2341
422 Ga0495676_0000024 3300047321 Bacteria 150285
423 Ga0495680_0003833 3300047322 Bacteria 14595
424 Ga0495683_0000056 3300047323 Bacteria 118944
425 Ga0495683_0003308 3300047323 Bacteria 9420
426 Ga0495683_0004611 3300047323 Bacteria 7777
427 Ga0495675_0161279 3300047444 Bacteria 1380
428 Ga0495679_000098 3300047446 Bacteria 79186
429 Ga0495679_000121 3300047446 Bacteria 68858
430 Ga0495679_005919 3300047446 Bacteria 5358
431 Ga0495685_011297 3300047447 Bacteria 3009
432 Ga0495673_0000502 3300047469 Bacteria 41495
433 Ga0495673_0000955 3300047469 Bacteria 26127
434 Ga0495673_0001415 3300047469 Bacteria 19224
435 Ga0495673_0001643 3300047469 Bacteria 17271
436 Ga0495673_0001791 3300047469 Bacteria 16290
437 Ga0495673_0002363 3300047469 Bacteria 13392
438 Ga0495673_0002557 3300047469 Bacteria 12657
439 Ga0495673_0004411 3300047469 Bacteria 8809
440 Ga0495673_0006561 3300047469 Bacteria 6822
441 Ga0495673_0013518 3300047469 Bacteria 4283
442 Ga0495673_0016277 3300047469 Bacteria 3805
443 Ga0495673_0018376 3300047469 Bacteria 3526
444 Ga0495673_0030610 3300047469 Bacteria 2526
445 Ga0495673_0041893 3300047469 Bacteria 2058
446 Ga0495681_0001030 3300047470 Bacteria 21299
447 Ga0495681_0001448 3300047470 Bacteria 17788
448 Ga0495681_0003240 3300047470 Bacteria 11355
449 Ga0495681_0017049 3300047470 Bacteria 4046
450 Ga0495681_0017346 3300047470 Bacteria 4000
451 Ga0495681_0039157 3300047470 Bacteria 2317
452 Ga0495681_0069600 3300047470 Bacteria 1598
453 Ga0495681_0157342 3300047470 Bacteria 948
454 Ga0495686_0019548 3300047472 Bacteria 4526
455 Ga0495686_0031174 3300047472 Bacteria 3459
456 Ga0495686_0060433 3300047472 Bacteria 2355
457 Ga0495626_0000061 3300048091 Bacteria 144886
458 Ga0495626_0057757 3300048091 Bacteria 1775
459 Ga0496110_0069899 3300048913 Bacteria 3110
460 Ga0496110_0118871 3300048913 Bacteria 2380
461 Ga0496110_0193200 3300048913 Bacteria 1848
462 Ga0496112_0213182 3300048915 Bacteria 1888
463 Ga0496114_0063799 3300048917 Bacteria 3084
464 Ga0496116_0000853 3300048919 Bacteria 38103
465 Ga0496117_0000721 3300048920 Bacteria 52172
466 Ga0496117_0001350 3300048920 Bacteria 35953
467 Ga0496117_0001489 3300048920 Bacteria 33561
468 Ga0496117_0003411 3300048920 Bacteria 18497
469 Ga0496117_0005313 3300048920 Bacteria 13613
470 Ga0496117_0009707 3300048920 Bacteria 8894
471 Ga0496117_0022883 3300048920 Bacteria 5004
472 Ga0496117_0087316 3300048920 Bacteria 2022
473 Ga0496118_0000982 3300048921 Bacteria 44419
474 Ga0496118_0006273 3300048921 Bacteria 13144
475 Ga0496118_0015041 3300048921 Bacteria 7194
476 Ga0496118_0081807 3300048921 Bacteria 2265
477 Ga0496118_0094678 3300048921 Bacteria 2041
478 Ga0496119_0000136 3300048922 Bacteria 103518
479 Ga0496119_0017184 3300048922 Bacteria 5457
480 Ga0496120_0008617 3300048923 Bacteria 7367
481 Ga0496120_0013023 3300048923 Bacteria 5624
482 Ga0496121_0002405 3300048924 Bacteria 28678
483 Ga0496121_0003645 3300048924 Bacteria 21666
484 Ga0496121_0003680 3300048924 Bacteria 21530
485 Ga0496121_0030451 3300048924 Bacteria 4956
486 Ga0496121_0397039 3300048924 Bacteria 904
487 Ga0496121_0408984 3300048924 Bacteria 886
488 Ga0496122_0001459 3300048925 Bacteria 38119
489 Ga0496122_0003280 3300048925 Bacteria 21447
490 Ga0496122_0019364 3300048925 Bacteria 6221
491 Ga0496122_0030352 3300048925 Bacteria 4530
492 Ga0496122_0062902 3300048925 Bacteria 2713
493 Ga0496122_0072674 3300048925 Bacteria 2444
494 Ga0496122_0079818 3300048925 Bacteria 2284
495 Ga0496122_0126775 3300048925 Bacteria 1632
496 Ga0496123_0000080 3300048926 Bacteria 190247
497 Ga0496123_0001420 3300048926 Bacteria 33487
498 Ga0496123_0006662 3300048926 Bacteria 11131
499 Ga0496123_0013234 3300048926 Bacteria 6951
500 Ga0496123_0063105 3300048926 Bacteria 2369
501 Ga0496123_0098585 3300048926 Bacteria 1708
502 Ga0496123_0115702 3300048926 Bacteria 1521
503 Ga0496123_0123599 3300048926 Bacteria 1449
504 Ga0496124_0002582 3300048927 Bacteria 23446
505 Ga0496124_0004287 3300048927 Bacteria 16753
506 Ga0496124_0004525 3300048927 Bacteria 16189
507 Ga0496124_0005300 3300048927 Bacteria 14571
508 Ga0496124_0006955 3300048927 Bacteria 12152
509 Ga0496124_0014213 3300048927 Bacteria 7712
510 Ga0496124_0019098 3300048927 Bacteria 6396
511 Ga0496124_0034475 3300048927 Bacteria 4441
512 Ga0496124_0037420 3300048927 Bacteria 4220
513 Ga0496124_0056816 3300048927 Bacteria 3299
514 Ga0496124_0083485 3300048927 Bacteria 2620
515 Ga0496124_0143980 3300048927 Bacteria 1877
516 Ga0496124_0216884 3300048927 Bacteria 1442
517 Ga0496125_0001348 3300048928 Bacteria 36222
518 Ga0496125_0006089 3300048928 Bacteria 13165
519 Ga0496125_0007993 3300048928 Bacteria 11172
520 Ga0496125_0023573 3300048928 Bacteria 5678
521 Ga0496125_0030617 3300048928 Bacteria 4810
522 Ga0496125_0034111 3300048928 Bacteria 4490
523 Ga0496125_0050925 3300048928 Bacteria 3422
524 Ga0496125_0064604 3300048928 Bacteria 2906
525 Ga0496126_0027874 3300048929 Bacteria 5388
526 Ga0496126_0143343 3300048929 Bacteria 2054
527 Ga0496126_0604408 3300048929 Bacteria 864
528 Ga0495678_000063 3300049459 Bacteria 140183
529 Ga0495678_001515 3300049459 Bacteria 18021
530 Ga0495678_002112 3300049459 Bacteria 14106
531 Ga0495678_003459 3300049459 Bacteria 9784
532 Ga0495678_005544 3300049459 Bacteria 6934
533 Ga0495678_014394 3300049459 Bacteria 3680
534 Ga0495682_0000098 3300049460 Bacteria 77089
535 Ga0495682_0000504 3300049460 Bacteria 27008
536 Ga0495682_0010362 3300049460 Bacteria 3612
537 Ga0501034_0000586 3300049571 Bacteria 57516
538 nmdc:mga08x19_690453_c1 3300050514 Bacteria 724
539 nmdc:mga08x19_87176_c1 3300050514 Bacteria 2056
540 Ga0500618_031596 3300053125 Bacteria 1241
541 Ga0500659_0004666 3300053135 Bacteria 7780
542 Ga0500573_0020257 3300053140 Bacteria 3809
543 Ga0500577_0063996 3300053142 Bacteria 1423
