F472225

General Info

Members Datasets Scaffolds Average Seq Length
646 293 646 275

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0212978|Ga0495652_0212978_184_1152
Length 322
Sequence MKGSVDPGELVIKVVRFYDDSWRQLIVDRLARRTAGRAGAVVSSAYVNVSSRFDVAGFGVIVTGGASGLGLAYAEVLAAHGARVTLIDVDADAVAAQASRMQAEGLDVRGAIADVTDHVTLDRAIDDAAGAYGRLDVAFANAGIDPGVGFVGAWAGGERPRVADGALERYADERWSRVIEINLNGIFATTRAAARHMRPRRFGRIIVTTSLAATKVEPAIGAAYMAAKAGARHLMHTVALELATDGITANAIAPGFFVTNIGGGHAHDPAVQAALAKDIPMHRVGVPDDIKALALFLASPASEYITGQEIVIDGGWGLGVAD

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
289 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 6.5
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10012152 3300002239 Bacteria 1295
2 JGI25406J46586_10004166 3300003203 Bacteria 6749
3 rootH1_10148054 3300003323 Bacteria 4672
4 Ga0070683_100047464 3300005329 Bacteria 3968
5 Ga0070683_100058685 3300005329 Bacteria 3575
6 Ga0070683_100243547 3300005329 Bacteria 1710
7 Ga0070683_100567391 3300005329 Bacteria 1085
8 Ga0068869_100302551 3300005334 Bacteria 1292
9 Ga0070666_10001519 3300005335 Bacteria 14089
10 Ga0070680_100003356 3300005336 Bacteria 11950
11 Ga0070680_100051214 3300005336 Bacteria 3369
12 Ga0070682_100109738 3300005337 Bacteria 1837
13 Ga0070682_100164767 3300005337 Bacteria 1534
14 Ga0070682_100284573 3300005337 Bacteria 1206
15 Ga0068868_100006600 3300005338 Bacteria 8225
16 Ga0068868_100014840 3300005338 Bacteria 5751
17 Ga0068868_100095910 3300005338 Bacteria 2395
18 Ga0070689_100025037 3300005340 Bacteria 4481
19 Ga0070689_100064086 3300005340 Bacteria 2860
20 Ga0070691_10032560 3300005341 Bacteria 2450
21 Ga0070661_100027821 3300005344 Bacteria 4074
22 Ga0070661_100056140 3300005344 Bacteria 2884
23 Ga0070692_10004704 3300005345 Bacteria 5722
24 Ga0070668_100075688 3300005347 Bacteria 2628
25 Ga0070669_100157035 3300005353 Bacteria 1765
26 Ga0070669_100293112 3300005353 Bacteria 1307
27 Ga0070675_100011459 3300005354 Bacteria 6942
28 Ga0070671_100029020 3300005355 Bacteria 4560
29 Ga0070671_100070390 3300005355 Unclassified 2918
30 Ga0070674_100050806 3300005356 Bacteria 2855
31 Ga0070673_100125100 3300005364 Bacteria 2150
32 Ga0070673_100412284 3300005364 Bacteria 1210
33 Ga0070688_100369600 3300005365 Bacteria 1055
34 Ga0070659_100028160 3300005366 Bacteria 4336
35 Ga0070659_100054054 3300005366 Bacteria 3162
36 Ga0070659_100080470 3300005366 Bacteria 2601
37 Ga0070659_100157125 3300005366 Bacteria 1857
38 Ga0070667_100001319 3300005367 Bacteria 22289
39 Ga0070667_100221405 3300005367 Bacteria 1685
40 Ga0070714_100022905 3300005435 Bacteria 5125
41 Ga0070714_100101954 3300005435 Unclassified 2530
42 Ga0070714_100158669 3300005435 Bacteria 2045
43 Ga0070713_100010073 3300005436 Bacteria 6816
44 Ga0070713_100021283 3300005436 Bacteria 4986
45 Ga0070713_100292336 3300005436 Bacteria 1498
46 Ga0070701_10007973 3300005438 Bacteria 4556
47 Ga0070711_100064815 3300005439 Bacteria 2554
48 Ga0070711_100144382 3300005439 Bacteria 1788
49 Ga0070711_100333604 3300005439 Bacteria 1215
50 Ga0070700_100152531 3300005441 Bacteria 1582
51 Ga0070663_100053721 3300005455 Bacteria 2877
52 Ga0070663_100096964 3300005455 Bacteria 2194
53 Ga0070662_100023967 3300005457 Bacteria 4199
54 Ga0070662_100030809 3300005457 Bacteria 3758
55 Ga0070681_10002016 3300005458 Bacteria 18381
56 Ga0070681_10016015 3300005458 Bacteria 7474
57 Ga0070681_10030819 3300005458 Bacteria 5383
58 Ga0070681_10109705 3300005458 Unclassified 2699
59 Ga0070681_10124606 3300005458 Bacteria 2509
60 Ga0070681_10507820 3300005458 Bacteria 1119
61 Ga0068867_100024614 3300005459 Bacteria 4314
62 Ga0068867_100119496 3300005459 Bacteria 2035
63 Ga0070685_10218465 3300005466 Bacteria 1248
64 Ga0070679_100007440 3300005530 Bacteria 10235
65 Ga0070679_100053871 3300005530 Bacteria 4005
66 Ga0070679_100081404 3300005530 Bacteria 3227
67 Ga0070679_100093059 3300005530 Bacteria 3002
68 Ga0070679_100120704 3300005530 Unclassified 2606
69 Ga0070679_100231513 3300005530 Bacteria 1807
70 Ga0070679_100406213 3300005530 Bacteria 1308
71 Ga0070684_100040482 3300005535 Bacteria 4013
72 Ga0070684_100052514 3300005535 Bacteria 3545
73 Ga0070684_100084643 3300005535 Bacteria 2811
74 Ga0070684_100111295 3300005535 Bacteria 2456
75 Ga0070684_100273313 3300005535 Bacteria 1547
76 Ga0070684_100363303 3300005535 Bacteria 1332
77 Ga0068853_100014189 3300005539 Bacteria 6523
78 Ga0068853_100300054 3300005539 Bacteria 1485
79 Ga0068853_100405276 3300005539 Unclassified 1277
80 Ga0070672_100205629 3300005543 Bacteria 1647
81 Ga0070686_100017998 3300005544 Bacteria 4139
82 Ga0070696_100265320 3300005546 Bacteria 1304
83 Ga0070693_100138422 3300005547 Bacteria 1529
84 Ga0070665_100004948 3300005548 Bacteria 13813
85 Ga0070665_100006291 3300005548 Bacteria 12128
86 Ga0070665_100083761 3300005548 Bacteria 3194
87 Ga0068855_100011077 3300005563 Bacteria 10882
88 Ga0068855_100057508 3300005563 Bacteria 4558
89 Ga0068855_100086916 3300005563 Bacteria 3614
90 Ga0068855_100180377 3300005563 Bacteria 2388
91 Ga0068855_100658154 3300005563 Bacteria 1124
92 Ga0070664_100084290 3300005564 Bacteria 2743
93 Ga0070664_100091280 3300005564 Bacteria 2636
94 Ga0068857_100104153 3300005577 Bacteria 2547
95 Ga0068857_100139635 3300005577 Bacteria 2190
96 Ga0068854_100091100 3300005578 Bacteria 2268
97 Ga0068854_100095301 3300005578 Bacteria 2221
98 Ga0068856_100064942 3300005614 Bacteria 3606
99 Ga0068856_100088563 3300005614 Bacteria 3078
100 Ga0068856_100157713 3300005614 Bacteria 2279
101 Ga0068856_100158055 3300005614 Bacteria 2277
102 Ga0070702_100017087 3300005615 Bacteria 3735
103 Ga0070702_100115386 3300005615 Bacteria 1673
104 Ga0068852_100000594 3300005616 Bacteria 23810
105 Ga0068852_100038941 3300005616 Bacteria 3999
106 Ga0068852_100069521 3300005616 Bacteria 3087
107 Ga0068859_100021328 3300005617 Bacteria 6500
108 Ga0068859_100101825 3300005617 Bacteria 2929
109 Ga0068859_100105639 3300005617 Unclassified 2875
110 Ga0068864_100066963 3300005618 Unclassified 3118
111 Ga0068864_100224665 3300005618 Bacteria 1734
112 Ga0068861_100092209 3300005719 Bacteria 2393
113 Ga0068861_100374091 3300005719 Bacteria 1257
114 Ga0068863_100005225 3300005841 Bacteria 12813
115 Ga0068863_100024338 3300005841 Bacteria 5775
116 Ga0068863_100117596 3300005841 Bacteria 2533
117 Ga0068858_100001170 3300005842 Bacteria 27211
118 Ga0068858_100012191 3300005842 Bacteria 8105
119 Ga0068860_100001012 3300005843 Bacteria 31132
120 Ga0068860_100011906 3300005843 Bacteria 8573
121 Ga0068860_100064414 3300005843 Bacteria 3481
122 Ga0068862_100366184 3300005844 Unclassified 1341
123 Ga0068862_100422282 3300005844 Bacteria 1251
124 Ga0081455_10000289 3300005937 Bacteria 66552
125 Ga0081455_10000746 3300005937 Bacteria 42273
126 Ga0081539_10000016 3300005985 Bacteria 381648
127 Ga0070717_10035797 3300006028 Bacteria 4022
128 Ga0070717_10057790 3300006028 Unclassified 3207
129 Ga0075365_10000551 3300006038 Bacteria 14473
130 Ga0075365_10032699 3300006038 Bacteria 3347
131 Ga0075365_10057429 3300006038 Bacteria 2589
132 Ga0075363_100064994 3300006048 Bacteria 1971
133 Ga0075364_10010262 3300006051 Bacteria 5652
134 Ga0075364_10043556 3300006051 Bacteria 2919
135 Ga0070715_10027800 3300006163 Bacteria 2262
136 Ga0070716_100019232 3300006173 Bacteria 3567
137 Ga0070712_100020269 3300006175 Bacteria 4349
138 Ga0070712_100029909 3300006175 Bacteria 3655
139 Ga0075362_10015905 3300006177 Bacteria 3069
140 Ga0075367_10039059 3300006178 Bacteria 2766
141 Ga0075367_10109849 3300006178 Bacteria 1692
142 Ga0097621_100005410 3300006237 Bacteria 8999
143 Ga0068871_100006591 3300006358 Bacteria 8233
144 Ga0068871_100602945 3300006358 Bacteria 999
145 Ga0075434_100298348 3300006871 Bacteria 1632
146 Ga0068865_100003888 3300006881 Bacteria 8961
147 Ga0068865_100021428 3300006881 Bacteria 4202
148 Ga0068865_100367515 3300006881 Bacteria 1170
149 Ga0097620_100021327 3300006931 Bacteria 6500
