F472225
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 646 | 293 | 646 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300046529|Ga0495652_0212978|Ga0495652_0212978_184_1152 |
| Length | 322 |
| Sequence | MKGSVDPGELVIKVVRFYDDSWRQLIVDRLARRTAGRAGAVVSSAYVNVSSRFDVAGFGVIVTGGASGLGLAYAEVLAAHGARVTLIDVDADAVAAQASRMQAEGLDVRGAIADVTDHVTLDRAIDDAAGAYGRLDVAFANAGIDPGVGFVGAWAGGERPRVADGALERYADERWSRVIEINLNGIFATTRAAARHMRPRRFGRIIVTTSLAATKVEPAIGAAYMAAKAGARHLMHTVALELATDGITANAIAPGFFVTNIGGGHAHDPAVQAALAKDIPMHRVGVPDDIKALALFLASPASEYITGQEIVIDGGWGLGVAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 168 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 184 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 289 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.72 |
| Nodule | 0 |
| Rhizoplane | 6.5 |
| Rhizosphere | 84.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10012152 | 3300002239 | Bacteria | 1295 |
| 2 | JGI25406J46586_10004166 | 3300003203 | Bacteria | 6749 |
| 3 | rootH1_10148054 | 3300003323 | Bacteria | 4672 |
| 4 | Ga0070683_100047464 | 3300005329 | Bacteria | 3968 |
| 5 | Ga0070683_100058685 | 3300005329 | Bacteria | 3575 |
| 6 | Ga0070683_100243547 | 3300005329 | Bacteria | 1710 |
| 7 | Ga0070683_100567391 | 3300005329 | Bacteria | 1085 |
| 8 | Ga0068869_100302551 | 3300005334 | Bacteria | 1292 |
| 9 | Ga0070666_10001519 | 3300005335 | Bacteria | 14089 |
| 10 | Ga0070680_100003356 | 3300005336 | Bacteria | 11950 |
| 11 | Ga0070680_100051214 | 3300005336 | Bacteria | 3369 |
| 12 | Ga0070682_100109738 | 3300005337 | Bacteria | 1837 |
| 13 | Ga0070682_100164767 | 3300005337 | Bacteria | 1534 |
| 14 | Ga0070682_100284573 | 3300005337 | Bacteria | 1206 |
| 15 | Ga0068868_100006600 | 3300005338 | Bacteria | 8225 |
| 16 | Ga0068868_100014840 | 3300005338 | Bacteria | 5751 |
| 17 | Ga0068868_100095910 | 3300005338 | Bacteria | 2395 |
| 18 | Ga0070689_100025037 | 3300005340 | Bacteria | 4481 |
| 19 | Ga0070689_100064086 | 3300005340 | Bacteria | 2860 |
| 20 | Ga0070691_10032560 | 3300005341 | Bacteria | 2450 |
| 21 | Ga0070661_100027821 | 3300005344 | Bacteria | 4074 |
| 22 | Ga0070661_100056140 | 3300005344 | Bacteria | 2884 |
| 23 | Ga0070692_10004704 | 3300005345 | Bacteria | 5722 |
| 24 | Ga0070668_100075688 | 3300005347 | Bacteria | 2628 |
| 25 | Ga0070669_100157035 | 3300005353 | Bacteria | 1765 |
| 26 | Ga0070669_100293112 | 3300005353 | Bacteria | 1307 |
| 27 | Ga0070675_100011459 | 3300005354 | Bacteria | 6942 |
| 28 | Ga0070671_100029020 | 3300005355 | Bacteria | 4560 |
| 29 | Ga0070671_100070390 | 3300005355 | Unclassified | 2918 |
| 30 | Ga0070674_100050806 | 3300005356 | Bacteria | 2855 |
| 31 | Ga0070673_100125100 | 3300005364 | Bacteria | 2150 |
| 32 | Ga0070673_100412284 | 3300005364 | Bacteria | 1210 |
| 33 | Ga0070688_100369600 | 3300005365 | Bacteria | 1055 |
| 34 | Ga0070659_100028160 | 3300005366 | Bacteria | 4336 |
| 35 | Ga0070659_100054054 | 3300005366 | Bacteria | 3162 |
| 36 | Ga0070659_100080470 | 3300005366 | Bacteria | 2601 |