544 Ga0500634_0004112 3300053161 Bacteria 6656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046500 Ga0495596_0093306 Ga0495596_0093306_514_1137 207
2 iso_pu_bacteria 2599185305 2599960954 211
3 iso_pu_bacteria 2599185316 2600024284 211
4 iso_pu_bacteria 2599185317 2600027909 211
5 iso_pu_bacteria 2599185325 2600078744 211
6 iso_pu_bacteria 2600254930 2600357076 211
7 iso_pu_bacteria 2667528176 2671125689 211
8 iso_pu_bacteria 2919481497 2919482685 211
9 3300003791 Ga0055530_10004127 Ga0055530_100041273 215
10 3300003792 Ga0055540_1003397 Ga0055540_10033973 215
11 3300025298 Ga0209050_1000027 Ga0209050_1000027325 215
12 3300025303 Ga0209051_1000102 Ga0209051_100010239 215
13 3300025304 Ga0209257_1013653 Ga0209257_10136532 215
14 3300041405 Ga0439438_021420 Ga0439438_021420_477_1145 215
15 3300042006 Ga0439432_031210 Ga0439432_031210_411_1079 215
16 3300042137 Ga0450902_000670 Ga0450902_000670_2960_3628 215
17 3300042138 Ga0450903_005889 Ga0450903_005889_461_1129 215
18 3300042184 Ga0450908_038060 Ga0450908_038060_138_806 215
19 3300046452 Ga0495617_004541 Ga0495617_004541_3270_3938 215
20 3300046453 Ga0495627_002927 Ga0495627_002927_4871_5539 215
21 3300046457 Ga0495590_0002234 Ga0495590_0002234_5257_5925 215
22 3300046457 Ga0495590_0024873 Ga0495590_0024873_375_1043 215
23 3300046458 Ga0495591_027711 Ga0495591_027711_751_1419 215
24 3300046460 Ga0495638_0022948 Ga0495638_0022948_1837_2505 215
25 3300046460 Ga0495638_0092648 Ga0495638_0092648_488_1156 215
26 3300046471 Ga0495650_0091802 Ga0495650_0091802_333_1001 215
27 3300046474 Ga0495605_0029471 Ga0495605_0029471_1803_2471 215
28 3300046492 Ga0495585_0031053 Ga0495585_0031053_1115_1783 215
29 3300046501 Ga0495607_0027689 Ga0495607_0027689_651_1319 215
30 3300046512 Ga0495610_0073176 Ga0495610_0073176_449_1117 215
31 3300046515 Ga0495620_0066980 Ga0495620_0066980_159_827 215
32 3300046519 Ga0495632_0005143 Ga0495632_0005143_3381_4049 215
33 3300046519 Ga0495632_0069004 Ga0495632_0069004_471_1139 215
34 3300046522 Ga0495643_0052575 Ga0495643_0052575_809_1477 215
35 3300046524 Ga0495648_0042013 Ga0495648_0042013_1163_1831 215
36 3300046524 Ga0495648_0131632 Ga0495648_0131632_413_1081 215
37 3300046530 Ga0495654_0002174 Ga0495654_0002174_7983_8651 215
38 3300046530 Ga0495654_0031125 Ga0495654_0031125_755_1423 215
39 3300046615 Ga0495656_0093930 Ga0495656_0093930_36_704 215
40 3300046648 Ga0495611_0028318 Ga0495611_0028318_142_810 215
41 3300046648 Ga0495611_0137483 Ga0495611_0137483_282_950 215
42 3300046660 Ga0495625_0130901 Ga0495625_0130901_50_718 215
43 3300046665 Ga0495661_0074005 Ga0495661_0074005_588_1256 215
44 3300046691 Ga0495670_0004917 Ga0495670_0004917_3873_4541 215
45 3300046692 Ga0495671_0009596 Ga0495671_0009596_2300_2968 215
46 3300046694 Ga0495649_0002863 Ga0495649_0002863_5422_6090 215
47 3300046694 Ga0495649_0060942 Ga0495649_0060942_600_1268 215
48 3300046810 Ga0495660_0006329 Ga0495660_0006329_2560_3228 215
49 3300046810 Ga0495660_0072202 Ga0495660_0072202_759_1427 215
50 3300047320 Ga0495672_0054357 Ga0495672_0054357_1012_1680 215
51 3300047323 Ga0495683_0003308 Ga0495683_0003308_5166_5834 215
52 3300047469 Ga0495673_0001791 Ga0495673_0001791_11125_11793 215
53 3300047470 Ga0495681_0001030 Ga0495681_0001030_9247_9915 215
54 3300047470 Ga0495681_0017049 Ga0495681_0017049_2608_3276 215
55 3300047472 Ga0495686_0019548 Ga0495686_0019548_847_1515 215
56 3300048091 Ga0495626_0057757 Ga0495626_0057757_474_1142 215
57 3300049459 Ga0495678_003459 Ga0495678_003459_8366_9034 215
58 3300050514 nmdc:mga08x19_87176_c1 nmdc:mga08x19_87176_c1_755_1423 215
59 3300048924 Ga0496121_0408984 Ga0496121_0408984_53_739 220
60 3300048927 Ga0496124_0056816 Ga0496124_0056816_28_714 220
61 3300048925 Ga0496122_0072674 Ga0496122_0072674_957_1625 222
62 3300048926 Ga0496123_0115702 Ga0496123_0115702_574_1242 222
63 3300047470 Ga0495681_0157342 Ga0495681_0157342_17_706 223
64 3300046501 Ga0495607_0094169 Ga0495607_0094169_907_1602 224
65 3300048927 Ga0496124_0014213 Ga0496124_0014213_5916_6590 224
66 3300050514 nmdc:mga08x19_690453_c1 nmdc:mga08x19_690453_c1_12_686 224
67 3300048928 Ga0496125_0050925 Ga0496125_0050925_378_1091 227
68 3300046501 Ga0495607_0148645 Ga0495607_0148645_43_750 228
69 3300048913 Ga0496110_0069899 Ga0496110_0069899_855_1607 232
70 3300003751 Ga0055538_1000036 Ga0055538_100003610 234
71 3300003752 Ga0055539_1000047 Ga0055539_100004710 234
72 3300003756 Ga0055533_1000058 Ga0055533_100005810 234
73 3300003758 Ga0055532_1000234 Ga0055532_100023426 234
74 3300003759 Ga0055525_1000113 Ga0055525_100011310 234
75 3300003841 Ga0055541_1000034 Ga0055541_1000034167 234
76 3300025206 Ga0209435_100990 Ga0209435_1009903 234
77 3300025224 Ga0209784_100050 Ga0209784_10005011 234
78 3300025225 Ga0209566_100063 Ga0209566_10006311 234
79 3300025226 Ga0209674_100084 Ga0209674_10008411 234
80 3300025229 Ga0209147_100083 Ga0209147_10008311 234
81 3300025230 Ga0209563_100084 Ga0209563_10008411 234
82 3300025233 Ga0209437_105507 Ga0209437_1055072 234
83 3300025242 Ga0209258_100113 Ga0209258_10011311 234
84 3300025246 Ga0209646_1000463 Ga0209646_100046311 234
85 3300025253 Ga0209677_100047 Ga0209677_10004711 234
86 3300025256 Ga0209759_1034646 Ga0209759_10346461 234
87 iso_pu_bacteria 2597489888 2597862220 237
88 iso_pu_bacteria 2599185167 2599397178 237
89 iso_pu_bacteria 2599185179 2599449173 237
90 iso_pu_bacteria 2599185190 2599511085 237
91 iso_pu_bacteria 2599185191 2599519423 237
92 iso_pu_bacteria 2599185257 2599803412 237
93 iso_pu_bacteria 2599185288 2599879551 237
94 iso_pu_bacteria 2599185290 2599890459 237
95 iso_pu_bacteria 2599185303 2599948050 237
96 iso_pu_bacteria 2600255283 2601626260 237
97 iso_pu_bacteria 2600255296 2601690814 237
98 iso_pu_bacteria 2643221571 2643868999 237
99 iso_pu_bacteria 2643221713 2644623903 237