150 Ga0097620_100101822 3300006931 Bacteria 2929
151 Ga0097620_100105638 3300006931 Unclassified 2875
152 Ga0105240_10001872 3300009093 Bacteria 34979
153 Ga0105240_10004116 3300009093 Bacteria 22324
154 Ga0105240_10022760 3300009093 Bacteria 8301
155 Ga0105240_10046552 3300009093 Bacteria 5495
156 Ga0105240_10301250 3300009093 Bacteria 1834
157 Ga0111539_10035839 3300009094 Bacteria 6005
158 Ga0105245_10004224 3300009098 Bacteria 12751
159 Ga0105245_10029226 3300009098 Bacteria 4868
160 Ga0105245_10064430 3300009098 Bacteria 3312
161 Ga0105247_10033987 3300009101 Bacteria 3105
162 Ga0105243_10021928 3300009148 Bacteria 4850
163 Ga0105243_10022526 3300009148 Bacteria 4789
164 Ga0105243_10206465 3300009148 Bacteria 1727
165 Ga0105242_10061347 3300009176 Unclassified 3092
166 Ga0105242_10133319 3300009176 Bacteria 2147
167 Ga0105242_10170149 3300009176 Bacteria 1914
168 Ga0105242_10332618 3300009176 Bacteria 1397
169 Ga0105248_10037253 3300009177 Bacteria 5441
170 Ga0105248_10082234 3300009177 Bacteria 3621
171 Ga0105248_11121230 3300009177 Bacteria 889
172 Ga0105237_10154365 3300009545 Bacteria 2292
173 Ga0105237_10238997 3300009545 Bacteria 1817
174 Ga0105237_10335856 3300009545 Bacteria 1515
175 Ga0105237_10434060 3300009545 Bacteria 1319
176 Ga0105238_10023381 3300009551 Bacteria 6300
177 Ga0105238_10050839 3300009551 Bacteria 4171
178 Ga0105238_10079012 3300009551 Bacteria 3280
179 Ga0105238_10079847 3300009551 Bacteria 3261
180 Ga0105238_10105397 3300009551 Bacteria 2801
181 Ga0105238_10114364 3300009551 Bacteria 2678
182 Ga0105238_10155595 3300009551 Bacteria 2261
183 Ga0105238_10176633 3300009551 Bacteria 2112
184 Ga0105238_10247735 3300009551 Bacteria 1759
185 Ga0105249_10820173 3300009553 Bacteria 995
186 Ga0105239_10002773 3300010375 Bacteria 21962
187 Ga0105239_10020110 3300010375 Bacteria 7365
188 Ga0105239_10143248 3300010375 Bacteria 2664
189 Ga0105239_10665722 3300010375 Bacteria 1189
190 Ga0105246_10056210 3300011119 Bacteria 2719
191 Ga0157371_10108798 3300013102 Bacteria 1967
192 Ga0157370_10232674 3300013104 Bacteria 1705
193 Ga0157370_10271043 3300013104 Unclassified 1568
194 Ga0157369_10023185 3300013105 Bacteria 6915
195 Ga0157369_10057229 3300013105 Bacteria 4207
196 Ga0157369_10117201 3300013105 Bacteria 2827
197 Ga0157369_10137853 3300013105 Bacteria 2582
198 Ga0157369_10259559 3300013105 Bacteria 1812
199 Ga0157369_10473266 3300013105 Bacteria 1296
200 Ga0157374_10002067 3300013296 Bacteria 16889
201 Ga0157374_10136792 3300013296 Bacteria 2376
202 Ga0157378_10006201 3300013297 Bacteria 10464
203 Ga0163162_10035042 3300013306 Bacteria 4996
204 Ga0163162_10152669 3300013306 Unclassified 2428
205 Ga0157372_10153125 3300013307 Bacteria 2662
206 Ga0157372_10199420 3300013307 Bacteria 2318
207 Ga0157372_10669140 3300013307 Bacteria 1209
208 Ga0157375_10135005 3300013308 Bacteria 2590
209 Ga0163163_10014563 3300014325 Bacteria 7234
210 Ga0163163_10234542 3300014325 Bacteria 1884
211 Ga0157380_10055019 3300014326 Bacteria 3158
212 Ga0157380_10107937 3300014326 Bacteria 2332
213 Ga0157377_10005003 3300014745 Bacteria 6182
214 Ga0157377_10110873 3300014745 Bacteria 1649
215 Ga0157379_10008362 3300014968 Bacteria 8992
216 Ga0157379_10027551 3300014968 Bacteria 5059
217 Ga0157379_10080966 3300014968 Bacteria 2909
218 Ga0157376_10005732 3300014969 Bacteria 8697
219 Ga0157376_10010199 3300014969 Bacteria 6860
220 Ga0163161_10059213 3300017792 Bacteria 2785
221 Ga0163161_10074237 3300017792 Bacteria 2494
222 Ga0213874_10000147 3300021377 Bacteria 12174
223 Ga0213874_10016645 3300021377 Bacteria 1961
224 Ga0213874_10056154 3300021377 Bacteria 1221
225 Ga0213876_10009597 3300021384 Bacteria 5206
226 Ga0213876_10115109 3300021384 Bacteria 1427
227 Ga0213876_10148833 3300021384 Bacteria 1245
228 Ga0213875_10019000 3300021388 Bacteria 3308
229 Ga0213875_10023583 3300021388 Bacteria 2938
230 Ga0213875_10039425 3300021388 Bacteria 2225
231 Ga0213875_10077375 3300021388 Unclassified 1552
232 Ga0207653_10004249 3300025885 Bacteria 4500
233 Ga0207682_10064866 3300025893 Bacteria 1536
234 Ga0207692_10038960 3300025898 Bacteria 2334
235 Ga0207692_10147049 3300025898 Bacteria 1346
236 Ga0207710_10011459 3300025900 Bacteria 3733
237 Ga0207688_10033854 3300025901 Bacteria 2827
238 Ga0207688_10120245 3300025901 Bacteria 1532
239 Ga0207680_10048394 3300025903 Unclassified 2525
240 Ga0207680_10074714 3300025903 Bacteria 2111
241 Ga0207699_10035364 3300025906 Bacteria 2842
242 Ga0207699_10097454 3300025906 Bacteria 1858
243 Ga0207643_10015477 3300025908 Bacteria 4152
244 Ga0207654_10072006 3300025911 Bacteria 2056
245 Ga0207707_10000659 3300025912 Bacteria 34203
246 Ga0207707_10005489 3300025912 Bacteria 11084
247 Ga0207707_10306500 3300025912 Bacteria 1373
248 Ga0207695_10007347 3300025913 Bacteria 14061
249 Ga0207695_10063339 3300025913 Bacteria 3813
250 Ga0207695_10081817 3300025913 Bacteria 3267
251 Ga0207695_10105229 3300025913 Bacteria 2810
252 Ga0207695_10109519 3300025913 Bacteria 2743
253 Ga0207671_10008474 3300025914 Bacteria 8714
254 Ga0207671_10053774 3300025914 Unclassified 2984
255 Ga0207693_10001765 3300025915 Bacteria 18972
256 Ga0207693_10331201 3300025915 Bacteria 1192
257 Ga0207663_10014787 3300025916 Bacteria 4286
258 Ga0207660_10011567 3300025917 Bacteria 5750
259 Ga0207662_10019780 3300025918 Bacteria 3837
260 Ga0207657_10035861 3300025919 Bacteria 4443
261 Ga0207657_10069646 3300025919 Bacteria 2984
262 Ga0207649_10197054 3300025920 Bacteria 1420
263 Ga0207652_10009622 3300025921 Bacteria 7774
264 Ga0207652_10037961 3300025921 Bacteria 4080
265 Ga0207652_10039072 3300025921 Bacteria 4026
266 Ga0207681_10221204 3300025923 Bacteria 1465
267 Ga0207694_10046070 3300025924 Bacteria 3370
268 Ga0207694_10084295 3300025924 Bacteria 2500
269 Ga0207694_10120723 3300025924 Bacteria 2093
270 Ga0207650_10264004 3300025925 Bacteria 1397
271 Ga0207687_10012491 3300025927 Bacteria 5547
272 Ga0207687_10142347 3300025927 Bacteria 1821
273 Ga0207700_10031445 3300025928 Bacteria 3771
274 Ga0207700_10084703 3300025928 Bacteria 2486
275 Ga0207700_10152790 3300025928 Bacteria 1909
276 Ga0207700_10546833 3300025928 Bacteria 1028
277 Ga0207664_10009304 3300025929 Bacteria 6889
278 Ga0207664_10092610 3300025929 Unclassified 2481
279 Ga0207664_10675744 3300025929 Bacteria 928
280 Ga0207690_10064690 3300025932 Bacteria 2498
281 Ga0207690_10075950 3300025932 Bacteria 2331
282 Ga0207690_10158645 3300025932 Bacteria 1684
283 Ga0207706_10023929 3300025933 Bacteria 5479
284 Ga0207706_10112822 3300025933 Bacteria 2391
285 Ga0207709_10094913 3300025935 Bacteria 1959
286 Ga0207709_10130259 3300025935 Bacteria 1713
287 Ga0207704_10023672 3300025938 Unclassified 3314
288 Ga0207704_10151330 3300025938 Bacteria 1638
289 Ga0207704_10151926 3300025938 Bacteria 1635
290 Ga0207704_10276379 3300025938 Bacteria 1274
291 Ga0207665_10107504 3300025939 Bacteria 1956
292 Ga0207665_10169782 3300025939 Bacteria 1574
293 Ga0207691_10039399 3300025940 Bacteria 4372
294 Ga0207711_10011383 3300025941 Bacteria 7393
295 Ga0207689_10107148 3300025942 Bacteria 2297
296 Ga0207689_10211460 3300025942 Bacteria 1602
297 Ga0207689_10305937 3300025942 Bacteria 1318
298 Ga0207661_10143493 3300025944 Bacteria 2057
299 Ga0207661_10181027 3300025944 Bacteria 1841
300 Ga0207667_10002777 3300025949 Bacteria 21665
301 Ga0207667_10016391 3300025949 Bacteria 8376
302 Ga0207667_10284209 3300025949 Bacteria 1690
303 Ga0207667_10375222 3300025949 Bacteria 1449
304 Ga0207651_10371313 3300025960 Unclassified 1210
305 Ga0207712_10056449 3300025961 Bacteria 2766
306 Ga0207712_10058428 3300025961 Bacteria 2725
307 Ga0207712_10195585 3300025961 Bacteria 1599
308 Ga0207640_10070982 3300025981 Bacteria 2344
309 Ga0207658_10010647 3300025986 Bacteria 6251
310 Ga0207677_10033634 3300026023 Bacteria 3310
311 Ga0207703_10001004 3300026035 Bacteria 27105
312 Ga0207703_10004345 3300026035 Bacteria 11646
313 Ga0207703_10075358 3300026035 Bacteria 2796