| 37 | Ga0070659_100157125 | 3300005366 | Bacteria | 1857 |
| 38 | Ga0070667_100001319 | 3300005367 | Bacteria | 22289 |
| 39 | Ga0070667_100221405 | 3300005367 | Bacteria | 1685 |
| 40 | Ga0070714_100022905 | 3300005435 | Bacteria | 5125 |
| 41 | Ga0070714_100101954 | 3300005435 | Unclassified | 2530 |
| 42 | Ga0070714_100158669 | 3300005435 | Bacteria | 2045 |
| 43 | Ga0070713_100010073 | 3300005436 | Bacteria | 6816 |
| 44 | Ga0070713_100021283 | 3300005436 | Bacteria | 4986 |
| 45 | Ga0070713_100292336 | 3300005436 | Bacteria | 1498 |
| 46 | Ga0070701_10007973 | 3300005438 | Bacteria | 4556 |
| 47 | Ga0070711_100064815 | 3300005439 | Bacteria | 2554 |
| 48 | Ga0070711_100144382 | 3300005439 | Bacteria | 1788 |
| 49 | Ga0070711_100333604 | 3300005439 | Bacteria | 1215 |
| 50 | Ga0070700_100152531 | 3300005441 | Bacteria | 1582 |
| 51 | Ga0070663_100053721 | 3300005455 | Bacteria | 2877 |
| 52 | Ga0070663_100096964 | 3300005455 | Bacteria | 2194 |
| 53 | Ga0070662_100023967 | 3300005457 | Bacteria | 4199 |
| 54 | Ga0070662_100030809 | 3300005457 | Bacteria | 3758 |
| 55 | Ga0070681_10002016 | 3300005458 | Bacteria | 18381 |
| 56 | Ga0070681_10016015 | 3300005458 | Bacteria | 7474 |
| 57 | Ga0070681_10030819 | 3300005458 | Bacteria | 5383 |
| 58 | Ga0070681_10109705 | 3300005458 | Unclassified | 2699 |
| 59 | Ga0070681_10124606 | 3300005458 | Bacteria | 2509 |
| 60 | Ga0070681_10507820 | 3300005458 | Bacteria | 1119 |
| 61 | Ga0068867_100024614 | 3300005459 | Bacteria | 4314 |
| 62 | Ga0068867_100119496 | 3300005459 | Bacteria | 2035 |
| 63 | Ga0070685_10218465 | 3300005466 | Bacteria | 1248 |
| 64 | Ga0070679_100007440 | 3300005530 | Bacteria | 10235 |
| 65 | Ga0070679_100053871 | 3300005530 | Bacteria | 4005 |
| 66 | Ga0070679_100081404 | 3300005530 | Bacteria | 3227 |
| 67 | Ga0070679_100093059 | 3300005530 | Bacteria | 3002 |
| 68 | Ga0070679_100120704 | 3300005530 | Unclassified | 2606 |
| 69 | Ga0070679_100231513 | 3300005530 | Bacteria | 1807 |
| 70 | Ga0070679_100406213 | 3300005530 | Bacteria | 1308 |
| 71 | Ga0070684_100040482 | 3300005535 | Bacteria | 4013 |
| 72 | Ga0070684_100052514 | 3300005535 | Bacteria | 3545 |
| 73 | Ga0070684_100084643 | 3300005535 | Bacteria | 2811 |
| 74 | Ga0070684_100111295 | 3300005535 | Bacteria | 2456 |
| 75 | Ga0070684_100273313 | 3300005535 | Bacteria | 1547 |
| 76 | Ga0070684_100363303 | 3300005535 | Bacteria | 1332 |
| 77 | Ga0068853_100014189 | 3300005539 | Bacteria | 6523 |
| 78 | Ga0068853_100300054 | 3300005539 | Bacteria | 1485 |
| 79 | Ga0068853_100405276 | 3300005539 | Unclassified | 1277 |
| 80 | Ga0070672_100205629 | 3300005543 | Bacteria | 1647 |
| 81 | Ga0070686_100017998 | 3300005544 | Bacteria | 4139 |
| 82 | Ga0070696_100265320 | 3300005546 | Bacteria | 1304 |
| 83 | Ga0070693_100138422 | 3300005547 | Bacteria | 1529 |
| 84 | Ga0070665_100004948 | 3300005548 | Bacteria | 13813 |
| 85 | Ga0070665_100006291 | 3300005548 | Bacteria | 12128 |