100 iso_pu_bacteria 2671180172 2671771020 237
101 iso_pu_bacteria 2721755607 2723247112 237
102 iso_pu_bacteria 2738541294 2738809009 237
103 iso_pu_bacteria 2738541309 2738896369 237
104 iso_pu_bacteria 2808606385 2808975147 237
105 iso_pu_bacteria 2808606388 2808991214 237
106 iso_pu_bacteria 2834028612 2834028906 237
107 iso_pu_bacteria 2842826826 2842829993 237
108 iso_pu_bacteria 2842837860 2842839028 237
109 iso_pu_bacteria 2852612431 2852615602 237
110 iso_pu_bacteria 2852667396 2852670570 237
111 iso_pu_bacteria 2860867994 2860868941 237
112 iso_pu_bacteria 2908446538 2908447691 237
113 iso_pu_bacteria 2931390751 2931391922 237
114 iso_pu_bacteria 2945928738 2945929646 237
115 iso_pu_bacteria 2945961074 2945965899 237
116 iso_pu_bacteria 2946006987 2946011931 237
117 iso_pu_bacteria 2946027586 2946029180 237
118 iso_pu_bacteria 2947233263 2947235727 237
119 iso_pu_bacteria 8054285046 8054290132 237
120 iso_pu_bacteria 8054503363 8054504518 237
121 iso_pu_bacteria 8055817908 8055818951 237
122 iso_pu_bacteria 8056148874 8056149037 237
123 iso_pu_bacteria 2511231006 2511263717 238
124 iso_pu_bacteria 2511231156 2511826835 238
125 iso_pu_bacteria 2512047018 2512324354 238
126 iso_pu_bacteria 2554235341 2555671964 238
127 iso_pu_bacteria 2582580891 2583794460 238
128 iso_pu_bacteria 2597489887 2597860045 238
129 iso_pu_bacteria 2599185155 2599328240 238
130 iso_pu_bacteria 2599185160 2599353872 238
131 iso_pu_bacteria 2599185161 2599360450 238
132 iso_pu_bacteria 2599185162 2599366772 238
133 iso_pu_bacteria 2599185163 2599373561 238
134 iso_pu_bacteria 2599185164 2599378980 238
135 iso_pu_bacteria 2599185165 2599386042 238
136 iso_pu_bacteria 2599185166 2599392420 238
137 iso_pu_bacteria 2599185168 2599404186 238
138 iso_pu_bacteria 2599185181 2599460706 238
139 iso_pu_bacteria 2599185182 2599470252 238
140 iso_pu_bacteria 2599185186 2599489727 238
141 iso_pu_bacteria 2599185307 2599974452 238
142 iso_pu_bacteria 2599185318 2600033392 238
143 iso_pu_bacteria 2599185322 2600060830 238
144 iso_pu_bacteria 2599185356 2600213320 238
145 iso_pu_bacteria 2600254931 2600365320 238
146 iso_pu_bacteria 2600255313 2601773487 238
147 iso_pu_bacteria 2667528171 2671096451 238
148 iso_pu_bacteria 2706794495 2707101435 238
149 iso_pu_bacteria 2740892503 2743739579 238
150 iso_pu_bacteria 2818991464 2819701544 238
151 iso_pu_bacteria 2825651385 2825655898 238
152 iso_pu_bacteria 2826581358 2826584050 238
153 iso_pu_bacteria 2842815866 2842819528 238
154 iso_pu_bacteria 2842849001 2842849771 238
155 iso_pu_bacteria 2844665904 2844666129 238
156 iso_pu_bacteria 2854601825 2854606173 238
157 iso_pu_bacteria 2913036834 2913037807 238
158 iso_pu_bacteria 2917070673 2917075836 238
159 iso_pu_bacteria 2923153595 2923158665 238
160 iso_pu_bacteria 2929144301 2929149133 238
161 iso_pu_bacteria 2931369376 2931373456 238
162 iso_pu_bacteria 2935353572 2935356822 238
163 iso_pu_bacteria 2984286254 2984287505 238
164 iso_pu_bacteria 3007395558 3007398295 238
165 iso_pu_bacteria 3007419365 3007420591 238
166 iso_pu_bacteria 637000220 637322380 238
167 iso_pu_bacteria 8015687852 8015692751 238
168 iso_pu_bacteria 8019769354 8019771747 238
169 iso_pu_bacteria 8055770955 8055775985 238
170 iso_pu_bacteria 8057798959 8057804868 238
171 3300046506 Ga0495583_0001467 Ga0495583_0001467_7057_7806 239
172 3300046512 Ga0495610_0005737 Ga0495610_0005737_6923_7672 239
173 2162886007 SwRhRL2b_contig_451913 SwRhRL2b_0707.00019340 240
174 3300005288 Ga0065714_10065847 Ga0065714_100658475 240
175 3300005331 Ga0070670_100002191 Ga0070670_10000219115 240
176 3300005344 Ga0070661_100001513 Ga0070661_1000015134 240
177 3300005353 Ga0070669_100000570 Ga0070669_10000057012 240
178 3300005457 Ga0070662_100000950 Ga0070662_1000009504 240
179 3300005539 Ga0068853_100001285 Ga0068853_10000128513 240
180 3300005548 Ga0070665_100030810 Ga0070665_1000308105 240
181 3300005564 Ga0070664_100002049 Ga0070664_10000204910 240
182 3300005578 Ga0068854_100033903 Ga0068854_1000339034 240
183 3300005834 Ga0068851_10000006 Ga0068851_10000006207 240
184 3300009011 Ga0105251_10000702 Ga0105251_1000070211 240
185 3300009011 Ga0105251_10004637 Ga0105251_100046375 240
186 3300009036 Ga0105244_10001491 Ga0105244_100014915 240
187 3300009036 Ga0105244_10003141 Ga0105244_100031418 240
188 3300009092 Ga0105250_10000216 Ga0105250_1000021610 240
189 3300009092 Ga0105250_10014872 Ga0105250_100148723 240
190 3300009176 Ga0105242_10003570 Ga0105242_100035705 240
191 3300009177 Ga0105248_10036588 Ga0105248_100365884 240
192 3300009545 Ga0105237_10001380 Ga0105237_100013807 240
193 3300009545 Ga0105237_10371849 Ga0105237_103718492 240
194 3300011119 Ga0105246_10000391 Ga0105246_1000039110 240
195 3300013100 Ga0157373_10003948 Ga0157373_100039486 240
196 3300013100 Ga0157373_10009036 Ga0157373_100090365 240
197 3300013100 Ga0157373_10029552 Ga0157373_100295524 240
198 3300013100 Ga0157373_10039586 Ga0157373_100395863 240
199 3300013104 Ga0157370_10064655 Ga0157370_100646554 240
200 3300013105 Ga0157369_10003869 Ga0157369_100038697 240
201 3300013105 Ga0157369_10008334 Ga0157369_100083345 240
202 3300013105 Ga0157369_10010281 Ga0157369_100102813 240
203 3300013306 Ga0163162_10224732 Ga0163162_102247322 240
204 3300013308 Ga0157375_10001660 Ga0157375_100016605 240
205 3300013308 Ga0157375_10015584 Ga0157375_100155844 240
206 3300014497 Ga0182008_10004237 Ga0182008_100042376 240
207 3300014497 Ga0182008_10004590 Ga0182008_100045903 240
208 3300015261 Ga0182006_1000460 Ga0182006_100046012 240
209 3300015262 Ga0182007_10006306 Ga0182007_100063063 240
210 3300017792 Ga0163161_10017002 Ga0163161_100170024 240
211 3300017792 Ga0163161_10024982 Ga0163161_100249823 240
212 3300025321 Ga0207656_10000023 Ga0207656_1000002317 240