314 Ga0207639_10058844 3300026041 Bacteria 2957
315 Ga0207639_10268235 3300026041 Bacteria 1496
316 Ga0207678_10084915 3300026067 Bacteria 2707
317 Ga0207678_10089442 3300026067 Bacteria 2632
318 Ga0207678_10111555 3300026067 Bacteria 2333
319 Ga0207708_10016970 3300026075 Bacteria 5481
320 Ga0207708_10259782 3300026075 Bacteria 1402
321 Ga0207702_10033844 3300026078 Bacteria 4271
322 Ga0207702_10075397 3300026078 Bacteria 2914
323 Ga0207702_10189902 3300026078 Bacteria 1897
324 Ga0207702_10353747 3300026078 Bacteria 1406
325 Ga0207641_10000871 3300026088 Bacteria 31582
326 Ga0207641_10011339 3300026088 Bacteria 7317
327 Ga0207641_10216163 3300026088 Bacteria 1775
328 Ga0207648_10071201 3300026089 Bacteria 3030
329 Ga0207648_10086750 3300026089 Bacteria 2731
330 Ga0207676_10024272 3300026095 Unclassified 4485
331 Ga0207674_10040638 3300026116 Bacteria 4817
332 Ga0207674_10300918 3300026116 Bacteria 1553
333 Ga0207674_10425890 3300026116 Bacteria 1282
334 Ga0207675_100084065 3300026118 Bacteria 2986
335 Ga0207675_100137213 3300026118 Bacteria 2322
336 Ga0207675_100145624 3300026118 Bacteria 2252
337 Ga0207675_100457512 3300026118 Bacteria 1265
338 Ga0207683_10022371 3300026121 Bacteria 5426
339 Ga0207683_10083083 3300026121 Bacteria 2846
340 Ga0207683_10147016 3300026121 Bacteria 2126
341 Ga0207698_10089208 3300026142 Bacteria 2517
342 Ga0207698_10090339 3300026142 Bacteria 2504
343 Ga0207698_10401251 3300026142 Bacteria 1310
344 Ga0207428_10013589 3300027907 Bacteria 7105
345 Ga0268266_10003099 3300028379 Bacteria 16936
346 Ga0268266_10026084 3300028379 Bacteria 4972
347 Ga0268266_10103400 3300028379 Bacteria 2513
348 Ga0268266_10259275 3300028379 Bacteria 1611
349 Ga0268266_10410530 3300028379 Bacteria 1282
350 Ga0268265_10003739 3300028380 Bacteria 10821
351 Ga0268265_10033579 3300028380 Bacteria 3732
352 Ga0268265_10417847 3300028380 Bacteria 1244
353 Ga0268264_10000518 3300028381 Bacteria 48829
354 Ga0268264_10070899 3300028381 Bacteria 2951
355 Ga0265334_10037433 3300028573 Bacteria 1912
356 Ga0265318_10003106 3300028577 Bacteria 8526
357 Ga0265322_10041222 3300028654 Bacteria 1314
358 Ga0265760_10037586 3300031090 Bacteria 1438
359 Ga0265330_10025326 3300031235 Bacteria 2690
360 Ga0265329_10041120 3300031242 Bacteria 1483
361 Ga0265340_10024228 3300031247 Bacteria 3085
362 Ga0265327_10025371 3300031251 Bacteria 3457
363 Ga0265316_10223226 3300031344 Bacteria 1389
364 Ga0307509_10000005 3300031507 Bacteria 435959
365 Ga0265313_10086358 3300031595 Bacteria 1416
366 Ga0307510_10000001 3300033180 Bacteria 1172244
367 Ga0373938_0001126 3300034957 Bacteria 4302
368 Ga0373929_0022239 3300035085 Bacteria 1293
369 Ga0373949_0010749 3300035090 Bacteria 2010
370 Ga0373936_0001046 3300035113 Bacteria 9889
371 Ga0373936_0013375 3300035113 Bacteria 3133
372 Ga0373945_0064041 3300035116 Bacteria 1378
373 Ga0373943_0051206 3300035170 Bacteria 2032
374 Ga0373955_0003012 3300035172 Bacteria 7383
375 Ga0373955_0065762 3300035172 Bacteria 2014
376 Ga0373931_0022264 3300035691 Bacteria 3188
377 Ga0373933_0026509 3300035724 Bacteria 3329
378 Ga0373933_0139129 3300035724 Bacteria 1532
379 Ga0373947_0185605 3300035725 Bacteria 1356
380 Ga0373937_0002672 3300036401 Bacteria 14863
381 Ga0373937_0622993 3300036401 Bacteria 1024
382 Ga0436364_0028511 3300037853 Bacteria 42380
383 Ga0436364_0088869 3300037853 Bacteria 14691
384 Ga0436364_0291817 3300037853 Bacteria 5502
385 Ga0436364_0380016 3300037853 Bacteria 7125
386 Ga0436364_0381743 3300037853 Bacteria 1578
387 Ga0436364_1565546 3300037853 Bacteria 3551
388 Ga0436365_0116219 3300039437 Bacteria 10872
389 Ga0436365_0392316 3300039437 Bacteria 5703
390 Ga0436365_0757770 3300039437 Bacteria 17434
391 Ga0436365_1310673 3300039437 Bacteria 4156
392 Ga0436365_1725271 3300039437 Bacteria 17905
393 Ga0436365_1860495 3300039437 Bacteria 1838
394 Ga0436363_0054480 3300039450 Bacteria 7588
395 Ga0436363_0400823 3300039450 Bacteria 2114
396 Ga0436363_0530445 3300039450 Bacteria 1522
397 Ga0436363_0812143 3300039450 Bacteria 15027
398 Ga0436363_1187238 3300039450 Bacteria 4830
399 Ga0436363_1553426 3300039450 Bacteria 5153
400 Ga0436363_1649388 3300039450 Unclassified 1187
401 Ga0436362_0136684 3300039453 Bacteria 2120
402 Ga0436362_0868892 3300039453 Bacteria 1794
403 Ga0439463_056349 3300042016 Bacteria 1004
404 Ga0466964_0082327 3300044706 Bacteria 1384
405 Ga0466968_0101314 3300044735 Bacteria 1286
406 Ga0466959_0049372 3300045049 Bacteria 3091
407 Ga0466958_0010971 3300045836 Bacteria 5092
408 Ga0466967_0023312 3300045976 Bacteria 5069
409 Ga0466967_0090081 3300045976 Bacteria 2786
410 Ga0466967_0113706 3300045976 Bacteria 2491
411 Ga0466967_0243394 3300045976 Bacteria 1716
412 Ga0466967_0479756 3300045976 Unclassified 1218
413 Ga0495592_0028980 3300046454 Bacteria 4191
414 Ga0495592_0074651 3300046454 Bacteria 2463
415 Ga0495603_0086678 3300046455 Bacteria 1833
416 Ga0495603_0089071 3300046455 Bacteria 1806
417 Ga0495603_0302371 3300046455 Unclassified 919
418 Ga0495641_0049416 3300046461 Bacteria 1925
419 Ga0495651_0007697 3300046462 Bacteria 8238
420 Ga0495651_0028653 3300046462 Bacteria 4340
421 Ga0495651_0103899 3300046462 Bacteria 2110
422 Ga0495653_0026729 3300046463 Bacteria 4625
423 Ga0495580_0001449 3300046472 Bacteria 20800
424 Ga0495580_0036525 3300046472 Bacteria 3527
425 Ga0495582_0038461 3300046473 Bacteria 2633
426 Ga0495582_0191961 3300046473 Bacteria 1166
427 Ga0495664_0088698 3300046477 Bacteria 1859
428 Ga0495584_0068708 3300046491 Bacteria 1780
429 Ga0495584_0082876 3300046491 Bacteria 1615
430 Ga0495596_0069675 3300046500 Bacteria 1367
431 Ga0495608_0007998 3300046511 Bacteria 7434
432 Ga0495608_0254096 3300046511 Bacteria 1095
433 Ga0495618_0093083 3300046514 Unclassified 1927
434 Ga0495620_0061393 3300046515 Bacteria 1564
435 Ga0495628_0153787 3300046516 Unclassified 1751
436 Ga0495628_0304128 3300046516 Bacteria 1180
437 Ga0495643_0127749 3300046522 Bacteria 1279
438 Ga0495652_0090884 3300046529 Bacteria 2497
439 Ga0495652_0119672 3300046529 Bacteria 2103
440 Ga0495652_0174833 3300046529 Bacteria 1654
441 Ga0495652_0212978 3300046529 Bacteria 1457
442 Ga0495587_0022877 3300046536 Bacteria 3845
443 Ga0495587_0042549 3300046536 Bacteria 2709
444 Ga0495587_0147384 3300046536 Bacteria 1342
445 Ga0495667_0001276 3300046559 Bacteria 16489
446 Ga0495667_0275406 3300046559 Bacteria 1068
447 Ga0495668_0264493 3300046616 Bacteria 942
448 Ga0495634_0080484 3300046642 Bacteria 2132
449 Ga0495634_0085852 3300046642 Bacteria 2051
450 Ga0495625_0179760 3300046660 Bacteria 1408
451 Ga0495635_0026046 3300046663 Bacteria 4073
452 Ga0495635_0063848 3300046663 Bacteria 2528
453 Ga0495661_0177574 3300046665 Bacteria 1131
454 Ga0495657_0027846 3300046675 Bacteria 3981
455 Ga0495657_0043330 3300046675 Bacteria 3070
456 Ga0495599_0119708 3300046678 Unclassified 1637
457 Ga0495599_0154948 3300046678 Bacteria 1418
458 Ga0495623_0116829 3300046679 Bacteria 1611
459 Ga0495623_0144909 3300046679 Bacteria 1409
460 Ga0495646_0139755 3300046680 Unclassified 1355
461 Ga0495658_0088312 3300046683 Bacteria 1832
462 Ga0495658_0243503 3300046683 Bacteria 1130
463 Ga0495613_0123626 3300046689 Bacteria 1857
464 Ga0495624_0158971 3300046690 Bacteria 1381
465 Ga0495600_0017357 3300046809 Bacteria 4578
466 Ga0495604_0257411 3300047317 Bacteria 1187
467 Ga0495674_0096394 3300047319 Bacteria 2521
468 Ga0495674_0300657 3300047319 Bacteria 1311
469 Ga0495674_0563750 3300047319 Bacteria 905
470 Ga0495676_0065494 3300047321 Bacteria 2820
471 Ga0495680_0031108 3300047322 Bacteria 4348
472 Ga0495680_0064440 3300047322 Bacteria 2810
473 Ga0495675_0054666 3300047444 Bacteria 2533
474 Ga0495675_0152270 3300047444 Bacteria 1428
475 Ga0495684_0026250 3300047471 Bacteria 4475
476 Ga0495684_0123970 3300047471 Unclassified 1944
477 Ga0495684_0285708 3300047471 Bacteria 1189
478 Ga0495602_0024011 3300048088 Bacteria 5923
479 Ga0495602_0050026 3300048088 Bacteria 3738
480 Ga0495602_0089031 3300048088 Bacteria 2567