| 86 | Ga0070665_100083761 | 3300005548 | Bacteria | 3194 |
| 87 | Ga0068855_100011077 | 3300005563 | Bacteria | 10882 |
| 88 | Ga0068855_100057508 | 3300005563 | Bacteria | 4558 |
| 89 | Ga0068855_100086916 | 3300005563 | Bacteria | 3614 |
| 90 | Ga0068855_100180377 | 3300005563 | Bacteria | 2388 |
| 91 | Ga0068855_100658154 | 3300005563 | Bacteria | 1124 |
| 92 | Ga0070664_100084290 | 3300005564 | Bacteria | 2743 |
| 93 | Ga0070664_100091280 | 3300005564 | Bacteria | 2636 |
| 94 | Ga0068857_100104153 | 3300005577 | Bacteria | 2547 |
| 95 | Ga0068857_100139635 | 3300005577 | Bacteria | 2190 |
| 96 | Ga0068854_100091100 | 3300005578 | Bacteria | 2268 |
| 97 | Ga0068854_100095301 | 3300005578 | Bacteria | 2221 |
| 98 | Ga0068856_100064942 | 3300005614 | Bacteria | 3606 |
| 99 | Ga0068856_100088563 | 3300005614 | Bacteria | 3078 |
| 100 | Ga0068856_100157713 | 3300005614 | Bacteria | 2279 |
| 101 | Ga0068856_100158055 | 3300005614 | Bacteria | 2277 |
| 102 | Ga0070702_100017087 | 3300005615 | Bacteria | 3735 |
| 103 | Ga0070702_100115386 | 3300005615 | Bacteria | 1673 |
| 104 | Ga0068852_100000594 | 3300005616 | Bacteria | 23810 |
| 105 | Ga0068852_100038941 | 3300005616 | Bacteria | 3999 |
| 106 | Ga0068852_100069521 | 3300005616 | Bacteria | 3087 |
| 107 | Ga0068859_100021328 | 3300005617 | Bacteria | 6500 |
| 108 | Ga0068859_100101825 | 3300005617 | Bacteria | 2929 |
| 109 | Ga0068859_100105639 | 3300005617 | Unclassified | 2875 |
| 110 | Ga0068864_100066963 | 3300005618 | Unclassified | 3118 |
| 111 | Ga0068864_100224665 | 3300005618 | Bacteria | 1734 |
| 112 | Ga0068861_100092209 | 3300005719 | Bacteria | 2393 |
| 113 | Ga0068861_100374091 | 3300005719 | Bacteria | 1257 |
| 114 | Ga0068863_100005225 | 3300005841 | Bacteria | 12813 |
| 115 | Ga0068863_100024338 | 3300005841 | Bacteria | 5775 |
| 116 | Ga0068863_100117596 | 3300005841 | Bacteria | 2533 |
| 117 | Ga0068858_100001170 | 3300005842 | Bacteria | 27211 |
| 118 | Ga0068858_100012191 | 3300005842 | Bacteria | 8105 |
| 119 | Ga0068860_100001012 | 3300005843 | Bacteria | 31132 |
| 120 | Ga0068860_100011906 | 3300005843 | Bacteria | 8573 |
| 121 | Ga0068860_100064414 | 3300005843 | Bacteria | 3481 |
| 122 | Ga0068862_100366184 | 3300005844 | Unclassified | 1341 |
| 123 | Ga0068862_100422282 | 3300005844 | Bacteria | 1251 |
| 124 | Ga0081455_10000289 | 3300005937 | Bacteria | 66552 |
| 125 | Ga0081455_10000746 | 3300005937 | Bacteria | 42273 |
| 126 | Ga0081539_10000016 | 3300005985 | Bacteria | 381648 |
| 127 | Ga0070717_10035797 | 3300006028 | Bacteria | 4022 |
| 128 | Ga0070717_10057790 | 3300006028 | Unclassified | 3207 |
| 129 | Ga0075365_10000551 | 3300006038 | Bacteria | 14473 |
| 130 | Ga0075365_10032699 | 3300006038 | Bacteria | 3347 |
| 131 | Ga0075365_10057429 | 3300006038 | Bacteria | 2589 |
| 132 | Ga0075363_100064994 | 3300006048 | Bacteria | 1971 |
| 133 | Ga0075364_10010262 | 3300006051 | Bacteria | 5652 |
| 134 | Ga0075364_10043556 | 3300006051 | Bacteria | 2919 |