213 3300025711 Ga0207696_1000210 Ga0207696_100021025 240
214 3300025711 Ga0207696_1032526 Ga0207696_10325263 240
215 3300025728 Ga0207655_1000311 Ga0207655_100031162 240
216 3300025728 Ga0207655_1002514 Ga0207655_10025149 240
217 3300025735 Ga0207713_1000244 Ga0207713_100024421 240
218 3300025735 Ga0207713_1000728 Ga0207713_100072818 240
219 3300025735 Ga0207713_1005679 Ga0207713_10056796 240
220 3300025914 Ga0207671_10001052 Ga0207671_100010527 240
221 3300025914 Ga0207671_10337135 Ga0207671_103371351 240
222 3300025920 Ga0207649_10000004 Ga0207649_10000004125 240
223 3300025923 Ga0207681_10000474 Ga0207681_1000047417 240
224 3300025925 Ga0207650_10000183 Ga0207650_100001839 240
225 3300025925 Ga0207650_10000393 Ga0207650_1000039326 240
226 3300025933 Ga0207706_10002563 Ga0207706_100025634 240
227 3300025934 Ga0207686_10002963 Ga0207686_100029634 240
228 3300025941 Ga0207711_10075591 Ga0207711_100755912 240
229 3300025945 Ga0207679_10000043 Ga0207679_10000043118 240
230 3300026041 Ga0207639_10001525 Ga0207639_100015258 240
231 3300031731 Ga0307405_10000606 Ga0307405_100006065 240
232 3300031911 Ga0307412_10320973 Ga0307412_103209732 240
233 3300042006 Ga0439432_000157 Ga0439432_000157_11414_12157 240
234 3300042993 Ga0439440_0005229 Ga0439440_0005229_574_1320 240
235 3300046453 Ga0495627_001424 Ga0495627_001424_5584_6327 240
236 3300046458 Ga0495591_001575 Ga0495591_001575_5355_6098 240
237 3300046501 Ga0495607_0000533 Ga0495607_0000533_30442_31215 240
238 3300046501 Ga0495607_0001218 Ga0495607_0001218_20484_21233 240
239 3300046501 Ga0495607_0011228 Ga0495607_0011228_179_922 240
240 3300046501 Ga0495607_0227206 Ga0495607_0227206_122_865 240
241 3300046507 Ga0495606_0024761 Ga0495606_0024761_2511_3254 240
242 3300046512 Ga0495610_0015161 Ga0495610_0015161_1314_2057 240
243 3300046512 Ga0495610_0016545 Ga0495610_0016545_580_1323 240
244 3300046512 Ga0495610_0021408 Ga0495610_0021408_1904_2647 240
245 3300046515 Ga0495620_0042982 Ga0495620_0042982_1093_1836 240
246 3300046518 Ga0495631_0010772 Ga0495631_0010772_925_1668 240
247 3300046519 Ga0495632_0006735 Ga0495632_0006735_1002_1745 240
248 3300046522 Ga0495643_0019641 Ga0495643_0019641_994_1737 240
249 3300046530 Ga0495654_0017603 Ga0495654_0017603_1944_2687 240
250 3300046530 Ga0495654_0030699 Ga0495654_0030699_582_1325 240
251 3300046665 Ga0495661_0002477 Ga0495661_0002477_5665_6408 240
252 3300046665 Ga0495661_0006019 Ga0495661_0006019_1292_2035 240
253 3300046794 Ga0495589_0006973 Ga0495589_0006973_1028_1771 240
254 3300046810 Ga0495660_0007640 Ga0495660_0007640_704_1477 240
255 3300047446 Ga0495679_005919 Ga0495679_005919_1427_2170 240
256 3300047470 Ga0495681_0017346 Ga0495681_0017346_2346_3089 240
257 3300048920 Ga0496117_0001350 Ga0496117_0001350_27413_28156 240
258 3300048920 Ga0496117_0005313 Ga0496117_0005313_10783_11526 240
259 3300048920 Ga0496117_0022883 Ga0496117_0022883_2844_3587 240
260 3300048921 Ga0496118_0006273 Ga0496118_0006273_1862_2605 240
261 3300048921 Ga0496118_0094678 Ga0496118_0094678_1049_1792 240
262 3300048922 Ga0496119_0017184 Ga0496119_0017184_3373_4116 240
263 3300048923 Ga0496120_0008617 Ga0496120_0008617_5706_6449 240
264 3300048923 Ga0496120_0013023 Ga0496120_0013023_1255_1998 240
265 3300048924 Ga0496121_0030451 Ga0496121_0030451_1391_2134 240
266 3300048925 Ga0496122_0030352 Ga0496122_0030352_2379_3122 240
267 3300048925 Ga0496122_0062902 Ga0496122_0062902_328_1071 240
268 3300048926 Ga0496123_0123599 Ga0496123_0123599_328_1071 240
269 3300048927 Ga0496124_0005300 Ga0496124_0005300_7796_8539 240
270 3300048927 Ga0496124_0037420 Ga0496124_0037420_2909_3652 240
271 3300048927 Ga0496124_0083485 Ga0496124_0083485_1617_2360 240
272 3300048927 Ga0496124_0216884 Ga0496124_0216884_37_780 240
273 3300048928 Ga0496125_0006089 Ga0496125_0006089_4607_5350 240
274 3300048928 Ga0496125_0023573 Ga0496125_0023573_2104_2847 240
275 3300048928 Ga0496125_0030617 Ga0496125_0030617_1222_1965 240
276 3300048928 Ga0496125_0034111 Ga0496125_0034111_1994_2737 240
277 3300048929 Ga0496126_0143343 Ga0496126_0143343_952_1695 240
278 3300053161 Ga0500634_0004112 Ga0500634_0004112_4879_5622 240
279 iso_pu_bacteria 2554235231 2555245451 240
280 iso_pu_bacteria 2765235841 2765582014 240
281 iso_pu_bacteria 2806310737 2807410099 240
282 iso_pu_bacteria 2806310745 2807458446 240
283 iso_pu_bacteria 2919155634 2919160095 240
284 iso_pu_bacteria 3007803356 3007806980 240
285 iso_pu_bacteria 3007872151 3007872832 240
286 iso_pu_bacteria 8052494512 8052499138 240
287 iso_pu_bacteria 8054929484 8054934306 240
288 iso_pu_bacteria 8056120720 8056125100 240
289 iso_pu_bacteria 8056137416 8056142119 240
290 2162886007 SwRhRL2b_contig_3024960 SwRhRL2b_0994.00000640 241
291 3300002737 JGI25162J39368_1000491 JGI25162J39368_10004917 241
292 3300002771 JGI25163J39215_1000427 JGI25163J39215_10004275 241
293 3300002772 JGI25164J39214_1000334 JGI25164J39214_10003347 241
294 3300003214 JGI25165J46597_1000616 JGI25165J46597_10006167 241
295 3300003781 Ga0055536_1000707 Ga0055536_100070712 241
296 3300003791 Ga0055530_10000626 Ga0055530_1000062618 241
297 3300003792 Ga0055540_1000484 Ga0055540_100048418 241
298 3300005288 Ga0065714_10013533 Ga0065714_100135333 241
299 3300005288 Ga0065714_10065221 Ga0065714_100652213 241
300 3300005290 Ga0065712_10067964 Ga0065712_100679644 241
301 3300006058 Ga0075432_10000364 Ga0075432_100003644 241
302 3300006914 Ga0075436_100025206 Ga0075436_1000252063 241
303 3300006914 Ga0075436_100222764 Ga0075436_1002227642 241
304 3300009011 Ga0105251_10000580 Ga0105251_1000058026 241
305 3300009011 Ga0105251_10000933 Ga0105251_1000093315 241
306 3300009011 Ga0105251_10005126 Ga0105251_100051262 241
307 3300009011 Ga0105251_10052398 Ga0105251_100523982 241
308 3300009036 Ga0105244_10000303 Ga0105244_1000030339 241
