F472272

General Info

Members Datasets Scaffolds Average Seq Length
647 230 1294 338

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10166506|Ga0105245_101665062
Length 381
Sequence MQIDVTEGCRLLPTFDKIHQARQRAGQKEIATMTATRLALFVIALSVPLATSHAQWLNHPTPGIPRTANGKPNLAAPASGLWNKISPKYSRNIAADLKPGEIQPWAEALVQQRKEDLGKDYMNVLCVPLGPAYSTDADSTGAEMMKIVQTPSLILILNPDLTYRQIFLDGRALEPAPNPAWMGYSVGHWDGDTLVVESFGFNDRTWLDHDGHPHTEALRMTERYRRRDFGNLELDVTLSDRAVYAKSWTVKVRAELAADTELIEWVCNEKGSELQHWVGKASDEKKSAVKVAPEVLTKYVGIYEEQPPLWRLVPRVVEITLSGDTLFADMDGRGKTPLVAQSQTSFSGLYGLGVDFKSDPAEAALLFVKHVSGDYRFTRRK

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 97.68
Stem 0
Stem Tuber 0
Unclassified 20.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10166506 3300009098 Bacteria 2095
2 JGI24746J21847_1001553 3300001977 Bacteria 3659
3 Ga0065712_10003266 3300005290 Bacteria 7644
4 Ga0065712_10101341 3300005290 Bacteria 2037
5 Ga0070683_100002302 3300005329 Bacteria 15142
6 Ga0070683_100005826 3300005329 Bacteria 10309
7 Ga0070683_100018326 3300005329 Bacteria 6198
8 Ga0070683_100043102 3300005329 Unclassified 4158
9 Ga0070683_100090881 3300005329 Bacteria 2866
10 Ga0070683_100118506 3300005329 Bacteria 2500
11 Ga0070683_100127642 3300005329 Unclassified 2405
12 Ga0070690_100116003 3300005330 Unclassified 1792
13 Ga0070670_100020220 3300005331 Bacteria 5720
14 Ga0068869_100040783 3300005334 Bacteria 3321
15 Ga0068869_100049516 3300005334 Bacteria 3042
16 Ga0068869_100062854 3300005334 Bacteria 2726
17 Ga0068869_100118472 3300005334 Unclassified 2022
18 Ga0070666_10001781 3300005335 Bacteria 13120
19 Ga0070666_10003591 3300005335 Bacteria 9403
20 Ga0070666_10005922 3300005335 Bacteria 7509
21 Ga0070666_10018601 3300005335 Bacteria 4471
22 Ga0070680_100007854 3300005336 Bacteria 8134
23 Ga0070680_100212862 3300005336 Bacteria 1631
24 Ga0068868_100026444 3300005338 Bacteria 4422
25 Ga0068868_100041365 3300005338 Unclassified 3591
26 Ga0070689_100096979 3300005340 Unclassified 2331
27 Ga0070689_100121627 3300005340 Bacteria 2085
28 Ga0070691_10000407 3300005341 Bacteria 15681
29 Ga0070687_100058908 3300005343 Bacteria 2020
30 Ga0070661_100078569 3300005344 Bacteria 2434
31 Ga0070669_100072762 3300005353 Bacteria 2545
32 Ga0070669_100102538 3300005353 Bacteria 2160
33 Ga0070671_100056231 3300005355 Bacteria 3274
34 Ga0070674_100023363 3300005356 Unclassified 4001
35 Ga0070674_100213401 3300005356 Archaea 1497
36 Ga0070673_100034282 3300005364 Bacteria 3839
37 Ga0070673_100139497 3300005364 Unclassified 2043
38 Ga0070688_100081582 3300005365 Unclassified 2095
39 Ga0070659_100124752 3300005366 Bacteria 2089
40 Ga0070659_100235725 3300005366 Viruses 1513
41 Ga0070667_100015626 3300005367 Bacteria 6276
42 Ga0070667_100048245 3300005367 Unclassified 3584
43 Ga0070709_10093216 3300005434 Archaea 1990
44 Ga0070709_10180557 3300005434 Unclassified 1482
45 Ga0070713_100033271 3300005436 Unclassified 4127
46 Ga0070713_100036847 3300005436 Bacteria 3951
47 Ga0070710_10179634 3300005437 Bacteria 1324
48 Ga0070711_100086356 3300005439 Bacteria 2250
49 Ga0070711_100180430 3300005439 Unclassified 1616
50 Ga0070711_100364293 3300005439 Unclassified 1165
51 Ga0070705_100080163 3300005440 Unclassified 2002
52 Ga0070700_100055848 3300005441 Bacteria 2473
53 Ga0070694_100007649 3300005444 Bacteria 6594
54 Ga0070708_100113291 3300005445 Unclassified 2495
55 Ga0070678_100063914 3300005456 Unclassified 2725
56 Ga0070662_100119404 3300005457 Bacteria 2019
57 Ga0070681_10002794 3300005458 Bacteria 16130
58 Ga0070681_10009422 3300005458 Bacteria 9609
59 Ga0070681_10068779 3300005458 Bacteria 3508
60 Ga0068867_100012310 3300005459 Bacteria 6051
61 Ga0070707_100098032 3300005468 Bacteria 2839
62 Ga0070707_100369765 3300005468 Unclassified 1393
63 Ga0070707_100479119 3300005468 Unclassified 1206
64 Ga0070707_100527344 3300005468 Unclassified 1143
65 Ga0070698_100007526 3300005471 Bacteria 11780
66 Ga0070698_100322688 3300005471 Bacteria 1475
67 Ga0070699_100001327 3300005518 Bacteria 22790
68 Ga0070699_100011374 3300005518 Bacteria 7683
69 Ga0070679_100001436 3300005530 Bacteria 21065
70 Ga0070684_100001444 3300005535 Bacteria 17131
71 Ga0070684_100059520 3300005535 Bacteria 3340
72 Ga0070684_100071600 3300005535 Bacteria 3051
73 Ga0070684_100254696 3300005535 Unclassified 1604
74 Ga0070684_100451400 3300005535 Unclassified 1188
75 Ga0070697_100193798 3300005536 Bacteria 1725
76 Ga0070697_100235735 3300005536 Unclassified 1562
77 Ga0068853_100008049 3300005539 Bacteria 8455
78 Ga0068853_100051401 3300005539 Unclassified 3547
79 Ga0068853_100342634 3300005539 Bacteria 1389
80 Ga0068853_100372086 3300005539 Unclassified 1333
81 Ga0070672_100169853 3300005543 Bacteria 1813
82 Ga0070672_100258603 3300005543 Archaea 1468
83 Ga0070686_100011511 3300005544 Bacteria 5018
84 Ga0070686_100012275 3300005544 Bacteria 4873
85 Ga0070695_100022986 3300005545 Unclassified 3827
86 Ga0070696_100012651 3300005546 Bacteria 5666
87 Ga0070696_100264480 3300005546 Bacteria 1306
88 Ga0070693_100050559 3300005547 Bacteria 2377
89 Ga0070693_100065392 3300005547 Unclassified 2125
90 Ga0070665_100185943 3300005548 Bacteria 2078
91 Ga0070704_100015627 3300005549 Unclassified 4774
92 Ga0068855_100001065 3300005563 Bacteria 34030
93 Ga0068855_100034324 3300005563 Bacteria 6051
94 Ga0068855_100067273 3300005563 Bacteria 4175
95 Ga0070664_100003680 3300005564 Bacteria 12357
96 Ga0070664_100244727 3300005564 Bacteria 1611
97 Ga0070664_100264171 3300005564 Bacteria 1549
98 Ga0068857_100000903 3300005577 Bacteria 22422
99 Ga0068857_100004125 3300005577 Bacteria 12243
100 Ga0068857_100010724 3300005577 Bacteria 7974
101 Ga0068857_100012375 3300005577 Bacteria 7427
102 Ga0068857_100014877 3300005577 Bacteria 6785
103 Ga0068854_100076308 3300005578 Bacteria 2463
104 Ga0068856_100001622 3300005614 Bacteria 23563
105 Ga0068856_100002791 3300005614 Bacteria 17875
106 Ga0068856_100013424 3300005614 Bacteria 7930
107 Ga0068856_100120194 3300005614 Bacteria 2629
108 Ga0068856_100203481 3300005614 Bacteria 1994
109 Ga0068852_100342828 3300005616 Bacteria 1457
110 Ga0068859_100024192 3300005617 Bacteria 6094
111 Ga0068859_100184777 3300005617 Bacteria 2168
112 Ga0068859_100381887 3300005617 Bacteria 1504