| 135 | Ga0070715_10027800 | 3300006163 | Bacteria | 2262 |
| 136 | Ga0070716_100019232 | 3300006173 | Bacteria | 3567 |
| 137 | Ga0070712_100020269 | 3300006175 | Bacteria | 4349 |
| 138 | Ga0070712_100029909 | 3300006175 | Bacteria | 3655 |
| 139 | Ga0075362_10015905 | 3300006177 | Bacteria | 3069 |
| 140 | Ga0075367_10039059 | 3300006178 | Bacteria | 2766 |
| 141 | Ga0075367_10109849 | 3300006178 | Bacteria | 1692 |
| 142 | Ga0097621_100005410 | 3300006237 | Bacteria | 8999 |
| 143 | Ga0068871_100006591 | 3300006358 | Bacteria | 8233 |
| 144 | Ga0068871_100602945 | 3300006358 | Bacteria | 999 |
| 145 | Ga0075434_100298348 | 3300006871 | Bacteria | 1632 |
| 146 | Ga0068865_100003888 | 3300006881 | Bacteria | 8961 |
| 147 | Ga0068865_100021428 | 3300006881 | Bacteria | 4202 |
| 148 | Ga0068865_100367515 | 3300006881 | Bacteria | 1170 |
| 149 | Ga0097620_100021327 | 3300006931 | Bacteria | 6500 |
| 150 | Ga0097620_100101822 | 3300006931 | Bacteria | 2929 |
| 151 | Ga0097620_100105638 | 3300006931 | Unclassified | 2875 |
| 152 | Ga0105240_10001872 | 3300009093 | Bacteria | 34979 |
| 153 | Ga0105240_10004116 | 3300009093 | Bacteria | 22324 |
| 154 | Ga0105240_10022760 | 3300009093 | Bacteria | 8301 |
| 155 | Ga0105240_10046552 | 3300009093 | Bacteria | 5495 |
| 156 | Ga0105240_10301250 | 3300009093 | Bacteria | 1834 |
| 157 | Ga0111539_10035839 | 3300009094 | Bacteria | 6005 |
| 158 | Ga0105245_10004224 | 3300009098 | Bacteria | 12751 |
| 159 | Ga0105245_10029226 | 3300009098 | Bacteria | 4868 |
| 160 | Ga0105245_10064430 | 3300009098 | Bacteria | 3312 |
| 161 | Ga0105247_10033987 | 3300009101 | Bacteria | 3105 |
| 162 | Ga0105243_10021928 | 3300009148 | Bacteria | 4850 |
| 163 | Ga0105243_10022526 | 3300009148 | Bacteria | 4789 |
| 164 | Ga0105243_10206465 | 3300009148 | Bacteria | 1727 |
| 165 | Ga0105242_10061347 | 3300009176 | Unclassified | 3092 |
| 166 | Ga0105242_10133319 | 3300009176 | Bacteria | 2147 |
| 167 | Ga0105242_10170149 | 3300009176 | Bacteria | 1914 |
| 168 | Ga0105242_10332618 | 3300009176 | Bacteria | 1397 |
| 169 | Ga0105248_10037253 | 3300009177 | Bacteria | 5441 |
| 170 | Ga0105248_10082234 | 3300009177 | Bacteria | 3621 |
| 171 | Ga0105248_11121230 | 3300009177 | Bacteria | 889 |
| 172 | Ga0105237_10154365 | 3300009545 | Bacteria | 2292 |
| 173 | Ga0105237_10238997 | 3300009545 | Bacteria | 1817 |
| 174 | Ga0105237_10335856 | 3300009545 | Bacteria | 1515 |
| 175 | Ga0105237_10434060 | 3300009545 | Bacteria | 1319 |
| 176 | Ga0105238_10023381 | 3300009551 | Bacteria | 6300 |
| 177 | Ga0105238_10050839 | 3300009551 | Bacteria | 4171 |
| 178 | Ga0105238_10079012 | 3300009551 | Bacteria | 3280 |
| 179 | Ga0105238_10079847 | 3300009551 | Bacteria | 3261 |
| 180 | Ga0105238_10105397 | 3300009551 | Bacteria | 2801 |
| 181 | Ga0105238_10114364 | 3300009551 | Bacteria | 2678 |
| 182 | Ga0105238_10155595 | 3300009551 | Bacteria | 2261 |
| 183 | Ga0105238_10176633 | 3300009551 | Bacteria | 2112 |
| 184 | Ga0105238_10247735 | 3300009551 | Bacteria | 1759 |