481 Ga0495602_0279397 3300048088 Bacteria 1231
482 Ga0496100_0026220 3300048903 Bacteria 3572
483 Ga0496101_0115530 3300048904 Bacteria 2024
484 Ga0496101_0388067 3300048904 Bacteria 1099
485 Ga0496102_0077300 3300048905 Bacteria 3063
486 Ga0496102_0558662 3300048905 Bacteria 1067
487 Ga0496104_0004546 3300048907 Bacteria 12086
488 Ga0496104_0006440 3300048907 Bacteria 10321
489 Ga0496104_0243006 3300048907 Bacteria 1713
490 Ga0496105_0002204 3300048908 Bacteria 14112
491 Ga0496105_0056304 3300048908 Bacteria 3245
492 Ga0496106_0127182 3300048909 Bacteria 1996
493 Ga0496106_0303895 3300048909 Bacteria 1280
494 Ga0496106_0360157 3300048909 Bacteria 1168
495 Ga0496107_0178567 3300048910 Bacteria 1576
496 Ga0496108_0006037 3300048911 Bacteria 9803
497 Ga0496108_0018273 3300048911 Bacteria 5741
498 Ga0496108_0042102 3300048911 Bacteria 3812
499 Ga0496108_0537882 3300048911 Bacteria 1020
500 Ga0496109_0008081 3300048912 Bacteria 8920
501 Ga0496109_0037631 3300048912 Bacteria 4371
502 Ga0496109_0041338 3300048912 Bacteria 4176
503 Ga0496109_0150984 3300048912 Bacteria 2175
504 Ga0496109_0196860 3300048912 Bacteria 1894
505 Ga0496110_0017574 3300048913 Bacteria 5981
506 Ga0496110_0070774 3300048913 Bacteria 3091
507 Ga0496110_0262468 3300048913 Bacteria 1572
508 Ga0496111_0005453 3300048914 Bacteria 8151
509 Ga0496111_0012868 3300048914 Bacteria 5677
510 Ga0496112_0032785 3300048915 Bacteria 5044
511 Ga0496112_0033874 3300048915 Bacteria 4968
512 Ga0496112_0232259 3300048915 Bacteria 1799
513 Ga0496112_0602916 3300048915 Bacteria 1030
514 Ga0496113_0001704 3300048916 Bacteria 12457
515 Ga0496113_0076238 3300048916 Bacteria 2561
516 Ga0496113_0453542 3300048916 Bacteria 1030
517 Ga0496114_0030604 3300048917 Bacteria 4429
518 Ga0496114_0123511 3300048917 Bacteria 2229
519 Ga0496114_0136431 3300048917 Bacteria 2122
520 Ga0496114_0143703 3300048917 Bacteria 2067
521 Ga0496114_0265203 3300048917 Bacteria 1513
522 Ga0496115_0316202 3300048918 Bacteria 1278
523 Ga0496115_0407028 3300048918 Bacteria 1103
524 Ga0496118_0252114 3300048921 Bacteria 1002
525 Ga0496121_0192582 3300048924 Bacteria 1461
526 Ga0496125_0002119 3300048928 Bacteria 26671
527 Ga0496126_0047317 3300048929 Bacteria 3938
528 Ga0501031_0029529 3300049568 Bacteria 3576
529 Ga0501032_0042393 3300049569 Bacteria 3087
530 Ga0501033_0019527 3300049570 Bacteria 5124
531 Ga0501033_0141644 3300049570 Unclassified 1738
532 Ga0501034_0006432 3300049571 Bacteria 12649
533 Ga0501036_0008102 3300049572 Bacteria 8611
534 Ga0501036_0139507 3300049572 Bacteria 2046
535 Ga0501036_0147668 3300049572 Bacteria 1983
536 Ga0501038_0064279 3300049574 Bacteria 3129
537 Ga0501038_0218728 3300049574 Bacteria 1520
538 Ga0501039_0006035 3300049575 Bacteria 9194
539 Ga0501039_0242354 3300049575 Bacteria 1417
540 Ga0501040_0022742 3300049576 Bacteria 4199
541 Ga0501040_0048222 3300049576 Bacteria 2911
542 Ga0501040_0060496 3300049576 Bacteria 2603
543 Ga0501040_0149654 3300049576 Bacteria 1646
544 Ga0501041_0004686 3300049577 Bacteria 7936
545 Ga0501041_0014372 3300049577 Bacteria 4700
546 Ga0501041_0230416 3300049577 Bacteria 1163
547 Ga0501042_0012658 3300049578 Bacteria 5723
548 Ga0501042_0037531 3300049578 Bacteria 3438
549 Ga0501042_0058929 3300049578 Bacteria 2741
550 Ga0501043_0137212 3300049579 Bacteria 1916
551 Ga0501046_0002204 3300049580 Bacteria 18411
552 Ga0501048_0029088 3300049582 Bacteria 4009
553 Ga0501048_0029249 3300049582 Bacteria 3997
554 Ga0501048_0331648 3300049582 Bacteria 1084
555 Ga0501048_0362302 3300049582 Unclassified 1034
556 Ga0501067_0003553 3300049583 Bacteria 8580
557 Ga0501067_0012844 3300049583 Bacteria 4637
558 Ga0501067_0039307 3300049583 Bacteria 2627
559 Ga0501067_0236415 3300049583 Bacteria 1017
560 Ga0501068_0057210 3300049584 Bacteria 2364
561 Ga0501069_0000875 3300049585 Bacteria 14347
562 Ga0501069_0014840 3300049585 Bacteria 4171
563 Ga0501070_0012951 3300049586 Bacteria 7029
564 Ga0501070_0044438 3300049586 Bacteria 3696
565 Ga0501070_0125588 3300049586 Bacteria 2120
566 Ga0501071_0029376 3300049587 Bacteria 3879
567 Ga0501071_0048396 3300049587 Bacteria 3058
568 Ga0501071_0146921 3300049587 Bacteria 1757
569 Ga0501072_0006425 3300049588 Bacteria 8957
570 Ga0501072_0030735 3300049588 Bacteria 4201
571 Ga0501072_0032620 3300049588 Bacteria 4079
572 Ga0501072_0037692 3300049588 Bacteria 3792
573 Ga0501073_0065413 3300049589 Bacteria 2535
574 Ga0501073_0072043 3300049589 Bacteria 2407
575 Ga0501074_0026333 3300049590 Bacteria 4217
576 Ga0501074_0037273 3300049590 Bacteria 3525
577 Ga0501074_0055815 3300049590 Bacteria 2846
578 Ga0501075_0008888 3300049591 Bacteria 7006
579 Ga0501075_0012025 3300049591 Bacteria 6143
580 Ga0501075_0316874 3300049591 Bacteria 1189
581 Ga0501076_0003603 3300049592 Bacteria 10881
582 Ga0501076_0040468 3300049592 Bacteria 3664
583 Ga0501076_0126687 3300049592 Bacteria 2069
584 Ga0501076_0243439 3300049592 Bacteria 1471
585 Ga0501077_0023940 3300049593 Bacteria 3873
586 Ga0501077_0050471 3300049593 Bacteria 2644
587 Ga0501077_0197409 3300049593 Bacteria 1278
588 Ga0501079_0006298 3300049741 Bacteria 8900
589 Ga0501079_0011754 3300049741 Bacteria 6687
590 Ga0501079_0165116 3300049741 Bacteria 1727
591 Ga0501079_0193996 3300049741 Bacteria 1585
592 Ga0501079_0262341 3300049741 Bacteria 1350
593 Ga0501080_0048773 3300049742 Bacteria 3940
594 Ga0501080_0380310 3300049742 Bacteria 1272
595 Ga0501080_0506408 3300049742 Unclassified 1078
596 Ga0501081_0000832 3300049743 Bacteria 18239
597 Ga0501081_0099008 3300049743 Bacteria 2059
598 Ga0501081_0122598 3300049743 Bacteria 1852
599 Ga0501081_0159749 3300049743 Bacteria 1623
600 Ga0501083_0007534 3300049744 Bacteria 7713
601 Ga0501083_0023782 3300049744 Bacteria 4248
602 Ga0501083_0041793 3300049744 Bacteria 3109
603 Ga0501083_0181348 3300049744 Bacteria 1375
604 Ga0501035_0021510 3300049822 Bacteria 5930
605 Ga0501035_0054011 3300049822 Bacteria 3590
606 Ga0501044_0046640 3300049823 Bacteria 4486
607 Ga0501045_0000502 3300049824 Bacteria 24311
608 Ga0501045_0034020 3300049824 Bacteria 3698
609 Ga0501045_0046018 3300049824 Bacteria 3177
610 Ga0501045_0168261 3300049824 Bacteria 1632
611 Ga0501045_0213648 3300049824 Bacteria 1437
612 nmdc:mga03n38_116552_c1 3300050490 Bacteria 1307
613 nmdc:mga03n38_147548_c1 3300050490 Bacteria 1181
614 nmdc:mga00v17_185154_c1 3300050491 Bacteria 1344
615 nmdc:mga00v17_340768_c1 3300050491 Bacteria 975
616 nmdc:mga0yw44_25303_c1 3300050492 Bacteria 3373
617 nmdc:mga0yw44_96510_c1 3300050492 Bacteria 1877
618 nmdc:mga0k408_201032_c1 3300050493 Bacteria 1189
619 nmdc:mga06z11_116291_c1 3300050494 Bacteria 1487
620 nmdc:mga06z11_62367_c1 3300050494 Bacteria 1947
621 nmdc:mga06z11_81485_c1 3300050494 Bacteria 1737
622 nmdc:mga08x19_328737_c1 3300050514 Bacteria 1065
623 Ga0495601_0073629 3300053077 Bacteria 2184
624 Ga0495612_0123646 3300053078 Bacteria 1114
625 Ga0495595_0048749 3300053084 Bacteria 1956
626 Ga0495619_0013492 3300053085 Bacteria 5148
627 Ga0495619_0191749 3300053085 Unclassified 1414
628 Ga0495619_0250047 3300053085 Bacteria 1228
629 Ga0495619_0260840 3300053085 Bacteria 1201
630 Ga0500644_0076720 3300053088 Bacteria 1219
631 Ga0500583_0003848 3300053092 Bacteria 4802
632 Ga0500583_0087928 3300053092 Bacteria 1510
633 Ga0500642_0044647 3300053130 Bacteria 1931
634 Ga0500616_0000018 3300053153 Bacteria 610976
635 Ga0501084_0026444 3300054114 Bacteria 4843
636 Ga0501084_0048089 3300054114 Bacteria 3571
637 Ga0501084_0221497 3300054114 Bacteria 1596
638 Ga0501082_0040761 3300060353 Bacteria 4005
639 Ga0501082_0052163 3300060353 Bacteria 3525
640 Ga0501082_0066684 3300060353 Bacteria 3099
641 Ga0501082_0071321 3300060353 Bacteria 2992
642 Ga0530510_0054568 3300061734 Bacteria 2887
643 Ga0530510_0074563 3300061734 Bacteria 2463
644 Ga0530510_0085167 3300061734 Bacteria 2303
645 Ga0530510_0154817 3300061734 Bacteria 1694
646 Ga0530510_0339537 3300061734 Unclassified 1127