113 Ga0068864_100308251 3300005618 Bacteria 1484
114 Ga0068870_10008486 3300005840 Bacteria 4624
115 Ga0068870_10204041 3300005840 Unclassified 1200
116 Ga0068863_100004609 3300005841 Bacteria 13578
117 Ga0068863_100037712 3300005841 Unclassified 4600
118 Ga0068863_100237224 3300005841 Bacteria 1760
119 Ga0068858_100000554 3300005842 Bacteria 38982
120 Ga0068858_100001731 3300005842 Bacteria 22321
121 Ga0068858_100004180 3300005842 Bacteria 14208
122 Ga0068858_100012658 3300005842 Bacteria 7952
123 Ga0068858_100014257 3300005842 Bacteria 7493
124 Ga0068858_100094275 3300005842 Unclassified 2788
125 Ga0068858_100155058 3300005842 Unclassified 2154
126 Ga0068858_100228660 3300005842 Bacteria 1763
127 Ga0068860_100001037 3300005843 Bacteria 30547
128 Ga0068860_100013005 3300005843 Bacteria 8172
129 Ga0068860_100067812 3300005843 Unclassified 3389
130 Ga0068862_100003259 3300005844 Bacteria 14040
131 Ga0070717_10003083 3300006028 Bacteria 11888
132 Ga0070717_10013684 3300006028 Bacteria 6224
133 Ga0070712_100195853 3300006175 Bacteria 1584
134 Ga0097621_100002394 3300006237 Bacteria 12852
135 Ga0097621_100008308 3300006237 Bacteria 7469
136 Ga0097621_100008499 3300006237 Bacteria 7393
137 Ga0097621_100016976 3300006237 Bacteria 5519
138 Ga0097621_100017580 3300006237 Bacteria 5434
139 Ga0097621_100022774 3300006237 Bacteria 4867
140 Ga0097621_100023007 3300006237 Bacteria 4846
141 Ga0097621_100026672 3300006237 Bacteria 4535
142 Ga0097621_100069625 3300006237 Bacteria 2905
143 Ga0097621_100080345 3300006237 Bacteria 2712
144 Ga0097621_100097164 3300006237 Bacteria 2472
145 Ga0097621_100115061 3300006237 Unclassified 2276
146 Ga0097621_100136766 3300006237 Bacteria 2090
147 Ga0097621_100253256 3300006237 Bacteria 1542
148 Ga0097621_100277446 3300006237 Unclassified 1475
149 Ga0097621_100291697 3300006237 Unclassified 1438
150 Ga0068871_100000701 3300006358 Bacteria 22770
151 Ga0068871_100001582 3300006358 Bacteria 15308
152 Ga0068871_100003721 3300006358 Bacteria 10490
153 Ga0068871_100008603 3300006358 Bacteria 7339
154 Ga0068871_100014882 3300006358 Bacteria 5813
155 Ga0068871_100019835 3300006358 Bacteria 5139
156 Ga0068871_100023708 3300006358 Bacteria 4751
157 Ga0068871_100056409 3300006358 Bacteria 3193
158 Ga0068871_100084429 3300006358 Bacteria 2635
159 Ga0068871_100094363 3300006358 Bacteria 2497
160 Ga0068871_100116917 3300006358 Unclassified 2248
161 Ga0068871_100141603 3300006358 Unclassified 2045
162 Ga0068871_100243152 3300006358 Bacteria 1565
163 Ga0068871_100387837 3300006358 Bacteria 1242
164 Ga0075428_100004765 3300006844 Bacteria 15018
165 Ga0075428_100073157 3300006844 Unclassified 3743
166 Ga0075428_100174782 3300006844 Bacteria 2326
167 Ga0075430_100001904 3300006846 Bacteria 17110
168 Ga0075431_100001226 3300006847 Bacteria 23249
169 Ga0075431_100068867 3300006847 Bacteria 3651
170 Ga0075433_10001097 3300006852 Bacteria 19542
171 Ga0075433_10001598 3300006852 Bacteria 16786
172 Ga0075433_10005044 3300006852 Bacteria 10347
173 Ga0075433_10016580 3300006852 Bacteria 6077
174 Ga0075433_10050173 3300006852 Bacteria 3632
175 Ga0075433_10072019 3300006852 Bacteria 3038
176 Ga0075434_100000153 3300006871 Bacteria 42782
177 Ga0075434_100000546 3300006871 Bacteria 28705
178 Ga0075434_100000681 3300006871 Bacteria 26437
179 Ga0075434_100004277 3300006871 Bacteria 12813
180 Ga0075434_100016203 3300006871 Bacteria 7164
181 Ga0075434_100026842 3300006871 Bacteria 5648
182 Ga0075434_100026927 3300006871 Bacteria 5640
183 Ga0075434_100051592 3300006871 Bacteria 4088
184 Ga0075434_100098415 3300006871 Bacteria 2930
185 Ga0075434_100571040 3300006871 Unclassified 1150
186 Ga0075429_100066643 3300006880 Bacteria 3135
187 Ga0068865_100033828 3300006881 Bacteria 3424
188 Ga0068865_100093609 3300006881 Bacteria 2185
189 Ga0075436_100002345 3300006914 Bacteria 13061
190 Ga0075436_100009413 3300006914 Bacteria 6679
191 Ga0075436_100028710 3300006914 Unclassified 3826
192 Ga0075436_100085440 3300006914 Unclassified 2190
193 Ga0075436_100266458 3300006914 Bacteria 1222
194 Ga0097620_100024192 3300006931 Bacteria 6094
195 Ga0097620_100184761 3300006931 Bacteria 2168
196 Ga0097620_100281287 3300006931 Bacteria 1756
197 Ga0097620_100381866 3300006931 Bacteria 1504
198 Ga0075435_100000010 3300007076 Bacteria 112658
199 Ga0075435_100000277 3300007076 Bacteria 31844
200 Ga0075435_100000499 3300007076 Bacteria 23869
201 Ga0075435_100012880 3300007076 Bacteria 6202
202 Ga0075435_100045490 3300007076 Unclassified 3519
203 Ga0075435_100062642 3300007076 Unclassified 3018
204 Ga0075435_100067954 3300007076 Bacteria 2902
205 Ga0075435_100115707 3300007076 Bacteria 2233
206 Ga0075435_100243666 3300007076 Bacteria 1529
207 Ga0105240_10001454 3300009093 Bacteria 40497
208 Ga0105240_10012792 3300009093 Bacteria 11562
209 Ga0105240_10145716 3300009093 Bacteria 2826
210 Ga0105240_10150063 3300009093 Unclassified 2777
211 Ga0105240_10173215 3300009093 Bacteria 2554
212 Ga0105240_10242479 3300009093 Bacteria 2089
213 Ga0111539_10104445 3300009094 Bacteria 3324
214 Ga0105245_10000711 3300009098 Bacteria 29955
215 Ga0105245_10002099 3300009098 Bacteria 18060
216 Ga0105245_10002352 3300009098 Bacteria 17104
217 Ga0105245_10002809 3300009098 Bacteria 15657
218 Ga0105245_10007120 3300009098 Bacteria 9811
219 Ga0105245_10015777 3300009098 Bacteria 6587
220 Ga0105245_10022643 3300009098 Bacteria 5516
221 Ga0105245_10027454 3300009098 Bacteria 5016
222 Ga0105245_10039300 3300009098 Bacteria 4211
223 Ga0105245_10172725 3300009098 Unclassified 2059
224 Ga0105245_10234282 3300009098 Unclassified 1777
225 Ga0105245_10326756 3300009098 Bacteria 1512
226 Ga0105245_10411272 3300009098 Bacteria 1354
227 Ga0105245_10596764 3300009098 Unclassified 1130
228 Ga0105247_10018337 3300009101 Bacteria 4199
229 Ga0105247_10058712 3300009101 Bacteria 2381
230 Ga0114129_10010949 3300009147 Bacteria 12920
231 Ga0114129_10034603 3300009147 Bacteria 7136
232 Ga0114129_10048933 3300009147 Bacteria 5941
233 Ga0114129_10049981 3300009147 Bacteria 5874
234 Ga0114129_10058330 3300009147 Bacteria 5399
235 Ga0114129_10065181 3300009147 Bacteria 5084
236 Ga0114129_10071490 3300009147 Unclassified 4838