| 185 | Ga0105249_10820173 | 3300009553 | Bacteria | 995 |
| 186 | Ga0105239_10002773 | 3300010375 | Bacteria | 21962 |
| 187 | Ga0105239_10020110 | 3300010375 | Bacteria | 7365 |
| 188 | Ga0105239_10143248 | 3300010375 | Bacteria | 2664 |
| 189 | Ga0105239_10665722 | 3300010375 | Bacteria | 1189 |
| 190 | Ga0105246_10056210 | 3300011119 | Bacteria | 2719 |
| 191 | Ga0157371_10108798 | 3300013102 | Bacteria | 1967 |
| 192 | Ga0157370_10232674 | 3300013104 | Bacteria | 1705 |
| 193 | Ga0157370_10271043 | 3300013104 | Unclassified | 1568 |
| 194 | Ga0157369_10023185 | 3300013105 | Bacteria | 6915 |
| 195 | Ga0157369_10057229 | 3300013105 | Bacteria | 4207 |
| 196 | Ga0157369_10117201 | 3300013105 | Bacteria | 2827 |
| 197 | Ga0157369_10137853 | 3300013105 | Bacteria | 2582 |
| 198 | Ga0157369_10259559 | 3300013105 | Bacteria | 1812 |
| 199 | Ga0157369_10473266 | 3300013105 | Bacteria | 1296 |
| 200 | Ga0157374_10002067 | 3300013296 | Bacteria | 16889 |
| 201 | Ga0157374_10136792 | 3300013296 | Bacteria | 2376 |
| 202 | Ga0157378_10006201 | 3300013297 | Bacteria | 10464 |
| 203 | Ga0163162_10035042 | 3300013306 | Bacteria | 4996 |
| 204 | Ga0163162_10152669 | 3300013306 | Unclassified | 2428 |
| 205 | Ga0157372_10153125 | 3300013307 | Bacteria | 2662 |
| 206 | Ga0157372_10199420 | 3300013307 | Bacteria | 2318 |
| 207 | Ga0157372_10669140 | 3300013307 | Bacteria | 1209 |
| 208 | Ga0157375_10135005 | 3300013308 | Bacteria | 2590 |
| 209 | Ga0163163_10014563 | 3300014325 | Bacteria | 7234 |
| 210 | Ga0163163_10234542 | 3300014325 | Bacteria | 1884 |
| 211 | Ga0157380_10055019 | 3300014326 | Bacteria | 3158 |
| 212 | Ga0157380_10107937 | 3300014326 | Bacteria | 2332 |
| 213 | Ga0157377_10005003 | 3300014745 | Bacteria | 6182 |
| 214 | Ga0157377_10110873 | 3300014745 | Bacteria | 1649 |
| 215 | Ga0157379_10008362 | 3300014968 | Bacteria | 8992 |
| 216 | Ga0157379_10027551 | 3300014968 | Bacteria | 5059 |
| 217 | Ga0157379_10080966 | 3300014968 | Bacteria | 2909 |
| 218 | Ga0157376_10005732 | 3300014969 | Bacteria | 8697 |
| 219 | Ga0157376_10010199 | 3300014969 | Bacteria | 6860 |
| 220 | Ga0163161_10059213 | 3300017792 | Bacteria | 2785 |
| 221 | Ga0163161_10074237 | 3300017792 | Bacteria | 2494 |
| 222 | Ga0213874_10000147 | 3300021377 | Bacteria | 12174 |
| 223 | Ga0213874_10016645 | 3300021377 | Bacteria | 1961 |
| 224 | Ga0213874_10056154 | 3300021377 | Bacteria | 1221 |
| 225 | Ga0213876_10009597 | 3300021384 | Bacteria | 5206 |
| 226 | Ga0213876_10115109 | 3300021384 | Bacteria | 1427 |
| 227 | Ga0213876_10148833 | 3300021384 | Bacteria | 1245 |
| 228 | Ga0213875_10019000 | 3300021388 | Bacteria | 3308 |
| 229 | Ga0213875_10023583 | 3300021388 | Bacteria | 2938 |
| 230 | Ga0213875_10039425 | 3300021388 | Bacteria | 2225 |
| 231 | Ga0213875_10077375 | 3300021388 | Unclassified | 1552 |
| 232 | Ga0207653_10004249 | 3300025885 | Bacteria | 4500 |
| 233 | Ga0207682_10064866 | 3300025893 | Bacteria | 1536 |