309 3300009036 Ga0105244_10107981 Ga0105244_101079812 241
310 3300009036 Ga0105244_10111522 Ga0105244_101115222 241
311 3300009148 Ga0105243_10000797 Ga0105243_100007977 241
312 3300009148 Ga0105243_10006057 Ga0105243_100060576 241
313 3300009148 Ga0105243_10041234 Ga0105243_100412344 241
314 3300009553 Ga0105249_10044565 Ga0105249_100445655 241
315 3300013100 Ga0157373_10008434 Ga0157373_100084346 241
316 3300013100 Ga0157373_10036047 Ga0157373_100360473 241
317 3300013102 Ga0157371_10001815 Ga0157371_100018159 241
318 3300013105 Ga0157369_10230491 Ga0157369_102304912 241
319 3300014497 Ga0182008_10001819 Ga0182008_100018192 241
320 3300014497 Ga0182008_10199034 Ga0182008_101990341 241
321 3300015265 Ga0182005_1028637 Ga0182005_10286372 241
322 3300015265 Ga0182005_1031895 Ga0182005_10318952 241
323 3300025207 Ga0209760_100232 Ga0209760_10023212 241
324 3300025231 Ga0207427_100007 Ga0207427_100007548 241
325 3300025233 Ga0209437_100006 Ga0209437_100006814 241
326 3300025256 Ga0209759_1002349 Ga0209759_10023492 241
327 3300025261 Ga0209233_1000059 Ga0209233_1000059181 241
328 3300025292 Ga0209676_1000006 Ga0209676_1000006797 241
329 3300025298 Ga0209050_1000065 Ga0209050_1000065279 241
330 3300025303 Ga0209051_1000504 Ga0209051_100050412 241
331 3300025728 Ga0207655_1000005 Ga0207655_1000005165 241
332 3300025728 Ga0207655_1000015 Ga0207655_1000015254 241
333 3300025728 Ga0207655_1002309 Ga0207655_100230910 241
334 3300025728 Ga0207655_1018347 Ga0207655_10183472 241
335 3300025735 Ga0207713_1000138 Ga0207713_100013878 241
336 3300025735 Ga0207713_1000604 Ga0207713_10006049 241
337 3300025735 Ga0207713_1019303 Ga0207713_10193033 241
338 3300025935 Ga0207709_10000827 Ga0207709_1000082713 241
339 3300025935 Ga0207709_10026801 Ga0207709_100268013 241
340 3300027907 Ga0207428_10013408 Ga0207428_100134082 241
341 3300031548 Ga0307408_100012772 Ga0307408_1000127725 241
342 3300033180 Ga0307510_10144294 Ga0307510_101442942 241
343 3300041405 Ga0439438_001822 Ga0439438_001822_7743_8492 241
344 3300041405 Ga0439438_002973 Ga0439438_002973_5147_5923 241
345 3300041407 Ga0439447_007010 Ga0439447_007010_2304_3080 241
346 3300041407 Ga0439447_019163 Ga0439447_019163_137_886 241
347 3300041411 Ga0439466_0000907 Ga0439466_0000907_842_1591 241
348 3300041411 Ga0439466_0001146 Ga0439466_0001146_1854_2603 241
349 3300041997 Ga0439431_0000561 Ga0439431_0000561_6185_6934 241
350 3300042006 Ga0439432_008900 Ga0439432_008900_2661_3410 241
351 3300042009 Ga0439451_004573 Ga0439451_004573_51_800 241
352 3300042010 Ga0439452_002394 Ga0439452_002394_1188_1937 241
353 3300042010 Ga0439452_016436 Ga0439452_016436_788_1561 241
354 3300042010 Ga0439452_031110 Ga0439452_031110_408_1184 241
355 3300042013 Ga0439456_006901 Ga0439456_006901_1501_2250 241
356 3300042016 Ga0439463_000258 Ga0439463_000258_8018_8770 241
357 3300042016 Ga0439463_001422 Ga0439463_001422_2263_3012 241
358 3300042016 Ga0439463_002096 Ga0439463_002096_4301_5053 241
359 3300042137 Ga0450902_017270 Ga0450902_017270_304_1053 241
360 3300042142 Ga0450905_006953 Ga0450905_006953_739_1518 241
361 3300042147 Ga0450910_003292 Ga0450910_003292_498_1247 241
362 3300042184 Ga0450908_017691 Ga0450908_017691_337_1113 241
363 3300042185 Ga0450909_003241 Ga0450909_003241_886_1635 241
364 3300042461 Ga0439460_0019019 Ga0439460_0019019_624_1400 241
365 3300046453 Ga0495627_000021 Ga0495627_000021_243905_244657 241
366 3300046453 Ga0495627_000064 Ga0495627_000064_33459_34232 241
367 3300046453 Ga0495627_040630 Ga0495627_040630_542_1291 241
368 3300046453 Ga0495627_081682 Ga0495627_081682_22_774 241
369 3300046457 Ga0495590_0007655 Ga0495590_0007655_1345_2094 241
370 3300046457 Ga0495590_0171628 Ga0495590_0171628_28_780 241
371 3300046458 Ga0495591_000085 Ga0495591_000085_65350_66102 241
372 3300046458 Ga0495591_000675 Ga0495591_000675_18568_19320 241
373 3300046458 Ga0495591_000775 Ga0495591_000775_5985_6737 241
374 3300046458 Ga0495591_002044 Ga0495591_002044_4883_5659 241
375 3300046458 Ga0495591_002143 Ga0495591_002143_7317_8069 241
376 3300046458 Ga0495591_011276 Ga0495591_011276_71_823 241
377 3300046458 Ga0495591_025184 Ga0495591_025184_690_1439 241
378 3300046460 Ga0495638_0000675 Ga0495638_0000675_4362_5111 241
379 3300046460 Ga0495638_0000678 Ga0495638_0000678_9054_9803 241
380 3300046460 Ga0495638_0022180 Ga0495638_0022180_1351_2100 241
381 3300046463 Ga0495653_0024413 Ga0495653_0024413_3843_4592 241
382 3300046471 Ga0495650_0009261 Ga0495650_0009261_3497_4246 241
383 3300046471 Ga0495650_0011729 Ga0495650_0011729_1964_2737 241
384 3300046471 Ga0495650_0014055 Ga0495650_0014055_2440_3192 241
385 3300046473 Ga0495582_0062713 Ga0495582_0062713_1232_1981 241
386 3300046474 Ga0495605_0000014 Ga0495605_0000014_82905_83657 241
387 3300046474 Ga0495605_0001107 Ga0495605_0001107_11148_11900 241
388 3300046474 Ga0495605_0001698 Ga0495605_0001698_7941_8693 241
389 3300046474 Ga0495605_0009223 Ga0495605_0009223_1495_2247 241
390 3300046474 Ga0495605_0029161 Ga0495605_0029161_1538_2287 241
391 3300046474 Ga0495605_0038104 Ga0495605_0038104_484_1260 241
392 3300046474 Ga0495605_0041983 Ga0495605_0041983_1001_1753 241
393 3300046474 Ga0495605_0052726 Ga0495605_0052726_1178_1930 241
394 3300046475 Ga0495639_0067777 Ga0495639_0067777_115_864 241
395 3300046491 Ga0495584_0004354 Ga0495584_0004354_2212_2961 241
396 3300046491 Ga0495584_0016905 Ga0495584_0016905_2282_3031 241
397 3300046492 Ga0495585_0002507 Ga0495585_0002507_11526_12275 241
398 3300046492 Ga0495585_0043036 Ga0495585_0043036_523_1272 241
399 3300046492 Ga0495585_0055246 Ga0495585_0055246_1361_2113 241
400 3300046499 Ga0495594_0076195 Ga0495594_0076195_408_1157 241
401 3300046501 Ga0495607_0000913 Ga0495607_0000913_21313_22065 241
402 3300046501 Ga0495607_0002484 Ga0495607_0002484_6462_7214 241