237 Ga0114129_10130238 3300009147 Bacteria 3456
238 Ga0114129_10132866 3300009147 Bacteria 3417
239 Ga0114129_10213589 3300009147 Unclassified 2607
240 Ga0114129_10224826 3300009147 Bacteria 2530
241 Ga0114129_10267789 3300009147 Bacteria 2287
242 Ga0105243_10056497 3300009148 Bacteria 3122
243 Ga0105243_10106665 3300009148 Bacteria 2336
244 Ga0105243_10178578 3300009148 Bacteria 1844
245 Ga0105241_10000146 3300009174 Bacteria 50607
246 Ga0105241_10013189 3300009174 Bacteria 6061
247 Ga0105241_10018225 3300009174 Bacteria 5162
248 Ga0105241_10044747 3300009174 Plasmid 3355
249 Ga0105241_10073641 3300009174 Bacteria 2658
250 Ga0105241_10084554 3300009174 Unclassified 2491
251 Ga0105241_10089327 3300009174 Bacteria 2427
252 Ga0105241_10154819 3300009174 Unclassified 1878
253 Ga0105241_10155587 3300009174 Unclassified 1874
254 Ga0105241_10231331 3300009174 Unclassified 1558
255 Ga0105242_10007682 3300009176 Bacteria 8297
256 Ga0105242_10027778 3300009176 Bacteria 4498
257 Ga0105242_10032670 3300009176 Bacteria 4163
258 Ga0105242_10048545 3300009176 Bacteria 3450
259 Ga0105242_10067775 3300009176 Bacteria 2951
260 Ga0105242_10091658 3300009176 Bacteria 2559
261 Ga0105242_10219536 3300009176 Unclassified 1698
262 Ga0105242_10330371 3300009176 Unclassified 1401
263 Ga0105242_10337064 3300009176 Unclassified 1389
264 Ga0105248_10018915 3300009177 Bacteria 7617
265 Ga0105248_10030676 3300009177 Bacteria 6004
266 Ga0105248_10032047 3300009177 Bacteria 5873
267 Ga0105248_10056231 3300009177 Bacteria 4414
268 Ga0105248_10069285 3300009177 Bacteria 3960
269 Ga0105248_10070483 3300009177 Unclassified 3926
270 Ga0105248_10105267 3300009177 Bacteria 3181
271 Ga0105248_10114048 3300009177 Bacteria 3048
272 Ga0105248_10124306 3300009177 Bacteria 2910
273 Ga0105248_10181222 3300009177 Unclassified 2373
274 Ga0105248_10232706 3300009177 Unclassified 2074
275 Ga0105248_10265620 3300009177 Bacteria 1932
276 Ga0105248_10356017 3300009177 Bacteria 1648
277 Ga0105248_10369994 3300009177 Unclassified 1614
278 Ga0105237_10005425 3300009545 Bacteria 14400
279 Ga0105237_10014118 3300009545 Bacteria 8358
280 Ga0105237_10017935 3300009545 Bacteria 7334
281 Ga0105237_10043588 3300009545 Bacteria 4519
282 Ga0105237_10071421 3300009545 Bacteria 3466
283 Ga0105237_10543336 3300009545 Unclassified 1169
284 Ga0105238_10001473 3300009551 Bacteria 23635
285 Ga0105238_10004407 3300009551 Bacteria 13964
286 Ga0105238_10006059 3300009551 Bacteria 11995
287 Ga0105238_10006886 3300009551 Bacteria 11353
288 Ga0105238_10051477 3300009551 Bacteria 4142
289 Ga0105238_10312701 3300009551 Viruses 1556
290 Ga0105249_10029916 3300009553 Bacteria 4920
291 Ga0105249_10088091 3300009553 Unclassified 2899
292 Ga0105239_10002755 3300010375 Bacteria 22064
293 Ga0105239_10021904 3300010375 Bacteria 7045
294 Ga0105239_10026142 3300010375 Bacteria 6425
295 Ga0105239_10047072 3300010375 Bacteria 4726
296 Ga0105239_10151927 3300010375 Bacteria 2584
297 Ga0105239_10225485 3300010375 Unclassified 2102
298 Ga0105239_10288709 3300010375 Bacteria 1847
299 Ga0105246_10003450 3300011119 Bacteria 9585
300 Ga0105246_10019967 3300011119 Bacteria 4293
301 Ga0105246_10030745 3300011119 Bacteria 3549
302 Ga0105246_10030998 3300011119 Bacteria 3536
303 Ga0157373_10216946 3300013100 Bacteria 1349
304 Ga0157371_10279494 3300013102 Bacteria 1206
305 Ga0157370_10001333 3300013104 Bacteria 30666
306 Ga0157370_10007211 3300013104 Bacteria 12134
307 Ga0157369_10008658 3300013105 Bacteria 11667
308 Ga0157369_10031992 3300013105 Bacteria 5787
309 Ga0157369_10061703 3300013105 Bacteria 4040
310 Ga0157369_10161491 3300013105 Unclassified 2365
311 Ga0157374_10080977 3300013296 Bacteria 3081
312 Ga0157374_10194770 3300013296 Bacteria 1983
313 Ga0157378_10001710 3300013297 Bacteria 19743
314 Ga0157378_10006868 3300013297 Bacteria 9928
315 Ga0157378_10011975 3300013297 Bacteria 7594
316 Ga0157378_10057904 3300013297 Unclassified 3455
317 Ga0157378_10063464 3300013297 Bacteria 3301
318 Ga0163162_10001375 3300013306 Bacteria 22624
319 Ga0163162_10018013 3300013306 Bacteria 6910
320 Ga0163162_10039235 3300013306 Bacteria 4731
321 Ga0163162_10084136 3300013306 Bacteria 3256
322 Ga0157372_10002867 3300013307 Bacteria 18642
323 Ga0157372_10026591 3300013307 Bacteria 6296
324 Ga0157372_10142454 3300013307 Bacteria 2763
325 Ga0157372_10144576 3300013307 Bacteria 2743
326 Ga0157372_10153587 3300013307 Bacteria 2658
327 Ga0157372_10483382 3300013307 Unclassified 1444
328 Ga0157375_10003915 3300013308 Bacteria 12913
329 Ga0157375_10004664 3300013308 Bacteria 11918
330 Ga0157375_10075935 3300013308 Unclassified 3386
331 Ga0157375_10108632 3300013308 Bacteria 2869
332 Ga0157375_10215256 3300013308 Unclassified 2079
333 Ga0163163_10011975 3300014325 Bacteria 7892
334 Ga0163163_10021305 3300014325 Bacteria 6115
335 Ga0163163_10035606 3300014325 Unclassified 4830
336 Ga0163163_10047029 3300014325 Bacteria 4240
337 Ga0163163_10064704 3300014325 Unclassified 3628
338 Ga0163163_10073066 3300014325 Bacteria 3420
339 Ga0163163_10087886 3300014325 Unclassified 3119
340 Ga0163163_10346527 3300014325 Bacteria 1541
341 Ga0157377_10128535 3300014745 Unclassified 1544
342 Ga0157379_10004575 3300014968 Bacteria 11868
343 Ga0157379_10027911 3300014968 Bacteria 5024
344 Ga0157379_10041419 3300014968 Unclassified 4111
345 Ga0157379_10123321 3300014968 Bacteria 2332
346 Ga0157379_10127079 3300014968 Bacteria 2294
347 Ga0157379_10132595 3300014968 Bacteria 2243
348 Ga0157376_10012369 3300014969 Bacteria 6333
349 Ga0157376_10023732 3300014969 Bacteria 4805
350 Ga0157376_10126634 3300014969 Bacteria 2273
351 Ga0157376_10169831 3300014969 Unclassified 1985
352 Ga0157376_10187915 3300014969 Bacteria 1892
353 Ga0157376_10372525 3300014969 Bacteria 1373
354 Ga0163161_10019000 3300017792 Bacteria 4817
355 Ga0213875_10004960 3300021388 Bacteria 7217
356 Ga0213875_10023817 3300021388 Bacteria 2922
357 Ga0207688_10008098 3300025901 Bacteria 5714
358 Ga0207680_10006926 3300025903 Bacteria 5498
359 Ga0207645_10050345 3300025907 Unclassified 2659
360 Ga0207643_10001140 3300025908 Bacteria 15778
361 Ga0207643_10005383 3300025908 Bacteria 6850
362 Ga0207654_10020551 3300025911 Bacteria 3501