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025929 Ga0207664_10675744 Ga0207664_106757442 229
2 3300025928 Ga0207700_10546833 Ga0207700_105468331 234
3 3300009551 Ga0105238_10176633 Ga0105238_101766332 236
4 3300046477 Ga0495664_0088698 Ga0495664_0088698_261_1004 239
5 3300013105 Ga0157369_10259559 Ga0157369_102595592 250
6 3300048905 Ga0496102_0558662 Ga0496102_0558662_76_888 258
7 3300048907 Ga0496104_0243006 Ga0496104_0243006_377_1189 258
8 3300048918 Ga0496115_0316202 Ga0496115_0316202_389_1201 258
9 3300021384 Ga0213876_10115109 Ga0213876_101151091 259
10 3300009148 Ga0105243_10021928 Ga0105243_100219283 260
11 3300025935 Ga0207709_10130259 Ga0207709_101302592 260
12 3300050514 nmdc:mga08x19_328737_c1 nmdc:mga08x19_328737_c1_237_1052 260
13 3300006038 Ga0075365_10057429 Ga0075365_100574292 261
14 3300009177 Ga0105248_11121230 Ga0105248_111212301 261
15 3300049583 Ga0501067_0012844 Ga0501067_0012844_101_934 261
16 3300050490 nmdc:mga03n38_147548_c1 nmdc:mga03n38_147548_c1_105_965 261
17 3300050492 nmdc:mga0yw44_96510_c1 nmdc:mga0yw44_96510_c1_418_1278 261
18 3300050494 nmdc:mga06z11_62367_c1 nmdc:mga06z11_62367_c1_536_1396 261
19 3300006048 Ga0075363_100064994 Ga0075363_1000649942 262
20 3300006051 Ga0075364_10010262 Ga0075364_100102626 262
21 3300006177 Ga0075362_10015905 Ga0075362_100159052 262
22 3300006178 Ga0075367_10109849 Ga0075367_101098492 262
23 3300021377 Ga0213874_10056154 Ga0213874_100561542 262
24 3300046529 Ga0495652_0174833 Ga0495652_0174833_284_1114 262
25 3300050493 nmdc:mga0k408_201032_c1 nmdc:mga0k408_201032_c1_259_1050 262
26 3300053088 Ga0500644_0076720 Ga0500644_0076720_47_877 262
27 3300053092 Ga0500583_0087928 Ga0500583_0087928_54_884 262
28 3300053153 Ga0500616_0000018 Ga0500616_0000018_187046_187876 262
29 3300005435 Ga0070714_100158669 Ga0070714_1001586692 263
30 3300005439 Ga0070711_100064815 Ga0070711_1000648152 263
31 3300006028 Ga0070717_10035797 Ga0070717_100357972 263
32 3300006175 Ga0070712_100029909 Ga0070712_1000299092 263
33 3300006881 Ga0068865_100367515 Ga0068865_1003675152 263
34 3300017792 Ga0163161_10074237 Ga0163161_100742373 263
35 3300025906 Ga0207699_10097454 Ga0207699_100974542 263
36 3300025915 Ga0207693_10001765 Ga0207693_1000176513 263
37 3300025938 Ga0207704_10151330 Ga0207704_101513302 263
38 3300025961 Ga0207712_10058428 Ga0207712_100584282 263
39 3300026118 Ga0207675_100145624 Ga0207675_1001456242 263
40 3300035724 Ga0373933_0139129 Ga0373933_0139129_171_998 263
41 3300046472 Ga0495580_0036525 Ga0495580_0036525_1398_2225 263
42 3300047444 Ga0495675_0054666 Ga0495675_0054666_311_1138 263
43 3300048088 Ga0495602_0279397 Ga0495602_0279397_183_1010 263
44 3300005329 Ga0070683_100243547 Ga0070683_1002435472 264
45 3300005337 Ga0070682_100109738 Ga0070682_1001097382 264
46 3300005439 Ga0070711_100333604 Ga0070711_1003336042 264
47 3300005535 Ga0070684_100052514 Ga0070684_1000525144 264
48 3300005539 Ga0068853_100014189 Ga0068853_1000141895 264
49 3300005578 Ga0068854_100091100 Ga0068854_1000911004 264
50 3300005616 Ga0068852_100000594 Ga0068852_10000059420 264
51 3300006173 Ga0070716_100019232 Ga0070716_1000192321 264
52 3300009093 Ga0105240_10046552 Ga0105240_100465523 264
53 3300013307 Ga0157372_10199420 Ga0157372_101994203 264
54 3300025928 Ga0207700_10152790 Ga0207700_101527902 264
55 3300021377 Ga0213874_10016645 Ga0213874_100166452 265
56 3300039450 Ga0436363_0054480 Ga0436363_0054480_1362_2192 265
57 3300046472 Ga0495580_0001449 Ga0495580_0001449_19529_20359 265
58 3300005435 Ga0070714_100022905 Ga0070714_1000229055 267
59 3300005436 Ga0070713_100010073 Ga0070713_1000100732 267
60 3300005535 Ga0070684_100273313 Ga0070684_1002733132 267
61 3300025928 Ga0207700_10084703 Ga0207700_100847031 267
62 3300025929 Ga0207664_10009304 Ga0207664_100093045 267
63 3300046511 Ga0495608_0254096 Ga0495608_0254096_130_960 267
64 3300046642 Ga0495634_0085852 Ga0495634_0085852_799_1629 267
65 3300046683 Ga0495658_0088312 Ga0495658_0088312_845_1675 267
66 3300047319 Ga0495674_0300657 Ga0495674_0300657_73_903 267
67 3300006028 Ga0070717_10057790 Ga0070717_100577902 268
68 3300039450 Ga0436363_1649388 Ga0436363_1649388_245_1075 268
69 3300047319 Ga0495674_0096394 Ga0495674_0096394_17_823 268
70 3300061734 Ga0530510_0085167 Ga0530510_0085167_1450_2256 268
71 3300046516 Ga0495628_0304128 Ga0495628_0304128_160_990 269
72 3300047319 Ga0495674_0563750 Ga0495674_0563750_58_888 269
73 3300049570 Ga0501033_0141644 Ga0501033_0141644_471_1301 270
74 3300049575 Ga0501039_0006035 Ga0501039_0006035_6166_6996 270
75 3300049577 Ga0501041_0004686 Ga0501041_0004686_6546_7376 270
76 3300049578 Ga0501042_0012658 Ga0501042_0012658_139_969 270
77 3300049579 Ga0501043_0137212 Ga0501043_0137212_904_1734 270
78 3300049580 Ga0501046_0002204 Ga0501046_0002204_13868_14698 270
79 3300049582 Ga0501048_0029088 Ga0501048_0029088_702_1532 270
80 3300049587 Ga0501071_0048396 Ga0501071_0048396_147_977 270
81 3300049588 Ga0501072_0037692 Ga0501072_0037692_487_1317 270
82 3300049592 Ga0501076_0003603 Ga0501076_0003603_7948_8778 270
83 3300049741 Ga0501079_0006298 Ga0501079_0006298_799_1629 270
84 3300049743 Ga0501081_0000832 Ga0501081_0000832_2881_3711 270
85 3300049824 Ga0501045_0000502 Ga0501045_0000502_21282_22112 270
86 3300050490 nmdc:mga03n38_116552_c1 nmdc:mga03n38_116552_c1_474_1289 271
87 3300050491 nmdc:mga00v17_185154_c1 nmdc:mga00v17_185154_c1_19_834 271
88 3300005530 Ga0070679_100231513 Ga0070679_1002315132 273
89 3300046473 Ga0495582_0191961 Ga0495582_0191961_186_1007 273
90 3300005336 Ga0070680_100051214 Ga0070680_1000512144 275
91 3300005439 Ga0070711_100144382 Ga0070711_1001443823 275
92 3300005458 Ga0070681_10002016 Ga0070681_1000201615 275
93 3300005458 Ga0070681_10016015 Ga0070681_100160152 275
94 3300005458 Ga0070681_10109705 Ga0070681_101097052 275
95 3300005530 Ga0070679_100053871 Ga0070679_1000538715 275
96 3300005530 Ga0070679_100120704 Ga0070679_1001207044 275
97 3300005539 Ga0068853_100405276 Ga0068853_1004052762 275
98 3300005563 Ga0068855_100057508 Ga0068855_1000575084 275
99 3300006175 Ga0070712_100020269 Ga0070712_1000202692 275
100 3300009093 Ga0105240_10001872 Ga0105240_1000187228 275
101 3300009093 Ga0105240_10022760 Ga0105240_100227605 275
102 3300009551 Ga0105238_10023381 Ga0105238_100233812 275
103 3300009551 Ga0105238_10155595 Ga0105238_101555951 275
104 3300013104 Ga0157370_10271043 Ga0157370_102710432 275
105 3300013105 Ga0157369_10023185 Ga0157369_100231852 275
106 3300013105 Ga0157369_10057229 Ga0157369_100572294 275
107 3300013307 Ga0157372_10669140 Ga0157372_106691402 275
108 3300025912 Ga0207707_10000659 Ga0207707_1000065917 275
109 3300025912 Ga0207707_10005489 Ga0207707_100054893 275
110 3300025913 Ga0207695_10105229 Ga0207695_101052293 275
111 3300025913 Ga0207695_10109519 Ga0207695_101095193 275
112 3300025917 Ga0207660_10011567 Ga0207660_100115672 275
113 3300025921 Ga0207652_10009622 Ga0207652_100096226 275
114 3300025921 Ga0207652_10039072 Ga0207652_100390722 275
115 3300025924 Ga0207694_10120723 Ga0207694_101207231 275
116 3300025939 Ga0207665_10169782 Ga0207665_101697822 275
117 3300025949 Ga0207667_10016391 Ga0207667_100163916 275
118 3300026116 Ga0207674_10425890 Ga0207674_104258902 275
119 3300044706 Ga0466964_0082327 Ga0466964_0082327_546_1373 275
120 3300045976 Ga0466967_0243394 Ga0466967_0243394_648_1475 275
121 3300002239 JGI24034J26672_10012152 JGI24034J26672_100121522 276
122 3300003203 JGI25406J46586_10004166 JGI25406J46586_100041661 276
123 3300003323 rootH1_10148054 rootH1_101480544 276
124 3300005329 Ga0070683_100047464 Ga0070683_1000474642 276
125 3300005329 Ga0070683_100058685 Ga0070683_1000586855 276
126 3300005329 Ga0070683_100567391 Ga0070683_1005673912 276
127 3300005334 Ga0068869_100302551 Ga0068869_1003025512 276
128 3300005335 Ga0070666_10001519 Ga0070666_1000151913 276
129 3300005336 Ga0070680_100003356 Ga0070680_1000033568 276
130 3300005337 Ga0070682_100164767 Ga0070682_1001647672 276
131 3300005337 Ga0070682_100284573 Ga0070682_1002845732 276
132 3300005338 Ga0068868_100006600 Ga0068868_1000066007 276
133 3300005338 Ga0068868_100014840 Ga0068868_1000148403 276
134 3300005338 Ga0068868_100095910 Ga0068868_1000959103 276
135 3300005340 Ga0070689_100025037 Ga0070689_1000250374 276
136 3300005340 Ga0070689_100064086 Ga0070689_1000640862 276
137 3300005341 Ga0070691_10032560 Ga0070691_100325603 276
138 3300005344 Ga0070661_100027821 Ga0070661_1000278215 276
139 3300005344 Ga0070661_100056140 Ga0070661_1000561403 276
140 3300005345 Ga0070692_10004704 Ga0070692_100047042 276
141 3300005347 Ga0070668_100075688 Ga0070668_1000756883 276
142 3300005353 Ga0070669_100157035 Ga0070669_1001570353 276
143 3300005353 Ga0070669_100293112 Ga0070669_1002931122 276
144 3300005354 Ga0070675_100011459 Ga0070675_1000114598 276
145 3300005355 Ga0070671_100029020 Ga0070671_1000290201 276
146 3300005355 Ga0070671_100070390 Ga0070671_1000703902 276
147 3300005356 Ga0070674_100050806 Ga0070674_1000508063 276
148 3300005364 Ga0070673_100125100 Ga0070673_1001251002 276
149 3300005364 Ga0070673_100412284 Ga0070673_1004122842 276
150 3300005365 Ga0070688_100369600 Ga0070688_1003696002 276
151 3300005366 Ga0070659_100028160 Ga0070659_1000281604 276
152 3300005366 Ga0070659_100054054 Ga0070659_1000540543 276
153 3300005366 Ga0070659_100080470 Ga0070659_1000804702 276
154 3300005366 Ga0070659_100157125 Ga0070659_1001571253 276
155 3300005367 Ga0070667_100001319 Ga0070667_1000013195 276
156 3300005367 Ga0070667_100221405 Ga0070667_1002214052 276
157 3300005435 Ga0070714_100101954 Ga0070714_1001019542 276
158 3300005436 Ga0070713_100021283 Ga0070713_1000212833 276
159 3300005436 Ga0070713_100292336 Ga0070713_1002923362 276
160 3300005438 Ga0070701_10007973 Ga0070701_100079735 276
161 3300005441 Ga0070700_100152531 Ga0070700_1001525311 276
162 3300005455 Ga0070663_100053721 Ga0070663_1000537213 276
163 3300005455 Ga0070663_100096964 Ga0070663_1000969642 276
164 3300005457 Ga0070662_100023967 Ga0070662_1000239671 276
165 3300005457 Ga0070662_100030809 Ga0070662_1000308093 276
166 3300005458 Ga0070681_10030819 Ga0070681_100308193 276
167 3300005458 Ga0070681_10124606 Ga0070681_101246062 276
168 3300005458 Ga0070681_10507820 Ga0070681_105078201 276