403 3300046501 Ga0495607_0002741 Ga0495607_0002741_6664_7413 241
404 3300046501 Ga0495607_0017427 Ga0495607_0017427_1213_1962 241
405 3300046501 Ga0495607_0057290 Ga0495607_0057290_251_1027 241
406 3300046506 Ga0495583_0000066 Ga0495583_0000066_53785_54537 241
407 3300046506 Ga0495583_0001270 Ga0495583_0001270_4611_5363 241
408 3300046506 Ga0495583_0002420 Ga0495583_0002420_14548_15324 241
409 3300046507 Ga0495606_0001118 Ga0495606_0001118_32912_33664 241
410 3300046507 Ga0495606_0185005 Ga0495606_0185005_317_1069 241
411 3300046512 Ga0495610_0002330 Ga0495610_0002330_2475_3227 241
412 3300046512 Ga0495610_0020028 Ga0495610_0020028_2237_2989 241
413 3300046513 Ga0495616_0005088 Ga0495616_0005088_4350_5099 241
414 3300046513 Ga0495616_0015760 Ga0495616_0015760_1653_2405 241
415 3300046513 Ga0495616_0064849 Ga0495616_0064849_613_1365 241
416 3300046515 Ga0495620_0000048 Ga0495620_0000048_53779_54531 241
417 3300046515 Ga0495620_0000935 Ga0495620_0000935_4741_5526 241
418 3300046515 Ga0495620_0005363 Ga0495620_0005363_4627_5379 241
419 3300046516 Ga0495628_0114688 Ga0495628_0114688_772_1521 241
420 3300046517 Ga0495630_0038210 Ga0495630_0038210_1656_2405 241
421 3300046518 Ga0495631_0000628 Ga0495631_0000628_12680_13453 241
422 3300046518 Ga0495631_0003784 Ga0495631_0003784_6027_6779 241
423 3300046518 Ga0495631_0136476 Ga0495631_0136476_248_997 241
424 3300046519 Ga0495632_0003846 Ga0495632_0003846_4759_5535 241
425 3300046519 Ga0495632_0009564 Ga0495632_0009564_342_1094 241
426 3300046519 Ga0495632_0015552 Ga0495632_0015552_825_1598 241
427 3300046519 Ga0495632_0021247 Ga0495632_0021247_65_838 241
428 3300046519 Ga0495632_0033368 Ga0495632_0033368_1174_1923 241
429 3300046519 Ga0495632_0034845 Ga0495632_0034845_1279_2028 241
430 3300046520 Ga0495637_0000609 Ga0495637_0000609_7339_8091 241
431 3300046520 Ga0495637_0000765 Ga0495637_0000765_5815_6567 241
432 3300046520 Ga0495637_0010628 Ga0495637_0010628_1500_2285 241
433 3300046520 Ga0495637_0012821 Ga0495637_0012821_2461_3213 241
434 3300046520 Ga0495637_0053112 Ga0495637_0053112_105_857 241
435 3300046522 Ga0495643_0012325 Ga0495643_0012325_3173_3925 241
436 3300046522 Ga0495643_0047259 Ga0495643_0047259_764_1513 241
437 3300046523 Ga0495644_0000328 Ga0495644_0000328_9094_9843 241
438 3300046523 Ga0495644_0000955 Ga0495644_0000955_8727_9479 241
439 3300046523 Ga0495644_0152606 Ga0495644_0152606_108_860 241
440 3300046524 Ga0495648_0002990 Ga0495648_0002990_8010_8762 241
441 3300046524 Ga0495648_0002998 Ga0495648_0002998_1890_2642 241
442 3300046524 Ga0495648_0005368 Ga0495648_0005368_8787_9539 241
443 3300046528 Ga0495642_0002058 Ga0495642_0002058_5887_6636 241
444 3300046530 Ga0495654_0000534 Ga0495654_0000534_19397_20170 241
445 3300046530 Ga0495654_0000761 Ga0495654_0000761_19435_20205 241
446 3300046530 Ga0495654_0002337 Ga0495654_0002337_2384_3136 241
447 3300046530 Ga0495654_0004633 Ga0495654_0004633_727_1476 241
448 3300046530 Ga0495654_0005574 Ga0495654_0005574_1751_2503 241
449 3300046530 Ga0495654_0039365 Ga0495654_0039365_232_981 241
450 3300046530 Ga0495654_0131228 Ga0495654_0131228_284_1033 241
451 3300046535 Ga0495586_0001717 Ga0495586_0001717_3781_4530 241
452 3300046536 Ga0495587_0003152 Ga0495587_0003152_10144_10893 241
453 3300046538 Ga0495609_0000024 Ga0495609_0000024_225989_226741 241
454 3300046542 Ga0495597_0000005 Ga0495597_0000005_257382_258134 241
455 3300046542 Ga0495597_0001399 Ga0495597_0001399_5107_5859 241
456 3300046542 Ga0495597_0016624 Ga0495597_0016624_218_967 241
457 3300046543 Ga0495645_0100312 Ga0495645_0100312_998_1747 241
458 3300046557 Ga0495622_0012465 Ga0495622_0012465_1609_2358 241
459 3300046557 Ga0495622_0012621 Ga0495622_0012621_1273_2025 241
460 3300046558 Ga0495633_0000030 Ga0495633_0000030_116401_117153 241
461 3300046558 Ga0495633_0061059 Ga0495633_0061059_637_1386 241
462 3300046616 Ga0495668_0007494 Ga0495668_0007494_1124_1876 241
463 3300046616 Ga0495668_0041202 Ga0495668_0041202_624_1400 241
464 3300046648 Ga0495611_0000524 Ga0495611_0000524_6593_7345 241
465 3300046648 Ga0495611_0003621 Ga0495611_0003621_5171_5947 241
466 3300046648 Ga0495611_0004277 Ga0495611_0004277_3950_4702 241
467 3300046648 Ga0495611_0017751 Ga0495611_0017751_1942_2691 241
468 3300046660 Ga0495625_0000050 Ga0495625_0000050_133666_134418 241
469 3300046663 Ga0495635_0003890 Ga0495635_0003890_9056_9805 241
470 3300046664 Ga0495659_0009040 Ga0495659_0009040_1988_2737 241
471 3300046664 Ga0495659_0072384 Ga0495659_0072384_339_1088 241
472 3300046665 Ga0495661_0000015 Ga0495661_0000015_144056_144808 241
473 3300046665 Ga0495661_0006600 Ga0495661_0006600_5250_6002 241
474 3300046665 Ga0495661_0006867 Ga0495661_0006867_3165_3941 241
475 3300046680 Ga0495646_0005403 Ga0495646_0005403_3159_3908 241
476 3300046689 Ga0495613_0006853 Ga0495613_0006853_922_1671 241
477 3300046691 Ga0495670_0018082 Ga0495670_0018082_2135_2887 241
478 3300046692 Ga0495671_0001516 Ga0495671_0001516_9988_10764 241
479 3300046692 Ga0495671_0001670 Ga0495671_0001670_7119_7892 241
480 3300046692 Ga0495671_0004153 Ga0495671_0004153_212_961 241
481 3300046692 Ga0495671_0046510 Ga0495671_0046510_421_1173 241
482 3300046692 Ga0495671_0101559 Ga0495671_0101559_461_1213 241
483 3300046794 Ga0495589_0000639 Ga0495589_0000639_1665_2417 241
484 3300046810 Ga0495660_0000853 Ga0495660_0000853_5063_5815 241
485 3300046810 Ga0495660_0006636 Ga0495660_0006636_1293_2045 241
486 3300046810 Ga0495660_0011667 Ga0495660_0011667_1720_2469 241
487 3300047315 Ga0495581_0080508 Ga0495581_0080508_102_851 241
488 3300047320 Ga0495672_0001802 Ga0495672_0001802_10384_11133 241
489 3300047320 Ga0495672_0002307 Ga0495672_0002307_7559_8308 241
490 3300047320 Ga0495672_0002703 Ga0495672_0002703_12166_12939 241
491 3300047320 Ga0495672_0008170 Ga0495672_0008170_2107_2883 241