363 Ga0207654_10087082 3300025911 Bacteria 1894
364 Ga0207654_10102702 3300025911 Unclassified 1764
365 Ga0207654_10112218 3300025911 Unclassified 1698
366 Ga0207654_10168373 3300025911 Bacteria 1421
367 Ga0207654_10228496 3300025911 Bacteria 1238
368 Ga0207707_10001595 3300025912 Bacteria 20890
369 Ga0207707_10122710 3300025912 Unclassified 2272
370 Ga0207707_10129629 3300025912 Bacteria 2206
371 Ga0207695_10000264 3300025913 Bacteria 132624
372 Ga0207695_10001887 3300025913 Bacteria 32776
373 Ga0207695_10245361 3300025913 Bacteria 1691
374 Ga0207671_10009995 3300025914 Bacteria 7881
375 Ga0207671_10063429 3300025914 Bacteria 2746
376 Ga0207663_10027926 3300025916 Bacteria 3296
377 Ga0207663_10192442 3300025916 Unclassified 1465
378 Ga0207663_10206567 3300025916 Bacteria 1420
379 Ga0207660_10262684 3300025917 Unclassified 1366
380 Ga0207652_10128667 3300025921 Bacteria 2257
381 Ga0207646_10014767 3300025922 Bacteria 7399
382 Ga0207646_10069347 3300025922 Bacteria 3149
383 Ga0207646_10238189 3300025922 Bacteria 1644
384 Ga0207681_10020299 3300025923 Bacteria 4207
385 Ga0207681_10101321 3300025923 Bacteria 2077
386 Ga0207694_10000543 3300025924 Bacteria 34172
387 Ga0207694_10003533 3300025924 Bacteria 12412
388 Ga0207694_10029404 3300025924 Bacteria 4193
389 Ga0207694_10034081 3300025924 Bacteria 3903
390 Ga0207694_10040090 3300025924 Bacteria 3605
391 Ga0207694_10056795 3300025924 Bacteria 3041
392 Ga0207694_10084268 3300025924 Bacteria 2500
393 Ga0207694_10156788 3300025924 Bacteria 1837
394 Ga0207687_10001450 3300025927 Bacteria 16255
395 Ga0207687_10002091 3300025927 Bacteria 13639
396 Ga0207687_10002790 3300025927 Bacteria 11846
397 Ga0207687_10003331 3300025927 Bacteria 10852
398 Ga0207687_10004354 3300025927 Bacteria 9444
399 Ga0207687_10006180 3300025927 Bacteria 7928
400 Ga0207687_10014097 3300025927 Bacteria 5227
401 Ga0207687_10035723 3300025927 Bacteria 3382
402 Ga0207687_10046734 3300025927 Unclassified 2998
403 Ga0207687_10201931 3300025927 Bacteria 1554
404 Ga0207687_10216967 3300025927 Unclassified 1504
405 Ga0207687_10218825 3300025927 Bacteria 1498
406 Ga0207700_10040590 3300025928 Bacteria 3398
407 Ga0207700_10138988 3300025928 Bacteria 1993
408 Ga0207700_10280327 3300025928 Bacteria 1434
409 Ga0207644_10072102 3300025931 Bacteria 2529
410 Ga0207690_10088092 3300025932 Bacteria 2186
411 Ga0207690_10091548 3300025932 Bacteria 2150
412 Ga0207706_10317919 3300025933 Archaea 1355
413 Ga0207686_10006097 3300025934 Bacteria 6475
414 Ga0207686_10036292 3300025934 Bacteria 2966
415 Ga0207686_10042104 3300025934 Bacteria 2789
416 Ga0207686_10047781 3300025934 Bacteria 2648
417 Ga0207686_10101020 3300025934 Unclassified 1926
418 Ga0207686_10140739 3300025934 Unclassified 1667
419 Ga0207686_10143733 3300025934 Bacteria 1652
420 Ga0207686_10238799 3300025934 Bacteria 1321
421 Ga0207686_10245839 3300025934 Unclassified 1304
422 Ga0207709_10041032 3300025935 Bacteria 2775
423 Ga0207709_10052733 3300025935 Bacteria 2500
424 Ga0207670_10142825 3300025936 Bacteria 1767
425 Ga0207669_10172148 3300025937 Archaea 1542
426 Ga0207704_10040319 3300025938 Bacteria 2728
427 Ga0207704_10046165 3300025938 Bacteria 2594
428 Ga0207704_10253849 3300025938 Bacteria 1322
429 Ga0207665_10063292 3300025939 Bacteria 2512
430 Ga0207691_10053868 3300025940 Unclassified 3671
431 Ga0207691_10348811 3300025940 Bacteria 1266
432 Ga0207711_10001193 3300025941 Bacteria 24619
433 Ga0207711_10001572 3300025941 Bacteria 21103
434 Ga0207711_10034150 3300025941 Bacteria 4308
435 Ga0207711_10039951 3300025941 Unclassified 3990
436 Ga0207711_10044072 3300025941 Bacteria 3807
437 Ga0207711_10102493 3300025941 Unclassified 2533
438 Ga0207711_10111123 3300025941 Bacteria 2437
439 Ga0207711_10315854 3300025941 Unclassified 1443
440 Ga0207689_10152969 3300025942 Bacteria 1902
441 Ga0207689_10164903 3300025942 Viruses 1826
442 Ga0207661_10007754 3300025944 Bacteria 7643
443 Ga0207661_10011574 3300025944 Bacteria 6399
444 Ga0207661_10019028 3300025944 Bacteria 5111
445 Ga0207661_10037089 3300025944 Bacteria 3810
446 Ga0207661_10071886 3300025944 Bacteria 2829
447 Ga0207661_10083401 3300025944 Bacteria 2645
448 Ga0207661_10312078 3300025944 Bacteria 1412
449 Ga0207661_10338904 3300025944 Bacteria 1354
450 Ga0207679_10002776 3300025945 Bacteria 10846
451 Ga0207679_10021329 3300025945 Bacteria 4391
452 Ga0207679_10196067 3300025945 Bacteria 1683
453 Ga0207679_10348929 3300025945 Bacteria 1289
454 Ga0207667_10000179 3300025949 Bacteria 92219
455 Ga0207667_10007915 3300025949 Bacteria 12692
456 Ga0207667_10021429 3300025949 Bacteria 7161
457 Ga0207667_10242595 3300025949 Bacteria 1844
458 Ga0207651_10154874 3300025960 Bacteria 1789
459 Ga0207712_10020853 3300025961 Bacteria 4298
460 Ga0207658_10034150 3300025986 Unclassified 3633
461 Ga0207677_10040257 3300026023 Unclassified 3080
462 Ga0207677_10083914 3300026023 Unclassified 2295
463 Ga0207703_10001639 3300026035 Bacteria 20169
464 Ga0207703_10003230 3300026035 Bacteria 13705
465 Ga0207703_10008595 3300026035 Bacteria 8059
466 Ga0207703_10011769 3300026035 Bacteria 6808
467 Ga0207703_10102703 3300026035 Unclassified 2426
468 Ga0207639_10030808 3300026041 Unclassified 3937
469 Ga0207639_10141094 3300026041 Unclassified 2007
470 Ga0207639_10395046 3300026041 Bacteria 1245
471 Ga0207708_10108867 3300026075 Bacteria 2149
472 Ga0207702_10007999 3300026078 Bacteria 8957
473 Ga0207702_10063570 3300026078 Bacteria 3156
474 Ga0207702_10537753 3300026078 Unclassified 1142
475 Ga0207641_10072447 3300026088 Bacteria 2967
476 Ga0207641_10153237 3300026088 Bacteria 2089
477 Ga0207648_10109091 3300026089 Bacteria 2429
478 Ga0207676_10217389 3300026095 Bacteria 1700
479 Ga0207674_10000936 3300026116 Bacteria 38032
480 Ga0207674_10001750 3300026116 Bacteria 27772
481 Ga0207674_10009661 3300026116 Bacteria 10999
482 Ga0207674_10041257 3300026116 Bacteria 4774
483 Ga0207674_10069683 3300026116 Bacteria 3537
484 Ga0207675_100049989 3300026118 Bacteria 3902
485 Ga0207675_100154298 3300026118 Bacteria 2187
486 Ga0207683_10051078 3300026121 Unclassified 3622
487 Ga0207683_10082749 3300026121 Bacteria 2852
488 Ga0207683_10237592 3300026121 Bacteria 1662
489 Ga0207698_10132695 3300026142 Bacteria 2131