169 3300005459 Ga0068867_100024614 Ga0068867_1000246145 276
170 3300005459 Ga0068867_100119496 Ga0068867_1001194963 276
171 3300005466 Ga0070685_10218465 Ga0070685_102184652 276
172 3300005530 Ga0070679_100007440 Ga0070679_1000074407 276
173 3300005530 Ga0070679_100081404 Ga0070679_1000814043 276
174 3300005530 Ga0070679_100093059 Ga0070679_1000930592 276
175 3300005530 Ga0070679_100406213 Ga0070679_1004062132 276
176 3300005535 Ga0070684_100040482 Ga0070684_1000404822 276
177 3300005535 Ga0070684_100084643 Ga0070684_1000846433 276
178 3300005535 Ga0070684_100111295 Ga0070684_1001112952 276
179 3300005535 Ga0070684_100363303 Ga0070684_1003633032 276
180 3300005539 Ga0068853_100300054 Ga0068853_1003000542 276
181 3300005543 Ga0070672_100205629 Ga0070672_1002056292 276
182 3300005544 Ga0070686_100017998 Ga0070686_1000179984 276
183 3300005546 Ga0070696_100265320 Ga0070696_1002653202 276
184 3300005547 Ga0070693_100138422 Ga0070693_1001384222 276
185 3300005548 Ga0070665_100004948 Ga0070665_10000494810 276
186 3300005548 Ga0070665_100006291 Ga0070665_1000062913 276
187 3300005548 Ga0070665_100083761 Ga0070665_1000837612 276
188 3300005563 Ga0068855_100011077 Ga0068855_1000110773 276
189 3300005563 Ga0068855_100086916 Ga0068855_1000869163 276
190 3300005563 Ga0068855_100180377 Ga0068855_1001803772 276
191 3300005563 Ga0068855_100658154 Ga0068855_1006581542 276
192 3300005564 Ga0070664_100084290 Ga0070664_1000842903 276
193 3300005564 Ga0070664_100091280 Ga0070664_1000912803 276
194 3300005577 Ga0068857_100104153 Ga0068857_1001041533 276
195 3300005577 Ga0068857_100139635 Ga0068857_1001396352 276
196 3300005578 Ga0068854_100095301 Ga0068854_1000953013 276
197 3300005614 Ga0068856_100064942 Ga0068856_1000649422 276
198 3300005614 Ga0068856_100088563 Ga0068856_1000885632 276
199 3300005614 Ga0068856_100157713 Ga0068856_1001577132 276
200 3300005614 Ga0068856_100158055 Ga0068856_1001580552 276
201 3300005615 Ga0070702_100017087 Ga0070702_1000170872 276
202 3300005615 Ga0070702_100115386 Ga0070702_1001153862 276
203 3300005616 Ga0068852_100038941 Ga0068852_1000389413 276
204 3300005616 Ga0068852_100069521 Ga0068852_1000695213 276
205 3300005617 Ga0068859_100021328 Ga0068859_1000213288 276
206 3300005617 Ga0068859_100101825 Ga0068859_1001018254 276
207 3300005617 Ga0068859_100105639 Ga0068859_1001056392 276
208 3300005618 Ga0068864_100066963 Ga0068864_1000669632 276
209 3300005618 Ga0068864_100224665 Ga0068864_1002246652 276
210 3300005719 Ga0068861_100092209 Ga0068861_1000922093 276
211 3300005719 Ga0068861_100374091 Ga0068861_1003740912 276
212 3300005841 Ga0068863_100005225 Ga0068863_10000522511 276
213 3300005841 Ga0068863_100024338 Ga0068863_1000243382 276
214 3300005841 Ga0068863_100117596 Ga0068863_1001175963 276
215 3300005842 Ga0068858_100001170 Ga0068858_1000011706 276
216 3300005842 Ga0068858_100012191 Ga0068858_1000121914 276
217 3300005843 Ga0068860_100001012 Ga0068860_1000010126 276
218 3300005843 Ga0068860_100011906 Ga0068860_10001190610 276
219 3300005843 Ga0068860_100064414 Ga0068860_1000644143 276
220 3300005844 Ga0068862_100366184 Ga0068862_1003661842 276
221 3300005844 Ga0068862_100422282 Ga0068862_1004222822 276
222 3300005937 Ga0081455_10000289 Ga0081455_100002896 276
223 3300005937 Ga0081455_10000746 Ga0081455_1000074615 276
224 3300005985 Ga0081539_10000016 Ga0081539_10000016117 276
225 3300006038 Ga0075365_10000551 Ga0075365_100005512 276
226 3300006038 Ga0075365_10032699 Ga0075365_100326992 276
227 3300006051 Ga0075364_10043556 Ga0075364_100435563 276
228 3300006163 Ga0070715_10027800 Ga0070715_100278003 276
229 3300006178 Ga0075367_10039059 Ga0075367_100390592 276
230 3300006237 Ga0097621_100005410 Ga0097621_1000054107 276
231 3300006358 Ga0068871_100006591 Ga0068871_1000065914 276
232 3300006358 Ga0068871_100602945 Ga0068871_1006029451 276
233 3300006871 Ga0075434_100298348 Ga0075434_1002983482 276
234 3300006881 Ga0068865_100003888 Ga0068865_1000038888 276
235 3300006881 Ga0068865_100021428 Ga0068865_1000214283 276
236 3300006931 Ga0097620_100021327 Ga0097620_1000213278 276
237 3300006931 Ga0097620_100101822 Ga0097620_1001018221 276
238 3300006931 Ga0097620_100105638 Ga0097620_1001056382 276
239 3300009093 Ga0105240_10004116 Ga0105240_1000411613 276
240 3300009093 Ga0105240_10301250 Ga0105240_103012502 276
241 3300009094 Ga0111539_10035839 Ga0111539_100358393 276
242 3300009098 Ga0105245_10004224 Ga0105245_100042246 276
243 3300009098 Ga0105245_10029226 Ga0105245_100292263 276
244 3300009098 Ga0105245_10064430 Ga0105245_100644302 276
245 3300009101 Ga0105247_10033987 Ga0105247_100339873 276
246 3300009148 Ga0105243_10022526 Ga0105243_100225266 276
247 3300009148 Ga0105243_10206465 Ga0105243_102064652 276
248 3300009176 Ga0105242_10061347 Ga0105242_100613472 276
249 3300009176 Ga0105242_10133319 Ga0105242_101333192 276
250 3300009176 Ga0105242_10170149 Ga0105242_101701492 276
251 3300009176 Ga0105242_10332618 Ga0105242_103326182 276
252 3300009177 Ga0105248_10037253 Ga0105248_100372534 276
253 3300009177 Ga0105248_10082234 Ga0105248_100822342 276
254 3300009545 Ga0105237_10154365 Ga0105237_101543652 276
255 3300009545 Ga0105237_10238997 Ga0105237_102389972 276
256 3300009545 Ga0105237_10335856 Ga0105237_103358561 276
257 3300009545 Ga0105237_10434060 Ga0105237_104340602 276
258 3300009551 Ga0105238_10050839 Ga0105238_100508393 276
259 3300009551 Ga0105238_10079012 Ga0105238_100790123 276
260 3300009551 Ga0105238_10079847 Ga0105238_100798472 276
261 3300009551 Ga0105238_10105397 Ga0105238_101053973 276
262 3300009551 Ga0105238_10114364 Ga0105238_101143643 276
263 3300009551 Ga0105238_10247735 Ga0105238_102477352 276
264 3300009553 Ga0105249_10820173 Ga0105249_108201731 276
265 3300010375 Ga0105239_10002773 Ga0105239_1000277318 276
266 3300010375 Ga0105239_10020110 Ga0105239_100201106 276
267 3300010375 Ga0105239_10143248 Ga0105239_101432483 276
268 3300010375 Ga0105239_10665722 Ga0105239_106657222 276
269 3300011119 Ga0105246_10056210 Ga0105246_100562102 276
270 3300013102 Ga0157371_10108798 Ga0157371_101087982 276
271 3300013104 Ga0157370_10232674 Ga0157370_102326742 276
272 3300013105 Ga0157369_10117201 Ga0157369_101172012 276
273 3300013105 Ga0157369_10137853 Ga0157369_101378533 276
274 3300013105 Ga0157369_10473266 Ga0157369_104732662 276
275 3300013296 Ga0157374_10002067 Ga0157374_100020679 276
276 3300013296 Ga0157374_10136792 Ga0157374_101367923 276
277 3300013297 Ga0157378_10006201 Ga0157378_100062017 276
278 3300013306 Ga0163162_10035042 Ga0163162_100350423 276
279 3300013306 Ga0163162_10152669 Ga0163162_101526692 276
280 3300013307 Ga0157372_10153125 Ga0157372_101531253 276
281 3300013308 Ga0157375_10135005 Ga0157375_101350053 276
282 3300014325 Ga0163163_10014563 Ga0163163_100145634 276
283 3300014325 Ga0163163_10234542 Ga0163163_102345422 276
284 3300014326 Ga0157380_10055019 Ga0157380_100550194 276
285 3300014326 Ga0157380_10107937 Ga0157380_101079373 276
286 3300014745 Ga0157377_10005003 Ga0157377_100050035 276
287 3300014745 Ga0157377_10110873 Ga0157377_101108732 276
288 3300014968 Ga0157379_10008362 Ga0157379_100083626 276
289 3300014968 Ga0157379_10027551 Ga0157379_100275513 276
290 3300014968 Ga0157379_10080966 Ga0157379_100809663 276
291 3300014969 Ga0157376_10005732 Ga0157376_100057327 276
292 3300014969 Ga0157376_10010199 Ga0157376_100101995 276
293 3300017792 Ga0163161_10059213 Ga0163161_100592134 276
294 3300021377 Ga0213874_10000147 Ga0213874_100001475 276
295 3300021384 Ga0213876_10009597 Ga0213876_100095973 276
296 3300021384 Ga0213876_10148833 Ga0213876_101488331 276
297 3300021388 Ga0213875_10019000 Ga0213875_100190002 276
298 3300021388 Ga0213875_10023583 Ga0213875_100235832 276
299 3300021388 Ga0213875_10039425 Ga0213875_100394252 276
300 3300021388 Ga0213875_10077375 Ga0213875_100773751 276
301 3300025885 Ga0207653_10004249 Ga0207653_100042492 276
302 3300025893 Ga0207682_10064866 Ga0207682_100648662 276
303 3300025898 Ga0207692_10038960 Ga0207692_100389603 276
304 3300025898 Ga0207692_10147049 Ga0207692_101470492 276
305 3300025900 Ga0207710_10011459 Ga0207710_100114592 276
306 3300025901 Ga0207688_10033854 Ga0207688_100338543 276
307 3300025901 Ga0207688_10120245 Ga0207688_101202452 276
308 3300025903 Ga0207680_10048394 Ga0207680_100483942 276
309 3300025903 Ga0207680_10074714 Ga0207680_100747143 276
310 3300025906 Ga0207699_10035364 Ga0207699_100353643 276
311 3300025908 Ga0207643_10015477 Ga0207643_100154774 276
312 3300025911 Ga0207654_10072006 Ga0207654_100720062 276
313 3300025912 Ga0207707_10306500 Ga0207707_103065002 276
314 3300025913 Ga0207695_10007347 Ga0207695_1000734710 276
315 3300025913 Ga0207695_10063339 Ga0207695_100633392 276
316 3300025913 Ga0207695_10081817 Ga0207695_100818172 276
317 3300025914 Ga0207671_10008474 Ga0207671_100084748 276
318 3300025914 Ga0207671_10053774 Ga0207671_100537742 276
319 3300025915 Ga0207693_10331201 Ga0207693_103312011 276
320 3300025916 Ga0207663_10014787 Ga0207663_100147873 276
321 3300025918 Ga0207662_10019780 Ga0207662_100197803 276
322 3300025919 Ga0207657_10035861 Ga0207657_100358612 276
323 3300025919 Ga0207657_10069646 Ga0207657_100696463 276
324 3300025920 Ga0207649_10197054 Ga0207649_101970542 276
325 3300025921 Ga0207652_10037961 Ga0207652_100379613 276
326 3300025923 Ga0207681_10221204 Ga0207681_102212042 276
327 3300025924 Ga0207694_10046070 Ga0207694_100460702 276
328 3300025924 Ga0207694_10084295 Ga0207694_100842952 276
329 3300025925 Ga0207650_10264004 Ga0207650_102640042 276
330 3300025927 Ga0207687_10012491 Ga0207687_100124912 276
331 3300025927 Ga0207687_10142347 Ga0207687_101423472 276
332 3300025928 Ga0207700_10031445 Ga0207700_100314454 276
333 3300025929 Ga0207664_10092610 Ga0207664_100926102 276
334 3300025932 Ga0207690_10064690 Ga0207690_100646903 276
335 3300025932 Ga0207690_10075950 Ga0207690_100759502 276
336 3300025932 Ga0207690_10158645 Ga0207690_101586452 276
337 3300025933 Ga0207706_10023929 Ga0207706_100239294 276
338 3300025933 Ga0207706_10112822 Ga0207706_101128222 276
339 3300025935 Ga0207709_10094913 Ga0207709_100949132 276
340 3300025938 Ga0207704_10023672 Ga0207704_100236722 276
341 3300025938 Ga0207704_10151926 Ga0207704_101519263 276
342 3300025938 Ga0207704_10276379 Ga0207704_102763792 276