492 3300047320 Ga0495672_0009355 Ga0495672_0009355_3874_4623 241
493 3300047321 Ga0495676_0000024 Ga0495676_0000024_53019_53771 241
494 3300047322 Ga0495680_0003833 Ga0495680_0003833_8761_9510 241
495 3300047323 Ga0495683_0000056 Ga0495683_0000056_53733_54485 241
496 3300047323 Ga0495683_0004611 Ga0495683_0004611_6113_6862 241
497 3300047444 Ga0495675_0161279 Ga0495675_0161279_569_1318 241
498 3300047446 Ga0495679_000121 Ga0495679_000121_47453_48205 241
499 3300047447 Ga0495685_011297 Ga0495685_011297_196_945 241
500 3300047469 Ga0495673_0000502 Ga0495673_0000502_6083_6868 241
501 3300047469 Ga0495673_0000955 Ga0495673_0000955_18989_19741 241
502 3300047469 Ga0495673_0001415 Ga0495673_0001415_3901_4677 241
503 3300047469 Ga0495673_0001643 Ga0495673_0001643_9647_10396 241
504 3300047469 Ga0495673_0002363 Ga0495673_0002363_2637_3389 241
505 3300047469 Ga0495673_0002557 Ga0495673_0002557_8039_8791 241
506 3300047469 Ga0495673_0006561 Ga0495673_0006561_1700_2452 241
507 3300047469 Ga0495673_0013518 Ga0495673_0013518_591_1343 241
508 3300047469 Ga0495673_0016277 Ga0495673_0016277_2838_3587 241
509 3300047469 Ga0495673_0030610 Ga0495673_0030610_449_1198 241
510 3300047469 Ga0495673_0041893 Ga0495673_0041893_191_943 241
511 3300047470 Ga0495681_0003240 Ga0495681_0003240_6684_7433 241
512 3300047470 Ga0495681_0039157 Ga0495681_0039157_231_983 241
513 3300047470 Ga0495681_0069600 Ga0495681_0069600_446_1195 241
514 3300047472 Ga0495686_0031174 Ga0495686_0031174_2491_3243 241
515 3300048913 Ga0496110_0118871 Ga0496110_0118871_612_1361 241
516 3300048913 Ga0496110_0193200 Ga0496110_0193200_413_1192 241
517 3300048915 Ga0496112_0213182 Ga0496112_0213182_91_843 241
518 3300048919 Ga0496116_0000853 Ga0496116_0000853_29556_30305 241
519 3300048920 Ga0496117_0003411 Ga0496117_0003411_9965_10714 241
520 3300048920 Ga0496117_0087316 Ga0496117_0087316_1253_2005 241
521 3300048921 Ga0496118_0015041 Ga0496118_0015041_5427_6176 241
522 3300048924 Ga0496121_0002405 Ga0496121_0002405_5963_6715 241
523 3300048924 Ga0496121_0003645 Ga0496121_0003645_14974_15726 241
524 3300048924 Ga0496121_0003680 Ga0496121_0003680_12969_13718 241
525 3300048925 Ga0496122_0003280 Ga0496122_0003280_14736_15488 241
526 3300048925 Ga0496122_0019364 Ga0496122_0019364_1351_2100 241
527 3300048925 Ga0496122_0079818 Ga0496122_0079818_71_823 241
528 3300048926 Ga0496123_0000080 Ga0496123_0000080_46085_46837 241
529 3300048926 Ga0496123_0006662 Ga0496123_0006662_3742_4491 241
530 3300048926 Ga0496123_0013234 Ga0496123_0013234_3569_4321 241
531 3300048926 Ga0496123_0063105 Ga0496123_0063105_480_1232 241
532 3300048927 Ga0496124_0004525 Ga0496124_0004525_7073_7822 241
533 3300048927 Ga0496124_0006955 Ga0496124_0006955_4635_5387 241
534 3300049459 Ga0495678_000063 Ga0495678_000063_97277_98029 241
535 3300049459 Ga0495678_001515 Ga0495678_001515_10298_11068 241
536 3300049459 Ga0495678_002112 Ga0495678_002112_5564_6316 241
537 3300049459 Ga0495678_005544 Ga0495678_005544_3882_4634 241
538 3300049459 Ga0495678_014394 Ga0495678_014394_2587_3336 241
539 3300049460 Ga0495682_0000098 Ga0495682_0000098_72701_73450 241
540 3300049460 Ga0495682_0000504 Ga0495682_0000504_5871_6623 241
541 3300049460 Ga0495682_0010362 Ga0495682_0010362_185_934 241
542 3300053125 Ga0500618_031596 Ga0500618_031596_86_838 241
543 3300053140 Ga0500573_0020257 Ga0500573_0020257_2577_3329 241
544 iso_pu_bacteria 2912963787 2912968229 241
545 iso_pu_bacteria 2939651529 2939652707 241
546 3300046471 Ga0495650_0003322 Ga0495650_0003322_3943_4779 242
547 3300046474 Ga0495605_0000678 Ga0495605_0000678_18147_18995 242
548 3300046501 Ga0495607_0010820 Ga0495607_0010820_67_915 242
549 3300046501 Ga0495607_0043718 Ga0495607_0043718_705_1553 242
550 3300046506 Ga0495583_0001499 Ga0495583_0001499_4658_5506 242
551 3300046519 Ga0495632_0001675 Ga0495632_0001675_15182_16018 242
552 3300046538 Ga0495609_0000006 Ga0495609_0000006_252616_253464 242
553 3300046665 Ga0495661_0000331 Ga0495661_0000331_28475_29311 242
554 3300047469 Ga0495673_0004411 Ga0495673_0004411_6746_7594 242
555 3300053142 Ga0500577_0063996 Ga0500577_0063996_158_1006 242
556 3300046542 Ga0495597_0144108 Ga0495597_0144108_25_786 243
557 3300047320 Ga0495672_0050102 Ga0495672_0050102_1697_2458 243
558 3300048927 Ga0496124_0019098 Ga0496124_0019098_1979_2740 243
559 iso_pu_bacteria 8055878733 8055879522 243
560 2162886007 SwRhRL2b_contig_1073037 SwRhRL2b_0934.00001140 244
561 3300005289 Ga0065704_10008515 Ga0065704_100085154 244
562 3300005289 Ga0065704_10078692 Ga0065704_100786921 244
563 3300006944 Ga0099823_1000082 Ga0099823_10000827 244
564 3300006944 Ga0099823_1062356 Ga0099823_10623562 244
565 3300009011 Ga0105251_10001234 Ga0105251_100012343 244
566 3300009011 Ga0105251_10238448 Ga0105251_102384481 244
567 3300009036 Ga0105244_10000703 Ga0105244_100007037 244
568 3300009036 Ga0105244_10008483 Ga0105244_100084836 244
569 3300009036 Ga0105244_10017940 Ga0105244_100179403 244
570 3300009036 Ga0105244_10024563 Ga0105244_100245633 244
571 3300009036 Ga0105244_10030567 Ga0105244_100305673 244
572 3300009036 Ga0105244_10039976 Ga0105244_100399762 244
573 3300009092 Ga0105250_10006186 Ga0105250_100061865 244
574 3300009148 Ga0105243_10006863 Ga0105243_100068635 244
575 3300009148 Ga0105243_10125741 Ga0105243_101257411 244
576 3300013307 Ga0157372_10008728 Ga0157372_100087285 244
577 3300014497 Ga0182008_10009338 Ga0182008_100093385 244
578 3300025292 Ga0209676_1000306 Ga0209676_100030615 244
579 3300025711 Ga0207696_1000248 Ga0207696_100024835 244
580 3300025711 Ga0207696_1010241 Ga0207696_10102412 244
581 3300025711 Ga0207696_1023886 Ga0207696_10238862 244
582 3300025711 Ga0207696_1025108 Ga0207696_10251082 244
583 3300025728 Ga0207655_1000430 Ga0207655_100043030 244
584 3300025728 Ga0207655_1000630 Ga0207655_10006307 244