490 Ga0207698_10163131 3300026142 Bacteria 1952
491 Ga0207428_10180375 3300027907 Bacteria 1596
492 Ga0268266_10068924 3300028379 Unclassified 3064
493 Ga0268266_10082100 3300028379 Bacteria 2811
494 Ga0268265_10008539 3300028380 Bacteria 6924
495 Ga0268264_10002722 3300028381 Bacteria 15423
496 Ga0268264_10007474 3300028381 Bacteria 9117
497 Ga0268264_10018759 3300028381 Bacteria 5656
498 Ga0268264_10048383 3300028381 Unclassified 3538
499 Ga0265338_10188551 3300028800 Unclassified 1565
500 Ga0265329_10039226 3300031242 Unclassified 1523
501 Ga0265313_10002209 3300031595 Bacteria 17167
502 Ga0265313_10031716 3300031595 Unclassified 2706
503 Ga0265314_10002944 3300031711 Bacteria 16867
504 Ga0265342_10052496 3300031712 Bacteria 2430
505 Ga0373928_0000935 3300035084 Bacteria 5736
506 Ga0373929_0003151 3300035085 Bacteria 2997
507 Ga0373934_0014276 3300035086 Bacteria 3010
508 Ga0373934_0040431 3300035086 Bacteria 1839
509 Ga0373940_0002103 3300035088 Bacteria 3792
510 Ga0373949_0002897 3300035090 Bacteria 4229
511 Ga0373951_0002668 3300035091 Bacteria 4472
512 Ga0373952_0005201 3300035092 Bacteria 2372
513 Ga0373932_0003965 3300035112 Bacteria 3526
514 Ga0373932_0004096 3300035112 Bacteria 3465
515 Ga0373941_0000531 3300035115 Bacteria 7609
516 Ga0373953_0007677 3300035117 Bacteria 3624
517 Ga0373954_0001468 3300035118 Bacteria 9590
518 Ga0373954_0009440 3300035118 Bacteria 4291
519 Ga0373956_0055240 3300035119 Bacteria 1791
520 Ga0373956_0070519 3300035119 Bacteria 1594
521 Ga0373957_0027083 3300035120 Bacteria 2080
522 Ga0373960_0002887 3300035121 Bacteria 3888
523 Ga0373955_0029084 3300035172 Bacteria 2871
524 Ga0373955_0120453 3300035172 Unclassified 1525
525 Ga0373942_0000670 3300035207 Bacteria 9564
526 Ga0373961_0008130 3300035241 Bacteria 2549
527 Ga0373962_0007069 3300035242 Bacteria 2742
528 Ga0373931_0016844 3300035691 Bacteria 3604
529 Ga0373931_0026628 3300035691 Unclassified 2945
530 Ga0373933_0102508 3300035724 Bacteria 1777
531 Ga0373933_0152548 3300035724 Unclassified 1464
532 Ga0373947_0005837 3300035725 Bacteria 7175
533 Ga0373947_0043779 3300035725 Bacteria 2674
534 Ga0373937_0001967 3300036401 Bacteria 17189
535 Ga0373937_0013634 3300036401 Bacteria 7162
536 Ga0373937_0042200 3300036401 Unclassified 4161
537 Ga0373937_0115222 3300036401 Bacteria 2502
538 Ga0373937_0127084 3300036401 Bacteria 2379
539 Ga0373937_0132092 3300036401 Bacteria 2332
540 Ga0373925_0011550 3300037068 Bacteria 6389
541 Ga0373925_0036130 3300037068 Bacteria 3647
542 Ga0373925_0038437 3300037068 Unclassified 3539
543 Ga0373925_0083040 3300037068 Bacteria 2439
544 Ga0373925_0114129 3300037068 Bacteria 2090
545 Ga0373925_0140341 3300037068 Unclassified 1891
546 Ga0436364_0286009 3300037853 Bacteria 1829
547 Ga0436364_1028936 3300037853 Bacteria 9270
548 Ga0436364_1376276 3300037853 Bacteria 1916
549 Ga0436364_1522164 3300037853 Unclassified 3967
550 Ga0436365_0680835 3300039437 Bacteria 5807
551 Ga0436365_0710837 3300039437 Bacteria 3297
552 Ga0436365_1657554 3300039437 Bacteria 6482
553 Ga0495592_0033274 3300046454 Unclassified 3889
554 Ga0495580_0014672 3300046472 Bacteria 5938
555 Ga0495580_0068099 3300046472 Unclassified 2490
556 Ga0495580_0215116 3300046472 Unclassified 1322
557 Ga0495580_0262228 3300046472 Bacteria 1182
558 Ga0495582_0003304 3300046473 Bacteria 9064
559 Ga0495639_0014448 3300046475 Bacteria 3419
560 Ga0495652_0127567 3300046529 Unclassified 2019
561 Ga0495665_0007263 3300046531 Bacteria 5980
562 Ga0495586_0013392 3300046535 Unclassified 4348
563 Ga0495587_0006318 3300046536 Bacteria 7728
564 Ga0495587_0012167 3300046536 Bacteria 5433
565 Ga0495587_0080860 3300046536 Bacteria 1883
566 Ga0495598_0033802 3300046537 Unclassified 1454
567 Ga0495667_0061359 3300046559 Bacteria 2465
568 Ga0495667_0108586 3300046559 Bacteria 1793
569 Ga0495635_0224383 3300046663 Unclassified 1270
570 Ga0495613_0102353 3300046689 Unclassified 2068
571 Ga0495600_0127317 3300046809 Unclassified 1656
572 Ga0495581_0220491 3300047315 Bacteria 1109
573 Ga0495636_0022329 3300047318 Bacteria 2557
574 Ga0495674_0027127 3300047319 Bacteria 5238
575 Ga0495674_0289422 3300047319 Unclassified 1340
576 Ga0495675_0191561 3300047444 Unclassified 1248
577 Ga0495684_0023923 3300047471 Bacteria 4698
578 Ga0495684_0068612 3300047471 Bacteria 2696
579 Ga0495684_0127549 3300047471 Bacteria 1913
580 Ga0495602_0002316 3300048088 Bacteria 19251
581 Ga0496102_0275478 3300048905 Unclassified 1586
582 Ga0496104_0058162 3300048907 Unclassified 3659
583 Ga0496106_0046634 3300048909 Bacteria 3259
584 Ga0496106_0236345 3300048909 Bacteria 1460
585 Ga0496114_0106703 3300048917 Bacteria 2397
586 Ga0496115_0187644 3300048918 Unclassified 1708
587 Ga0501038_0073495 3300049574 Bacteria 2895
588 Ga0501039_0162731 3300049575 Bacteria 1754
589 Ga0501040_0046909 3300049576 Bacteria 2949
590 Ga0501041_0022776 3300049577 Bacteria 3753
591 Ga0501042_0013022 3300049578 Bacteria 5652
592 Ga0501046_0008632 3300049580 Bacteria 8862
593 Ga0501072_0132589 3300049588 Bacteria 1986
594 Ga0501075_0031276 3300049591 Bacteria 3949
595 Ga0501077_0036847 3300049593 Bacteria 3116
596 Ga0501081_0001406 3300049743 Bacteria 14696
597 Ga0501045_0125919 3300049824 Bacteria 1903
598 nmdc:mga05p37_143631_c1 3300050507 Bacteria 2923
599 nmdc:mga05p37_21371_c1 3300050507 Bacteria 7837
600 nmdc:mga05p37_369548_c1 3300050507 Bacteria 1684
601 nmdc:mga05p37_40237_c1 3300050507 Bacteria 5740
602 nmdc:mga05p37_493664_c1 3300050507 Bacteria 1407
603 nmdc:mga05p37_678499_c1 3300050507 Unclassified 1149
604 nmdc:mga05p37_79919_c1 3300050507 Bacteria 4027
605 nmdc:mga05p37_8156_c1 3300050507 Bacteria 11741
606 nmdc:mga05p37_88800_c1 3300050507 Unclassified 3810
607 nmdc:mga05p37_98708_c1 3300050507 Unclassified 3597
608 nmdc:mga09592_1365_c1 3300050508 Bacteria 19537
609 nmdc:mga09592_164810_c1 3300050508 Unclassified 1915
610 nmdc:mga09592_287009_c1 3300050508 Bacteria 1427
611 nmdc:mga09592_324594_c1 3300050508 Unclassified 1333
612 nmdc:mga09592_62228_c1 3300050508 Unclassified 3157
613 nmdc:mga0qj67_14083_c1 3300050509 Bacteria 6039
614 nmdc:mga06r32_16630_c1 3300050510 Bacteria 6705
615 nmdc:mga06r32_72792_c1 3300050510 Bacteria 3327