343 3300025939 Ga0207665_10107504 Ga0207665_101075042 276
344 3300025940 Ga0207691_10039399 Ga0207691_100393996 276
345 3300025941 Ga0207711_10011383 Ga0207711_100113836 276
346 3300025942 Ga0207689_10107148 Ga0207689_101071483 276
347 3300025942 Ga0207689_10211460 Ga0207689_102114602 276
348 3300025942 Ga0207689_10305937 Ga0207689_103059372 276
349 3300025944 Ga0207661_10143493 Ga0207661_101434932 276
350 3300025944 Ga0207661_10181027 Ga0207661_101810272 276
351 3300025949 Ga0207667_10002777 Ga0207667_100027778 276
352 3300025949 Ga0207667_10284209 Ga0207667_102842092 276
353 3300025949 Ga0207667_10375222 Ga0207667_103752222 276
354 3300025960 Ga0207651_10371313 Ga0207651_103713131 276
355 3300025961 Ga0207712_10056449 Ga0207712_100564493 276
356 3300025961 Ga0207712_10195585 Ga0207712_101955852 276
357 3300025981 Ga0207640_10070982 Ga0207640_100709822 276
358 3300025986 Ga0207658_10010647 Ga0207658_100106475 276
359 3300026023 Ga0207677_10033634 Ga0207677_100336342 276
360 3300026035 Ga0207703_10001004 Ga0207703_100010046 276
361 3300026035 Ga0207703_10004345 Ga0207703_100043452 276
362 3300026035 Ga0207703_10075358 Ga0207703_100753582 276
363 3300026041 Ga0207639_10058844 Ga0207639_100588442 276
364 3300026041 Ga0207639_10268235 Ga0207639_102682352 276
365 3300026067 Ga0207678_10084915 Ga0207678_100849152 276
366 3300026067 Ga0207678_10089442 Ga0207678_100894422 276
367 3300026067 Ga0207678_10111555 Ga0207678_101115552 276
368 3300026075 Ga0207708_10016970 Ga0207708_100169705 276
369 3300026075 Ga0207708_10259782 Ga0207708_102597822 276
370 3300026078 Ga0207702_10033844 Ga0207702_100338442 276
371 3300026078 Ga0207702_10075397 Ga0207702_100753973 276
372 3300026078 Ga0207702_10189902 Ga0207702_101899021 276
373 3300026078 Ga0207702_10353747 Ga0207702_103537472 276
374 3300026088 Ga0207641_10000871 Ga0207641_100008714 276
375 3300026088 Ga0207641_10011339 Ga0207641_100113396 276
376 3300026088 Ga0207641_10216163 Ga0207641_102161632 276
377 3300026089 Ga0207648_10071201 Ga0207648_100712013 276
378 3300026089 Ga0207648_10086750 Ga0207648_100867502 276
379 3300026095 Ga0207676_10024272 Ga0207676_100242724 276
380 3300026116 Ga0207674_10040638 Ga0207674_100406383 276
381 3300026116 Ga0207674_10300918 Ga0207674_103009182 276
382 3300026118 Ga0207675_100084065 Ga0207675_1000840653 276
383 3300026118 Ga0207675_100137213 Ga0207675_1001372132 276
384 3300026118 Ga0207675_100457512 Ga0207675_1004575121 276
385 3300026121 Ga0207683_10022371 Ga0207683_100223713 276
386 3300026121 Ga0207683_10083083 Ga0207683_100830833 276
387 3300026121 Ga0207683_10147016 Ga0207683_101470162 276
388 3300026142 Ga0207698_10089208 Ga0207698_100892082 276
389 3300026142 Ga0207698_10090339 Ga0207698_100903393 276
390 3300026142 Ga0207698_10401251 Ga0207698_104012512 276
391 3300027907 Ga0207428_10013589 Ga0207428_100135897 276
392 3300028379 Ga0268266_10003099 Ga0268266_1000309912 276
393 3300028379 Ga0268266_10026084 Ga0268266_100260846 276
394 3300028379 Ga0268266_10103400 Ga0268266_101034002 276
395 3300028379 Ga0268266_10259275 Ga0268266_102592752 276
396 3300028379 Ga0268266_10410530 Ga0268266_104105301 276
397 3300028380 Ga0268265_10003739 Ga0268265_100037399 276
398 3300028380 Ga0268265_10033579 Ga0268265_100335794 276
399 3300028380 Ga0268265_10417847 Ga0268265_104178471 276
400 3300028381 Ga0268264_10000518 Ga0268264_1000051814 276
401 3300028381 Ga0268264_10070899 Ga0268264_100708994 276
402 3300028573 Ga0265334_10037433 Ga0265334_100374331 276
403 3300028577 Ga0265318_10003106 Ga0265318_100031064 276
404 3300028654 Ga0265322_10041222 Ga0265322_100412222 276
405 3300031090 Ga0265760_10037586 Ga0265760_100375863 276
406 3300031235 Ga0265330_10025326 Ga0265330_100253263 276
407 3300031242 Ga0265329_10041120 Ga0265329_100411201 276
408 3300031247 Ga0265340_10024228 Ga0265340_100242283 276
409 3300031251 Ga0265327_10025371 Ga0265327_100253713 276
410 3300031344 Ga0265316_10223226 Ga0265316_102232261 276
411 3300031507 Ga0307509_10000005 Ga0307509_1000000528 276
412 3300031595 Ga0265313_10086358 Ga0265313_100863582 276
413 3300033180 Ga0307510_10000001 Ga0307510_10000001593 276
414 3300034957 Ga0373938_0001126 Ga0373938_0001126_2552_3382 276
415 3300035085 Ga0373929_0022239 Ga0373929_0022239_451_1281 276
416 3300035090 Ga0373949_0010749 Ga0373949_0010749_461_1291 276
417 3300035113 Ga0373936_0001046 Ga0373936_0001046_7742_8572 276
418 3300035113 Ga0373936_0013375 Ga0373936_0013375_2289_3119 276
419 3300035116 Ga0373945_0064041 Ga0373945_0064041_368_1198 276
420 3300035170 Ga0373943_0051206 Ga0373943_0051206_752_1582 276
421 3300035172 Ga0373955_0003012 Ga0373955_0003012_640_1470 276
422 3300035172 Ga0373955_0065762 Ga0373955_0065762_1015_1845 276
423 3300035691 Ga0373931_0022264 Ga0373931_0022264_1629_2459 276
424 3300035724 Ga0373933_0026509 Ga0373933_0026509_338_1168 276
425 3300035725 Ga0373947_0185605 Ga0373947_0185605_251_1081 276
426 3300036401 Ga0373937_0002672 Ga0373937_0002672_87_917 276
427 3300036401 Ga0373937_0622993 Ga0373937_0622993_146_976 276
428 3300037853 Ga0436364_0028511 Ga0436364_0028511_17038_17868 276
429 3300037853 Ga0436364_0088869 Ga0436364_0088869_8226_9056 276
430 3300037853 Ga0436364_0291817 Ga0436364_0291817_2528_3358 276
431 3300037853 Ga0436364_0380016 Ga0436364_0380016_1822_2652 276
432 3300037853 Ga0436364_0381743 Ga0436364_0381743_635_1465 276
433 3300037853 Ga0436364_1565546 Ga0436364_1565546_2047_2877 276
434 3300039437 Ga0436365_0116219 Ga0436365_0116219_4964_5794 276
435 3300039437 Ga0436365_0392316 Ga0436365_0392316_2027_2857 276
436 3300039437 Ga0436365_0757770 Ga0436365_0757770_9875_10705 276
437 3300039437 Ga0436365_1310673 Ga0436365_1310673_2850_3680 276
438 3300039437 Ga0436365_1725271 Ga0436365_1725271_2003_2833 276
439 3300039437 Ga0436365_1860495 Ga0436365_1860495_812_1648 276
440 3300039450 Ga0436363_0400823 Ga0436363_0400823_29_859 276
441 3300039450 Ga0436363_0530445 Ga0436363_0530445_626_1456 276
442 3300039450 Ga0436363_0812143 Ga0436363_0812143_11136_11966 276
443 3300039450 Ga0436363_1187238 Ga0436363_1187238_2035_2865 276
444 3300039450 Ga0436363_1553426 Ga0436363_1553426_4129_4959 276
445 3300039453 Ga0436362_0136684 Ga0436362_0136684_562_1392 276
446 3300039453 Ga0436362_0868892 Ga0436362_0868892_582_1412 276
447 3300042016 Ga0439463_056349 Ga0439463_056349_101_931 276
448 3300044735 Ga0466968_0101314 Ga0466968_0101314_116_946 276
449 3300045049 Ga0466959_0049372 Ga0466959_0049372_2077_2907 276
450 3300045836 Ga0466958_0010971 Ga0466958_0010971_3645_4475 276
451 3300045976 Ga0466967_0023312 Ga0466967_0023312_1564_2394 276
452 3300045976 Ga0466967_0090081 Ga0466967_0090081_1179_2009 276
453 3300045976 Ga0466967_0113706 Ga0466967_0113706_78_908 276
454 3300045976 Ga0466967_0479756 Ga0466967_0479756_286_1116 276
455 3300046454 Ga0495592_0028980 Ga0495592_0028980_3192_4022 276
456 3300046454 Ga0495592_0074651 Ga0495592_0074651_341_1171 276
457 3300046455 Ga0495603_0086678 Ga0495603_0086678_658_1488 276
458 3300046455 Ga0495603_0089071 Ga0495603_0089071_249_1079 276
459 3300046455 Ga0495603_0302371 Ga0495603_0302371_23_853 276
460 3300046461 Ga0495641_0049416 Ga0495641_0049416_1049_1879 276
461 3300046462 Ga0495651_0007697 Ga0495651_0007697_1263_2093 276
462 3300046462 Ga0495651_0028653 Ga0495651_0028653_1460_2290 276
463 3300046462 Ga0495651_0103899 Ga0495651_0103899_1128_1958 276
464 3300046463 Ga0495653_0026729 Ga0495653_0026729_564_1394 276
465 3300046473 Ga0495582_0038461 Ga0495582_0038461_637_1467 276
466 3300046491 Ga0495584_0068708 Ga0495584_0068708_367_1197 276
467 3300046491 Ga0495584_0082876 Ga0495584_0082876_514_1344 276
468 3300046500 Ga0495596_0069675 Ga0495596_0069675_65_895 276
469 3300046511 Ga0495608_0007998 Ga0495608_0007998_1586_2416 276
470 3300046514 Ga0495618_0093083 Ga0495618_0093083_109_939 276
471 3300046515 Ga0495620_0061393 Ga0495620_0061393_698_1528 276
472 3300046516 Ga0495628_0153787 Ga0495628_0153787_738_1568 276
473 3300046522 Ga0495643_0127749 Ga0495643_0127749_46_876 276
474 3300046529 Ga0495652_0090884 Ga0495652_0090884_168_998 276
475 3300046529 Ga0495652_0119672 Ga0495652_0119672_1239_2069 276
476 3300046529 Ga0495652_0212978 Ga0495652_0212978_184_1152 276
477 3300046536 Ga0495587_0022877 Ga0495587_0022877_2052_3020 276
478 3300046536 Ga0495587_0042549 Ga0495587_0042549_740_1570 276
479 3300046536 Ga0495587_0147384 Ga0495587_0147384_369_1199 276
480 3300046559 Ga0495667_0001276 Ga0495667_0001276_14969_15799 276
481 3300046559 Ga0495667_0275406 Ga0495667_0275406_70_1038 276
482 3300046616 Ga0495668_0264493 Ga0495668_0264493_18_848 276
483 3300046642 Ga0495634_0080484 Ga0495634_0080484_1262_2092 276
484 3300046660 Ga0495625_0179760 Ga0495625_0179760_317_1168 276
485 3300046663 Ga0495635_0026046 Ga0495635_0026046_34_864 276
486 3300046663 Ga0495635_0063848 Ga0495635_0063848_178_1008 276
487 3300046665 Ga0495661_0177574 Ga0495661_0177574_30_860 276
488 3300046675 Ga0495657_0027846 Ga0495657_0027846_90_920 276
489 3300046675 Ga0495657_0043330 Ga0495657_0043330_747_1715 276
490 3300046678 Ga0495599_0119708 Ga0495599_0119708_417_1247 276
491 3300046678 Ga0495599_0154948 Ga0495599_0154948_110_940 276
492 3300046679 Ga0495623_0116829 Ga0495623_0116829_101_931 276
493 3300046679 Ga0495623_0144909 Ga0495623_0144909_382_1212 276
494 3300046680 Ga0495646_0139755 Ga0495646_0139755_51_881 276
495 3300046683 Ga0495658_0243503 Ga0495658_0243503_118_948 276
496 3300046689 Ga0495613_0123626 Ga0495613_0123626_825_1655 276
497 3300046690 Ga0495624_0158971 Ga0495624_0158971_500_1330 276
498 3300046809 Ga0495600_0017357 Ga0495600_0017357_159_989 276
499 3300047317 Ga0495604_0257411 Ga0495604_0257411_101_931 276
500 3300047321 Ga0495676_0065494 Ga0495676_0065494_1514_2344 276
501 3300047322 Ga0495680_0031108 Ga0495680_0031108_739_1569 276
502 3300047322 Ga0495680_0064440 Ga0495680_0064440_703_1533 276
503 3300047444 Ga0495675_0152270 Ga0495675_0152270_456_1286 276
504 3300047471 Ga0495684_0026250 Ga0495684_0026250_67_897 276
505 3300047471 Ga0495684_0123970 Ga0495684_0123970_949_1779 276
506 3300047471 Ga0495684_0285708 Ga0495684_0285708_246_1076 276
507 3300048088 Ga0495602_0024011 Ga0495602_0024011_5070_5900 276
508 3300048088 Ga0495602_0050026 Ga0495602_0050026_1330_2298 276