585 3300025728 Ga0207655_1009300 Ga0207655_10093006 244
586 3300025728 Ga0207655_1018288 Ga0207655_10182882 244
587 3300025728 Ga0207655_1031644 Ga0207655_10316443 244
588 3300025728 Ga0207655_1055056 Ga0207655_10550561 244
589 3300025735 Ga0207713_1001356 Ga0207713_10013568 244
590 3300025735 Ga0207713_1011342 Ga0207713_10113424 244
591 3300025735 Ga0207713_1033555 Ga0207713_10335553 244
592 3300025735 Ga0207713_1042400 Ga0207713_10424002 244
593 3300025935 Ga0207709_10002785 Ga0207709_100027853 244
594 3300025935 Ga0207709_10007744 Ga0207709_100077443 244
595 3300027296 Ga0209389_1000082 Ga0209389_10000827 244
596 3300027296 Ga0209389_1088974 Ga0209389_10889742 244
597 3300027312 Ga0209371_1002332 Ga0209371_10023323 244
598 3300030500 Ga0268256_1002399 Ga0268256_10023993 244
599 3300042006 Ga0439432_002114 Ga0439432_002114_6182_6934 244
600 3300042013 Ga0439456_000018 Ga0439456_000018_42944_43711 244
601 3300042136 Ga0450900_005270 Ga0450900_005270_478_1230 244
602 3300042137 Ga0450902_004725 Ga0450902_004725_42_776 244
603 3300042142 Ga0450905_000235 Ga0450905_000235_286_1020 244
604 3300042142 Ga0450905_003415 Ga0450905_003415_612_1364 244
605 3300042439 Ga0439464_0018643 Ga0439464_0018643_919_1671 244
606 3300042533 Ga0450901_000405 Ga0450901_000405_4382_5116 244
607 3300046471 Ga0495650_0001687 Ga0495650_0001687_16003_16857 244
608 3300046491 Ga0495584_0009959 Ga0495584_0009959_216_1082 244
609 3300046500 Ga0495596_0036003 Ga0495596_0036003_507_1373 244
610 3300046506 Ga0495583_0000168 Ga0495583_0000168_57772_58626 244
611 3300046507 Ga0495606_0000482 Ga0495606_0000482_53113_53928 244
612 3300046513 Ga0495616_0019325 Ga0495616_0019325_2520_3386 244
613 3300046515 Ga0495620_0000027 Ga0495620_0000027_44329_45081 244
614 3300046518 Ga0495631_0008161 Ga0495631_0008161_3981_4835 244
615 3300046519 Ga0495632_0000299 Ga0495632_0000299_21619_22371 244
616 3300046522 Ga0495643_0000457 Ga0495643_0000457_45634_46386 244
617 3300046522 Ga0495643_0001019 Ga0495643_0001019_6681_7415 244
618 3300046524 Ga0495648_0000393 Ga0495648_0000393_21643_22395 244
619 3300046538 Ga0495609_0000099 Ga0495609_0000099_67497_68351 244
620 3300046542 Ga0495597_0026126 Ga0495597_0026126_1445_2212 244
621 3300046665 Ga0495661_0000216 Ga0495661_0000216_32793_33659 244
622 3300047446 Ga0495679_000098 Ga0495679_000098_64060_64914 244
623 3300047469 Ga0495673_0018376 Ga0495673_0018376_1752_2618 244
624 3300047470 Ga0495681_0001448 Ga0495681_0001448_11182_12048 244
625 3300047472 Ga0495686_0060433 Ga0495686_0060433_698_1564 244
626 3300048091 Ga0495626_0000061 Ga0495626_0000061_91882_92748 244
627 3300048917 Ga0496114_0063799 Ga0496114_0063799_876_1610 244
628 3300048920 Ga0496117_0000721 Ga0496117_0000721_21543_22277 244
629 3300048920 Ga0496117_0001489 Ga0496117_0001489_25865_26617 244
630 3300048920 Ga0496117_0009707 Ga0496117_0009707_6755_7507 244
631 3300048921 Ga0496118_0000982 Ga0496118_0000982_32362_33096 244
632 3300048921 Ga0496118_0081807 Ga0496118_0081807_83_835 244
633 3300048922 Ga0496119_0000136 Ga0496119_0000136_38188_38940 244
634 3300048924 Ga0496121_0397039 Ga0496121_0397039_28_762 244
635 3300048925 Ga0496122_0001459 Ga0496122_0001459_4969_5703 244
636 3300048925 Ga0496122_0126775 Ga0496122_0126775_717_1451 244
637 3300048926 Ga0496123_0001420 Ga0496123_0001420_25803_26537 244
638 3300048926 Ga0496123_0098585 Ga0496123_0098585_817_1551 244
639 3300048927 Ga0496124_0002582 Ga0496124_0002582_181_915 244
640 3300048927 Ga0496124_0004287 Ga0496124_0004287_9409_10143 244
641 3300048927 Ga0496124_0034475 Ga0496124_0034475_1011_1745 244
642 3300048927 Ga0496124_0143980 Ga0496124_0143980_723_1475 244
643 3300048928 Ga0496125_0001348 Ga0496125_0001348_11475_12227 244
644 3300048928 Ga0496125_0007993 Ga0496125_0007993_10248_10982 244
645 3300048928 Ga0496125_0064604 Ga0496125_0064604_1600_2334 244
646 3300048929 Ga0496126_0027874 Ga0496126_0027874_3272_4024 244
647 3300048929 Ga0496126_0604408 Ga0496126_0604408_60_794 244
648 3300049571 Ga0501034_0000586 Ga0501034_0000586_20907_21641 244
649 3300053135 Ga0500659_0004666 Ga0500659_0004666_4694_5446 244
650 iso_pu_bacteria 8056115690 8056120491 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03692

CxxCxxCC

Putative zinc- or iron-chelating domain

50

170

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xwi-assembly1.cif.gz_A x-ray crystal structure of cmp-kdo synthase from pseudomonas aeruginosa 0.7662 209 237
1vh3-assembly1.cif.gz_A crystal structure of cmp-kdo synthetase 0.6137 194 235
3l4b-assembly1.cif.gz_A crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima 0.5426 196 232
4za1-assembly1.cif.gz_C crystal structure of nosa involved in nosiheptide biosynthesis 0.5343 37 80
8tdj-assembly1.cif.gz_B cryo-em structure of the wild-type atmsl10 in gdn 0.4538 31 87
ID Description Score Start End Superfamily
af_Q54U59_216_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7866 211 236 3.40.50.150
4fcuA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.645 206 237 3.90.550.10
af_Q2G240_75_233_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.5712 196 232 3.40.50.1360
af_Q12129_1_160_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5688 190 232 3.40.50.1010
af_M9PBV2_262_493_3.30.420.150 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.5409 35 80 3.30.420.150
ID Description Score Start End GO Terms
AF-A0A427G173-F1-model_v4 YkgJ family cysteine cluster protein 0.9083 6 244
AF-A0A345RVN0-F1-model_v4 Zinc/iron-chelating domain-containing protein 0.8954 6 243
AF-A0A0P9KXW4-F1-model_v4 deleted 0.8925 1 243
AF-A0A427G173-F1-model_v4 YkgJ family cysteine cluster protein 0.8874 6 244
AF-A0A0P9KXW4-F1-model_v4 deleted 0.8856 1 243

Feature Viewer

pLDDT pTM Quality
85.11 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map