616 nmdc:mga08y16_134345_c1 3300050511 Bacteria 2571
617 nmdc:mga08y16_29344_c1 3300050511 Bacteria 5795
618 nmdc:mga0n895_13118_c1 3300050512 Bacteria 7458
619 nmdc:mga0n895_1364_c1 3300050512 Bacteria 18165
620 nmdc:mga0n895_150_c1 3300050512 Bacteria 42831
621 nmdc:mga0n895_164490_c1 3300050512 Bacteria 2250
622 nmdc:mga0n895_244232_c1 3300050512 Bacteria 1822
623 nmdc:mga0n895_448770_c1 3300050512 Bacteria 1302
624 nmdc:mga0n895_558901_c1 3300050512 Unclassified 1150
625 nmdc:mga0n895_60385_c1 3300050512 Bacteria 3741
626 nmdc:mga0n895_7218_c1 3300050512 Bacteria 9512
627 nmdc:mga0n895_78_c1 3300050512 Bacteria 55918
628 nmdc:mga0n895_87086_c1 3300050512 Unclassified 3120
629 nmdc:mga0rr50_18_c1 3300050513 Bacteria 166751
630 nmdc:mga0rr50_231881_c1 3300050513 Bacteria 1528
631 nmdc:mga0rr50_533_c1 3300050513 Bacteria 20360
632 nmdc:mga0rr50_6_c1 3300050513 Bacteria 310626
633 nmdc:mga08x19_166_c1 3300050514 Bacteria 54784
634 nmdc:mga08x19_301662_c1 3300050514 Bacteria 1113
635 nmdc:mga08x19_331_c1 3300050514 Bacteria 34130
636 nmdc:mga08x19_347349_c1 3300050514 Bacteria 1035
637 nmdc:mga0a205_126720_c1 3300050515 Bacteria 2453
638 nmdc:mga0a205_1308_c1 3300050515 Bacteria 20935
639 nmdc:mga0a205_13420_c1 3300050515 Bacteria 7628
640 nmdc:mga0a205_166_c1 3300050515 Bacteria 44087
641 nmdc:mga0a205_28244_c1 3300050515 Bacteria 5363
642 nmdc:mga0a205_301795_c1 3300050515 Bacteria 1474
643 nmdc:mga0a205_75044_c1 3300050515 Bacteria 3267
644 Ga0495619_0111368 3300053085 Unclassified 1871
645 Ga0501084_0025006 3300054114 Bacteria 4983
646 Ga0501082_0004297 3300060353 Bacteria 12453
647 Ga0530510_0003203 3300061734 Bacteria 11244
648 Ga0105245_10166506
649 JGI24746J21847_1001553
650 Ga0065712_10003266
651 Ga0065712_10101341
652 Ga0070683_100002302
653 Ga0070683_100005826
654 Ga0070683_100018326
655 Ga0070683_100043102
656 Ga0070683_100090881
657 Ga0070683_100118506
658 Ga0070683_100127642
659 Ga0070690_100116003
660 Ga0070670_100020220
661 Ga0068869_100040783
662 Ga0068869_100049516
663 Ga0068869_100062854
664 Ga0068869_100118472
665 Ga0070666_10001781
666 Ga0070666_10003591
667 Ga0070666_10005922
668 Ga0070666_10018601
669 Ga0070680_100007854
670 Ga0070680_100212862
671 Ga0068868_100026444
672 Ga0068868_100041365
673 Ga0070689_100096979
674 Ga0070689_100121627
675 Ga0070691_10000407
676 Ga0070687_100058908
677 Ga0070661_100078569
678 Ga0070669_100072762
679 Ga0070669_100102538
680 Ga0070671_100056231
681 Ga0070674_100023363
682 Ga0070674_100213401
683 Ga0070673_100034282
684 Ga0070673_100139497
685 Ga0070688_100081582
686 Ga0070659_100124752
687 Ga0070659_100235725
688 Ga0070667_100015626
689 Ga0070667_100048245
690 Ga0070709_10093216
691 Ga0070709_10180557
692 Ga0070713_100033271
693 Ga0070713_100036847
694 Ga0070710_10179634
695 Ga0070711_100086356
696 Ga0070711_100180430
697 Ga0070711_100364293
698 Ga0070705_100080163
699 Ga0070700_100055848
700 Ga0070694_100007649
701 Ga0070708_100113291
702 Ga0070678_100063914
703 Ga0070662_100119404
704 Ga0070681_10002794
705 Ga0070681_10009422
706 Ga0070681_10068779
707 Ga0068867_100012310
708 Ga0070707_100098032
709 Ga0070707_100369765
710 Ga0070707_100479119
711 Ga0070707_100527344
712 Ga0070698_100007526
713 Ga0070698_100322688
714 Ga0070699_100001327
715 Ga0070699_100011374
716 Ga0070679_100001436
717 Ga0070684_100001444
718 Ga0070684_100059520
719 Ga0070684_100071600
720 Ga0070684_100254696
721 Ga0070684_100451400
722 Ga0070697_100193798
723 Ga0070697_100235735
724 Ga0068853_100008049
725 Ga0068853_100051401
726 Ga0068853_100342634
727 Ga0068853_100372086
728 Ga0070672_100169853
729 Ga0070672_100258603
730 Ga0070686_100011511
731 Ga0070686_100012275
732 Ga0070695_100022986
733 Ga0070696_100012651
734 Ga0070696_100264480
735 Ga0070693_100050559
736 Ga0070693_100065392
737 Ga0070665_100185943
738 Ga0070704_100015627
739 Ga0068855_100001065
740 Ga0068855_100034324
741 Ga0068855_100067273
742 Ga0070664_100003680
743 Ga0070664_100244727
744 Ga0070664_100264171
745 Ga0068857_100000903
746 Ga0068857_100004125
747 Ga0068857_100010724
748 Ga0068857_100012375
749 Ga0068857_100014877
750 Ga0068854_100076308
751 Ga0068856_100001622
752 Ga0068856_100002791
753 Ga0068856_100013424
754 Ga0068856_100120194
755 Ga0068856_100203481
756 Ga0068852_100342828
757 Ga0068859_100024192
758 Ga0068859_100184777
759 Ga0068859_100381887
760 Ga0068864_100308251
761 Ga0068870_10008486
762 Ga0068870_10204041
763 Ga0068863_100004609
764 Ga0068863_100037712
765 Ga0068863_100237224
766 Ga0068858_100000554
767 Ga0068858_100001731
768 Ga0068858_100004180
769 Ga0068858_100012658
770 Ga0068858_100014257
771 Ga0068858_100094275
772 Ga0068858_100155058
773 Ga0068858_100228660
774 Ga0068860_100001037
775 Ga0068860_100013005
776 Ga0068860_100067812
777 Ga0068862_100003259
778 Ga0070717_10003083
779 Ga0070717_10013684
780 Ga0070712_100195853
781 Ga0097621_100002394
782 Ga0097621_100008308
783 Ga0097621_100008499
784 Ga0097621_100016976
785 Ga0097621_100017580
786 Ga0097621_100022774
787 Ga0097621_100023007
788 Ga0097621_100026672
789 Ga0097621_100069625
790 Ga0097621_100080345
791 Ga0097621_100097164
792 Ga0097621_100115061
793 Ga0097621_100136766
794 Ga0097621_100253256
795 Ga0097621_100277446
796 Ga0097621_100291697
797 Ga0068871_100000701
798 Ga0068871_100001582
799 Ga0068871_100003721
800 Ga0068871_100008603
801 Ga0068871_100014882
802 Ga0068871_100019835
803 Ga0068871_100023708
804 Ga0068871_100056409
805 Ga0068871_100084429
806 Ga0068871_100094363
807 Ga0068871_100116917
808 Ga0068871_100141603
809 Ga0068871_100243152
810 Ga0068871_100387837
811 Ga0075428_100004765
812 Ga0075428_100073157
813 Ga0075428_100174782
814 Ga0075430_100001904
815 Ga0075431_100001226
816 Ga0075431_100068867
817 Ga0075433_10001097
818 Ga0075433_10001598
819 Ga0075433_10005044
820 Ga0075433_10016580
821 Ga0075433_10050173
822 Ga0075433_10072019
823 Ga0075434_100000153
824 Ga0075434_100000546
825 Ga0075434_100000681
826 Ga0075434_100004277
827 Ga0075434_100016203
828 Ga0075434_100026842
829 Ga0075434_100026927
830 Ga0075434_100051592
831 Ga0075434_100098415
832 Ga0075434_100571040
833 Ga0075429_100066643
834 Ga0068865_100033828
835 Ga0068865_100093609
836 Ga0075436_100002345