509 3300048088 Ga0495602_0089031 Ga0495602_0089031_1222_2052 276
510 3300048903 Ga0496100_0026220 Ga0496100_0026220_2071_2901 276
511 3300048904 Ga0496101_0115530 Ga0496101_0115530_802_1632 276
512 3300048904 Ga0496101_0388067 Ga0496101_0388067_177_1007 276
513 3300048905 Ga0496102_0077300 Ga0496102_0077300_1207_2037 276
514 3300048907 Ga0496104_0004546 Ga0496104_0004546_4972_5802 276
515 3300048907 Ga0496104_0006440 Ga0496104_0006440_1148_1984 276
516 3300048908 Ga0496105_0002204 Ga0496105_0002204_6090_6926 276
517 3300048908 Ga0496105_0056304 Ga0496105_0056304_173_1003 276
518 3300048909 Ga0496106_0127182 Ga0496106_0127182_637_1467 276
519 3300048909 Ga0496106_0303895 Ga0496106_0303895_219_1052 276
520 3300048909 Ga0496106_0360157 Ga0496106_0360157_35_865 276
521 3300048910 Ga0496107_0178567 Ga0496107_0178567_389_1219 276
522 3300048911 Ga0496108_0006037 Ga0496108_0006037_2180_3016 276
523 3300048911 Ga0496108_0018273 Ga0496108_0018273_2729_3559 276
524 3300048911 Ga0496108_0042102 Ga0496108_0042102_47_877 276
525 3300048911 Ga0496108_0537882 Ga0496108_0537882_55_885 276
526 3300048912 Ga0496109_0008081 Ga0496109_0008081_2906_3742 276
527 3300048912 Ga0496109_0037631 Ga0496109_0037631_75_905 276
528 3300048912 Ga0496109_0041338 Ga0496109_0041338_2892_3722 276
529 3300048912 Ga0496109_0150984 Ga0496109_0150984_441_1271 276
530 3300048912 Ga0496109_0196860 Ga0496109_0196860_701_1531 276
531 3300048913 Ga0496110_0017574 Ga0496110_0017574_3910_4746 276
532 3300048913 Ga0496110_0070774 Ga0496110_0070774_849_1679 276
533 3300048913 Ga0496110_0262468 Ga0496110_0262468_181_1011 276
534 3300048914 Ga0496111_0005453 Ga0496111_0005453_3204_4040 276
535 3300048914 Ga0496111_0012868 Ga0496111_0012868_1026_1856 276
536 3300048915 Ga0496112_0032785 Ga0496112_0032785_238_1068 276
537 3300048915 Ga0496112_0033874 Ga0496112_0033874_987_1817 276
538 3300048915 Ga0496112_0232259 Ga0496112_0232259_431_1261 276
539 3300048915 Ga0496112_0602916 Ga0496112_0602916_161_991 276
540 3300048916 Ga0496113_0001704 Ga0496113_0001704_5736_6566 276
541 3300048916 Ga0496113_0076238 Ga0496113_0076238_39_869 276
542 3300048916 Ga0496113_0453542 Ga0496113_0453542_71_901 276
543 3300048917 Ga0496114_0030604 Ga0496114_0030604_1226_2056 276
544 3300048917 Ga0496114_0123511 Ga0496114_0123511_691_1521 276
545 3300048917 Ga0496114_0136431 Ga0496114_0136431_147_977 276
546 3300048917 Ga0496114_0143703 Ga0496114_0143703_903_1733 276
547 3300048917 Ga0496114_0265203 Ga0496114_0265203_37_867 276
548 3300048918 Ga0496115_0407028 Ga0496115_0407028_208_1038 276
549 3300048921 Ga0496118_0252114 Ga0496118_0252114_157_987 276
550 3300048924 Ga0496121_0192582 Ga0496121_0192582_586_1416 276
551 3300048928 Ga0496125_0002119 Ga0496125_0002119_8849_9679 276
552 3300048929 Ga0496126_0047317 Ga0496126_0047317_1705_2535 276
553 3300049568 Ga0501031_0029529 Ga0501031_0029529_1026_1856 276
554 3300049569 Ga0501032_0042393 Ga0501032_0042393_1578_2408 276
555 3300049570 Ga0501033_0019527 Ga0501033_0019527_2771_3601 276
556 3300049571 Ga0501034_0006432 Ga0501034_0006432_9404_10234 276
557 3300049572 Ga0501036_0008102 Ga0501036_0008102_670_1500 276
558 3300049572 Ga0501036_0139507 Ga0501036_0139507_119_949 276
559 3300049572 Ga0501036_0147668 Ga0501036_0147668_293_1123 276
560 3300049574 Ga0501038_0064279 Ga0501038_0064279_579_1409 276
561 3300049574 Ga0501038_0218728 Ga0501038_0218728_561_1391 276
562 3300049575 Ga0501039_0242354 Ga0501039_0242354_24_854 276
563 3300049576 Ga0501040_0022742 Ga0501040_0022742_605_1435 276
564 3300049576 Ga0501040_0048222 Ga0501040_0048222_1653_2483 276
565 3300049576 Ga0501040_0060496 Ga0501040_0060496_502_1332 276
566 3300049576 Ga0501040_0149654 Ga0501040_0149654_152_982 276
567 3300049577 Ga0501041_0014372 Ga0501041_0014372_2380_3210 276
568 3300049577 Ga0501041_0230416 Ga0501041_0230416_53_883 276
569 3300049578 Ga0501042_0037531 Ga0501042_0037531_109_939 276
570 3300049578 Ga0501042_0058929 Ga0501042_0058929_315_1145 276
571 3300049582 Ga0501048_0029249 Ga0501048_0029249_946_1776 276
572 3300049582 Ga0501048_0331648 Ga0501048_0331648_238_1068 276
573 3300049582 Ga0501048_0362302 Ga0501048_0362302_33_863 276
574 3300049583 Ga0501067_0003553 Ga0501067_0003553_3318_4148 276
575 3300049583 Ga0501067_0039307 Ga0501067_0039307_1722_2552 276
576 3300049583 Ga0501067_0236415 Ga0501067_0236415_157_987 276
577 3300049584 Ga0501068_0057210 Ga0501068_0057210_156_986 276
578 3300049585 Ga0501069_0000875 Ga0501069_0000875_3241_4071 276
579 3300049585 Ga0501069_0014840 Ga0501069_0014840_2604_3434 276
580 3300049586 Ga0501070_0012951 Ga0501070_0012951_3235_4065 276
581 3300049586 Ga0501070_0044438 Ga0501070_0044438_834_1664 276
582 3300049586 Ga0501070_0125588 Ga0501070_0125588_677_1507 276
583 3300049587 Ga0501071_0029376 Ga0501071_0029376_1026_1856 276
584 3300049587 Ga0501071_0146921 Ga0501071_0146921_511_1341 276
585 3300049588 Ga0501072_0006425 Ga0501072_0006425_1443_2273 276
586 3300049588 Ga0501072_0030735 Ga0501072_0030735_154_984 276
587 3300049588 Ga0501072_0032620 Ga0501072_0032620_791_1621 276
588 3300049589 Ga0501073_0065413 Ga0501073_0065413_1142_1972 276
589 3300049589 Ga0501073_0072043 Ga0501073_0072043_1378_2208 276
590 3300049590 Ga0501074_0026333 Ga0501074_0026333_570_1400 276
591 3300049590 Ga0501074_0037273 Ga0501074_0037273_125_955 276
592 3300049590 Ga0501074_0055815 Ga0501074_0055815_583_1413 276
593 3300049591 Ga0501075_0008888 Ga0501075_0008888_3449_4279 276
594 3300049591 Ga0501075_0012025 Ga0501075_0012025_5215_6045 276
595 3300049591 Ga0501075_0316874 Ga0501075_0316874_203_1033 276
596 3300049592 Ga0501076_0040468 Ga0501076_0040468_1557_2387 276
597 3300049592 Ga0501076_0126687 Ga0501076_0126687_293_1123 276
598 3300049592 Ga0501076_0243439 Ga0501076_0243439_208_1038 276
599 3300049593 Ga0501077_0023940 Ga0501077_0023940_1553_2383 276
600 3300049593 Ga0501077_0050471 Ga0501077_0050471_1614_2444 276
601 3300049593 Ga0501077_0197409 Ga0501077_0197409_95_925 276
602 3300049741 Ga0501079_0011754 Ga0501079_0011754_3523_4353 276
603 3300049741 Ga0501079_0165116 Ga0501079_0165116_755_1585 276
604 3300049741 Ga0501079_0193996 Ga0501079_0193996_464_1294 276
605 3300049741 Ga0501079_0262341 Ga0501079_0262341_447_1277 276
606 3300049742 Ga0501080_0048773 Ga0501080_0048773_576_1406 276
607 3300049742 Ga0501080_0380310 Ga0501080_0380310_94_924 276
608 3300049742 Ga0501080_0506408 Ga0501080_0506408_72_902 276
609 3300049743 Ga0501081_0099008 Ga0501081_0099008_238_1068 276
610 3300049743 Ga0501081_0122598 Ga0501081_0122598_79_909 276
611 3300049743 Ga0501081_0159749 Ga0501081_0159749_377_1207 276
612 3300049744 Ga0501083_0007534 Ga0501083_0007534_3730_4560 276
613 3300049744 Ga0501083_0023782 Ga0501083_0023782_967_1797 276
614 3300049744 Ga0501083_0041793 Ga0501083_0041793_2083_2913 276
615 3300049744 Ga0501083_0181348 Ga0501083_0181348_417_1247 276
616 3300049822 Ga0501035_0021510 Ga0501035_0021510_5049_5879 276
617 3300049822 Ga0501035_0054011 Ga0501035_0054011_1081_1911 276
618 3300049823 Ga0501044_0046640 Ga0501044_0046640_2253_3083 276
619 3300049824 Ga0501045_0034020 Ga0501045_0034020_1920_2750 276
620 3300049824 Ga0501045_0046018 Ga0501045_0046018_1400_2230 276
621 3300049824 Ga0501045_0168261 Ga0501045_0168261_664_1494 276
622 3300049824 Ga0501045_0213648 Ga0501045_0213648_55_885 276
623 3300050491 nmdc:mga00v17_340768_c1 nmdc:mga00v17_340768_c1_130_960 276
624 3300050492 nmdc:mga0yw44_25303_c1 nmdc:mga0yw44_25303_c1_334_1164 276
625 3300050494 nmdc:mga06z11_116291_c1 nmdc:mga06z11_116291_c1_227_1057 276
626 3300050494 nmdc:mga06z11_81485_c1 nmdc:mga06z11_81485_c1_447_1277 276
627 3300053077 Ga0495601_0073629 Ga0495601_0073629_272_1102 276
628 3300053078 Ga0495612_0123646 Ga0495612_0123646_147_977 276
629 3300053084 Ga0495595_0048749 Ga0495595_0048749_1093_1923 276
630 3300053085 Ga0495619_0013492 Ga0495619_0013492_146_976 276
631 3300053085 Ga0495619_0191749 Ga0495619_0191749_300_1130 276
632 3300053085 Ga0495619_0250047 Ga0495619_0250047_343_1173 276
633 3300053085 Ga0495619_0260840 Ga0495619_0260840_179_1147 276
634 3300053092 Ga0500583_0003848 Ga0500583_0003848_3208_4038 276
635 3300053130 Ga0500642_0044647 Ga0500642_0044647_30_860 276
636 3300054114 Ga0501084_0026444 Ga0501084_0026444_248_1078 276
637 3300054114 Ga0501084_0048089 Ga0501084_0048089_1964_2794 276
638 3300054114 Ga0501084_0221497 Ga0501084_0221497_567_1397 276
639 3300060353 Ga0501082_0040761 Ga0501082_0040761_1834_2664 276
640 3300060353 Ga0501082_0052163 Ga0501082_0052163_253_1083 276
641 3300060353 Ga0501082_0066684 Ga0501082_0066684_213_1043 276
642 3300060353 Ga0501082_0071321 Ga0501082_0071321_488_1318 276
643 3300061734 Ga0530510_0054568 Ga0530510_0054568_1861_2691 276
644 3300061734 Ga0530510_0074563 Ga0530510_0074563_974_1804 276
645 3300061734 Ga0530510_0154817 Ga0530510_0154817_18_848 276
646 3300061734 Ga0530510_0339537 Ga0530510_0339537_230_1060 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

59

269

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

64

317

0.94

PF08659

KR

KR domain

59

145

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9577 6 270
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9545 5 269
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9544 8 269
4za2-assembly1.cif.gz_C crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9544 2 270
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9543 9 270
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 6 67 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9543 9 270 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9532 2 209 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 6 272 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9496 12 270 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534J3R9-F1-model_v4 SDR family oxidoreductase 0.9856 1 276 GO:0016616
GO:0030497
AF-A0A534HFF2-F1-model_v4 SDR family oxidoreductase 0.983 62 276 GO:0016616
AF-A0A534CWY4-F1-model_v4 SDR family oxidoreductase 0.9815 76 276 GO:0016616
AF-A0A1Q4BC21-F1-model_v4 Short-chain dehydrogenase 0.9746 1 276 GO:0016491
AF-A0A0C3IF51-F1-model_v4 Short-chain dehydrogenase 0.9705 1 276 GO:0050664

Feature Viewer

pLDDT pTM Quality
93.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map