837 Ga0075436_100009413
838 Ga0075436_100028710
839 Ga0075436_100085440
840 Ga0075436_100266458
841 Ga0097620_100024192
842 Ga0097620_100184761
843 Ga0097620_100281287
844 Ga0097620_100381866
845 Ga0075435_100000010
846 Ga0075435_100000277
847 Ga0075435_100000499
848 Ga0075435_100012880
849 Ga0075435_100045490
850 Ga0075435_100062642
851 Ga0075435_100067954
852 Ga0075435_100115707
853 Ga0075435_100243666
854 Ga0105240_10001454
855 Ga0105240_10012792
856 Ga0105240_10145716
857 Ga0105240_10150063
858 Ga0105240_10173215
859 Ga0105240_10242479
860 Ga0111539_10104445
861 Ga0105245_10000711
862 Ga0105245_10002099
863 Ga0105245_10002352
864 Ga0105245_10002809
865 Ga0105245_10007120
866 Ga0105245_10015777
867 Ga0105245_10022643
868 Ga0105245_10027454
869 Ga0105245_10039300
870 Ga0105245_10172725
871 Ga0105245_10234282
872 Ga0105245_10326756
873 Ga0105245_10411272
874 Ga0105245_10596764
875 Ga0105247_10018337
876 Ga0105247_10058712
877 Ga0114129_10010949
878 Ga0114129_10034603
879 Ga0114129_10048933
880 Ga0114129_10049981
881 Ga0114129_10058330
882 Ga0114129_10065181
883 Ga0114129_10071490
884 Ga0114129_10130238
885 Ga0114129_10132866
886 Ga0114129_10213589
887 Ga0114129_10224826
888 Ga0114129_10267789
889 Ga0105243_10056497
890 Ga0105243_10106665
891 Ga0105243_10178578
892 Ga0105241_10000146
893 Ga0105241_10013189
894 Ga0105241_10018225
895 Ga0105241_10044747
896 Ga0105241_10073641
897 Ga0105241_10084554
898 Ga0105241_10089327
899 Ga0105241_10154819
900 Ga0105241_10155587
901 Ga0105241_10231331
902 Ga0105242_10007682
903 Ga0105242_10027778
904 Ga0105242_10032670
905 Ga0105242_10048545
906 Ga0105242_10067775
907 Ga0105242_10091658
908 Ga0105242_10219536
909 Ga0105242_10330371
910 Ga0105242_10337064
911 Ga0105248_10018915
912 Ga0105248_10030676
913 Ga0105248_10032047
914 Ga0105248_10056231
915 Ga0105248_10069285
916 Ga0105248_10070483
917 Ga0105248_10105267
918 Ga0105248_10114048
919 Ga0105248_10124306
920 Ga0105248_10181222
921 Ga0105248_10232706
922 Ga0105248_10265620
923 Ga0105248_10356017
924 Ga0105248_10369994
925 Ga0105237_10005425
926 Ga0105237_10014118
927 Ga0105237_10017935
928 Ga0105237_10043588
929 Ga0105237_10071421
930 Ga0105237_10543336
931 Ga0105238_10001473
932 Ga0105238_10004407
933 Ga0105238_10006059
934 Ga0105238_10006886
935 Ga0105238_10051477
936 Ga0105238_10312701
937 Ga0105249_10029916
938 Ga0105249_10088091
939 Ga0105239_10002755
940 Ga0105239_10021904
941 Ga0105239_10026142
942 Ga0105239_10047072
943 Ga0105239_10151927
944 Ga0105239_10225485
945 Ga0105239_10288709
946 Ga0105246_10003450
947 Ga0105246_10019967
948 Ga0105246_10030745
949 Ga0105246_10030998
950 Ga0157373_10216946
951 Ga0157371_10279494
952 Ga0157370_10001333
953 Ga0157370_10007211
954 Ga0157369_10008658
955 Ga0157369_10031992
956 Ga0157369_10061703
957 Ga0157369_10161491
958 Ga0157374_10080977
959 Ga0157374_10194770
960 Ga0157378_10001710
961 Ga0157378_10006868
962 Ga0157378_10011975
963 Ga0157378_10057904
964 Ga0157378_10063464
965 Ga0163162_10001375
966 Ga0163162_10018013
967 Ga0163162_10039235
968 Ga0163162_10084136
969 Ga0157372_10002867
970 Ga0157372_10026591
971 Ga0157372_10142454
972 Ga0157372_10144576
973 Ga0157372_10153587
974 Ga0157372_10483382
975 Ga0157375_10003915
976 Ga0157375_10004664
977 Ga0157375_10075935
978 Ga0157375_10108632
979 Ga0157375_10215256
980 Ga0163163_10011975
981 Ga0163163_10021305
982 Ga0163163_10035606
983 Ga0163163_10047029
984 Ga0163163_10064704
985 Ga0163163_10073066
986 Ga0163163_10087886
987 Ga0163163_10346527
988 Ga0157377_10128535
989 Ga0157379_10004575
990 Ga0157379_10027911
991 Ga0157379_10041419
992 Ga0157379_10123321
993 Ga0157379_10127079
994 Ga0157379_10132595
995 Ga0157376_10012369
996 Ga0157376_10023732
997 Ga0157376_10126634
998 Ga0157376_10169831
999 Ga0157376_10187915
1000 Ga0157376_10372525
1001 Ga0163161_10019000
1002 Ga0213875_10004960
1003 Ga0213875_10023817
1004 Ga0207688_10008098
1005 Ga0207680_10006926
1006 Ga0207645_10050345
1007 Ga0207643_10001140
1008 Ga0207643_10005383
1009 Ga0207654_10020551
1010 Ga0207654_10087082
1011 Ga0207654_10102702
1012 Ga0207654_10112218
1013 Ga0207654_10168373
1014 Ga0207654_10228496
1015 Ga0207707_10001595
1016 Ga0207707_10122710
1017 Ga0207707_10129629
1018 Ga0207695_10000264
1019 Ga0207695_10001887
1020 Ga0207695_10245361
1021 Ga0207671_10009995
1022 Ga0207671_10063429
1023 Ga0207663_10027926
1024 Ga0207663_10192442
1025 Ga0207663_10206567
1026 Ga0207660_10262684
1027 Ga0207652_10128667
1028 Ga0207646_10014767
1029 Ga0207646_10069347
1030 Ga0207646_10238189
1031 Ga0207681_10020299
1032 Ga0207681_10101321
1033 Ga0207694_10000543
1034 Ga0207694_10003533
1035 Ga0207694_10029404
1036 Ga0207694_10034081
1037 Ga0207694_10040090
1038 Ga0207694_10056795
1039 Ga0207694_10084268
1040 Ga0207694_10156788
1041 Ga0207687_10001450
1042 Ga0207687_10002091
1043 Ga0207687_10002790
1044 Ga0207687_10003331
1045 Ga0207687_10004354
1046 Ga0207687_10006180
1047 Ga0207687_10014097
1048 Ga0207687_10035723
1049 Ga0207687_10046734
1050 Ga0207687_10201931
1051 Ga0207687_10216967
1052 Ga0207687_10218825
1053 Ga0207700_10040590
1054 Ga0207700_10138988
1055 Ga0207700_10280327
1056 Ga0207644_10072102
1057 Ga0207690_10088092
1058 Ga0207690_10091548
1059 Ga0207706_10317919
1060 Ga0207686_10006097
1061 Ga0207686_10036292
1062 Ga0207686_10042104
1063 Ga0207686_10047781
1064 Ga0207686_10101020
1065 Ga0207686_10140739
1066 Ga0207686_10143733
1067 Ga0207686_10238799
1068 Ga0207686_10245839
1069 Ga0207709_10041032
1070 Ga0207709_10052733
1071 Ga0207670_10142825
1072 Ga0207669_10172148
1073 Ga0207704_10040319
1074 Ga0207704_10046165
1075 Ga0207704_10253849
1076 Ga0207665_10063292
1077 Ga0207691_10053868
1078 Ga0207691_10348811
1079 Ga0207711_10001193
1080 Ga0207711_10001572
1081 Ga0207711_10034150
1082 Ga0207711_10039951
1083 Ga0207711_10044072
1084 Ga0207711_10102493
1085 Ga0207711_10111123
1086 Ga0207711_10315854
1087 Ga0207689_10152969
1088 Ga0207689_10164903
1089 Ga0207661_10007754
1090 Ga0207661_10011574
1091 Ga0207661_10019028
1092 Ga0207661_10037089
1093 Ga0207661_10071886
1094 Ga0207661_10083401
1095 Ga0207661_10312078
1096 Ga0207661_10338904
1097 Ga0207679_10002776
1098 Ga0207679_10021329
1099 Ga0207679_10196067
1100 Ga0207679_10348929
1101 Ga0207667_10000179
1102 Ga0207667_10007915
1103 Ga0207667_10021429
1104 Ga0207667_10242595
1105 Ga0207651_10154874
1106 Ga0207712_10020853
1107 Ga0207658_10034150
1108 Ga0207677_10040257
1109 Ga0207677_10083914
1110 Ga0207703_10001639
1111 Ga0207703_10003230
1112 Ga0207703_10008595
1113 Ga0207703_10011769
1114 Ga0207703_10102703
1115 Ga0207639_10030808
1116 Ga0207639_10141094
1117 Ga0207639_10395046
1118 Ga0207708_10108867
1119 Ga0207702_10007999
1120 Ga0207702_10063570
1121 Ga0207702_10537753
1122 Ga0207641_10072447
1123 Ga0207641_10153237
1124 Ga0207648_10109091
1125 Ga0207676_10217389
1126 Ga0207674_10000936
1127 Ga0207674_10001750
1128 Ga0207674_10009661
1129 Ga0207674_10041257
1130 Ga0207674_10069683
1131 Ga0207675_100049989
1132 Ga0207675_100154298
1133 Ga0207683_10051078
1134 Ga0207683_10082749
1135 Ga0207683_10237592
1136 Ga0207698_10132695
1137 Ga0207698_10163131
1138 Ga0207428_10180375
1139 Ga0268266_10068924
1140 Ga0268266_10082100
1141 Ga0268265_10008539
1142 Ga0268264_10002722
1143 Ga0268264_10007474
1144 Ga0268264_10018759
1145 Ga0268264_10048383
1146 Ga0265338_10188551
1147 Ga0265329_10039226
1148 Ga0265313_10002209
1149 Ga0265313_10031716
1150 Ga0265314_10002944
1151 Ga0265342_10052496
1152 Ga0373928_0000935
1153 Ga0373929_0003151
1154 Ga0373934_0014276
1155 Ga0373934_0040431
1156 Ga0373940_0002103
1157 Ga0373949_0002897
1158 Ga0373951_0002668
1159 Ga0373952_0005201
1160 Ga0373932_0003965
1161 Ga0373932_0004096
1162 Ga0373941_0000531
1163 Ga0373953_0007677
1164 Ga0373954_0001468
1165 Ga0373954_0009440
1166 Ga0373956_0055240
1167 Ga0373956_0070519
1168 Ga0373957_0027083
1169 Ga0373960_0002887
1170 Ga0373955_0029084
1171 Ga0373955_0120453
1172 Ga0373942_0000670
1173 Ga0373961_0008130
1174 Ga0373962_0007069
1175 Ga0373931_0016844
1176 Ga0373931_0026628
1177 Ga0373933_0102508
1178 Ga0373933_0152548
1179 Ga0373947_0005837
1180 Ga0373947_0043779
1181 Ga0373937_0001967
1182 Ga0373937_0013634
1183 Ga0373937_0042200
1184 Ga0373937_0115222
1185 Ga0373937_0127084
1186 Ga0373937_0132092
1187 Ga0373925_0011550
1188 Ga0373925_0036130
1189 Ga0373925_0038437
1190 Ga0373925_0083040
1191 Ga0373925_0114129
1192 Ga0373925_0140341
1193 Ga0436364_0286009
1194 Ga0436364_1028936
1195 Ga0436364_1376276
1196 Ga0436364_1522164
1197 Ga0436365_0680835
1198 Ga0436365_0710837
1199 Ga0436365_1657554
1200 Ga0495592_0033274
1201 Ga0495580_0014672
1202 Ga0495580_0068099
1203 Ga0495580_0215116
1204 Ga0495580_0262228
1205 Ga0495582_0003304
1206 Ga0495639_0014448
1207 Ga0495652_0127567
1208 Ga0495665_0007263
1209 Ga0495586_0013392
1210 Ga0495587_0006318
1211 Ga0495587_0012167
1212 Ga0495587_0080860
1213 Ga0495598_0033802
1214 Ga0495667_0061359
1215 Ga0495667_0108586
1216 Ga0495635_0224383
1217 Ga0495613_0102353
1218 Ga0495600_0127317
1219 Ga0495581_0220491
1220 Ga0495636_0022329
1221 Ga0495674_0027127
1222 Ga0495674_0289422
1223 Ga0495675_0191561
1224 Ga0495684_0023923
1225 Ga0495684_0068612
1226 Ga0495684_0127549
1227 Ga0495602_0002316
1228 Ga0496102_0275478
1229 Ga0496104_0058162
1230 Ga0496106_0046634
1231 Ga0496106_0236345
1232 Ga0496114_0106703
1233 Ga0496115_0187644
1234 Ga0501038_0073495
1235 Ga0501039_0162731
1236 Ga0501040_0046909
1237 Ga0501041_0022776
1238 Ga0501042_0013022
1239 Ga0501046_0008632
1240 Ga0501072_0132589
1241 Ga0501075_0031276
1242 Ga0501077_0036847
1243 Ga0501081_0001406
1244 Ga0501045_0125919
1245 nmdc:mga05p37_143631_c1
1246 nmdc:mga05p37_21371_c1
1247 nmdc:mga05p37_369548_c1
1248 nmdc:mga05p37_40237_c1
1249 nmdc:mga05p37_493664_c1
1250 nmdc:mga05p37_678499_c1
1251 nmdc:mga05p37_79919_c1
1252 nmdc:mga05p37_8156_c1
1253 nmdc:mga05p37_88800_c1
1254 nmdc:mga05p37_98708_c1
1255 nmdc:mga09592_1365_c1
1256 nmdc:mga09592_164810_c1
1257 nmdc:mga09592_287009_c1
1258 nmdc:mga09592_324594_c1
1259 nmdc:mga09592_62228_c1
1260 nmdc:mga0qj67_14083_c1
1261 nmdc:mga06r32_16630_c1
1262 nmdc:mga06r32_72792_c1
1263 nmdc:mga08y16_134345_c1
1264 nmdc:mga08y16_29344_c1
1265 nmdc:mga0n895_13118_c1
1266 nmdc:mga0n895_1364_c1
1267 nmdc:mga0n895_150_c1
1268 nmdc:mga0n895_164490_c1
1269 nmdc:mga0n895_244232_c1
1270 nmdc:mga0n895_448770_c1
1271 nmdc:mga0n895_558901_c1
1272 nmdc:mga0n895_60385_c1
1273 nmdc:mga0n895_7218_c1
1274 nmdc:mga0n895_78_c1
1275 nmdc:mga0n895_87086_c1
1276 nmdc:mga0rr50_18_c1
1277 nmdc:mga0rr50_231881_c1
1278 nmdc:mga0rr50_533_c1
1279 nmdc:mga0rr50_6_c1
1280 nmdc:mga08x19_166_c1
1281 nmdc:mga08x19_301662_c1
1282 nmdc:mga08x19_331_c1
1283 nmdc:mga08x19_347349_c1
1284 nmdc:mga0a205_126720_c1
1285 nmdc:mga0a205_1308_c1
1286 nmdc:mga0a205_13420_c1
1287 nmdc:mga0a205_166_c1
1288 nmdc:mga0a205_28244_c1
1289 nmdc:mga0a205_301795_c1
1290 nmdc:mga0a205_75044_c1
1291 Ga0495619_0111368
1292 Ga0501084_0025006
1293 Ga0501082_0004297
1294 Ga0530510_0003203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.7646 171 216
3kvu-assembly1.cif.gz_A structural basis of the activity and substrate specificity of the fluoroacetyl-coa flk - t42s mutant in complex with acetyl-coa 0.7032 171 214
1zhg-assembly1.cif.gz_B crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum 0.6765 171 210
8ceo-assembly1.cif.gz_d yeast rna polymerase ii transcription pre-initiation complex with core mediator and the +1 nucleosome 0.6665 146 217
5buw-assembly1.cif.gz_A crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from yersinia pestis 0.6665 171 210
ID Description Score Start End Superfamily
5iw9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7592 173 210 3.10.450.40
2essA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6982 166 210 3.10.129.10
af_P04157_888_1201_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6779 171 204 3.90.190.10
af_A0A0R4IZF0_299_399_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.671 183 213 2.60.40.60
3e29D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6545 164 210 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V9CU41-F1-model_v4 Uncharacterized protein 0.963 121 202
AF-A0A2V8N442-F1-model_v4 Uncharacterized protein 0.9609 101 217
AF-A0A2V8KPN4-F1-model_v4 Uncharacterized protein 0.9599 115 212
AF-A0A2V9C7H0-F1-model_v4 Uncharacterized protein 0.9591 135 212
AF-A0A2V8NZG8-F1-model_v4 DUF1579 domain-containing protein 0.9559 117 213

Map