| 234 | Ga0207692_10038960 | 3300025898 | Bacteria | 2334 |
| 235 | Ga0207692_10147049 | 3300025898 | Bacteria | 1346 |
| 236 | Ga0207710_10011459 | 3300025900 | Bacteria | 3733 |
| 237 | Ga0207688_10033854 | 3300025901 | Bacteria | 2827 |
| 238 | Ga0207688_10120245 | 3300025901 | Bacteria | 1532 |
| 239 | Ga0207680_10048394 | 3300025903 | Unclassified | 2525 |
| 240 | Ga0207680_10074714 | 3300025903 | Bacteria | 2111 |
| 241 | Ga0207699_10035364 | 3300025906 | Bacteria | 2842 |
| 242 | Ga0207699_10097454 | 3300025906 | Bacteria | 1858 |
| 243 | Ga0207643_10015477 | 3300025908 | Bacteria | 4152 |
| 244 | Ga0207654_10072006 | 3300025911 | Bacteria | 2056 |
| 245 | Ga0207707_10000659 | 3300025912 | Bacteria | 34203 |
| 246 | Ga0207707_10005489 | 3300025912 | Bacteria | 11084 |
| 247 | Ga0207707_10306500 | 3300025912 | Bacteria | 1373 |
| 248 | Ga0207695_10007347 | 3300025913 | Bacteria | 14061 |
| 249 | Ga0207695_10063339 | 3300025913 | Bacteria | 3813 |
| 250 | Ga0207695_10081817 | 3300025913 | Bacteria | 3267 |
| 251 | Ga0207695_10105229 | 3300025913 | Bacteria | 2810 |
| 252 | Ga0207695_10109519 | 3300025913 | Bacteria | 2743 |
| 253 | Ga0207671_10008474 | 3300025914 | Bacteria | 8714 |
| 254 | Ga0207671_10053774 | 3300025914 | Unclassified | 2984 |
| 255 | Ga0207693_10001765 | 3300025915 | Bacteria | 18972 |
| 256 | Ga0207693_10331201 | 3300025915 | Bacteria | 1192 |
| 257 | Ga0207663_10014787 | 3300025916 | Bacteria | 4286 |
| 258 | Ga0207660_10011567 | 3300025917 | Bacteria | 5750 |
| 259 | Ga0207662_10019780 | 3300025918 | Bacteria | 3837 |
| 260 | Ga0207657_10035861 | 3300025919 | Bacteria | 4443 |
| 261 | Ga0207657_10069646 | 3300025919 | Bacteria | 2984 |
| 262 | Ga0207649_10197054 | 3300025920 | Bacteria | 1420 |
| 263 | Ga0207652_10009622 | 3300025921 | Bacteria | 7774 |
| 264 | Ga0207652_10037961 | 3300025921 | Bacteria | 4080 |
| 265 | Ga0207652_10039072 | 3300025921 | Bacteria | 4026 |
| 266 | Ga0207681_10221204 | 3300025923 | Bacteria | 1465 |
| 267 | Ga0207694_10046070 | 3300025924 | Bacteria | 3370 |
| 268 | Ga0207694_10084295 | 3300025924 | Bacteria | 2500 |
| 269 | Ga0207694_10120723 | 3300025924 | Bacteria | 2093 |
| 270 | Ga0207650_10264004 | 3300025925 | Bacteria | 1397 |
| 271 | Ga0207687_10012491 | 3300025927 | Bacteria | 5547 |
| 272 | Ga0207687_10142347 | 3300025927 | Bacteria | 1821 |
| 273 | Ga0207700_10031445 | 3300025928 | Bacteria | 3771 |
| 274 | Ga0207700_10084703 | 3300025928 | Bacteria | 2486 |
| 275 | Ga0207700_10152790 | 3300025928 | Bacteria | 1909 |
| 276 | Ga0207700_10546833 | 3300025928 | Bacteria | 1028 |
| 277 | Ga0207664_10009304 | 3300025929 | Bacteria | 6889 |
| 278 | Ga0207664_10092610 | 3300025929 | Unclassified | 2481 |
| 279 | Ga0207664_10675744 | 3300025929 | Bacteria | 928 |
| 280 | Ga0207690_10064690 | 3300025932 | Bacteria | 2498 |
| 281 | Ga0207690_10075950 | 3300025932 | Bacteria | 2331 |
| 282 | Ga0207690_10158645 | 3300025932 | Bacteria | 1684 |
| 283 | Ga0207706_10023929 | 3300025933 | Bacteria | 5479 |
| 284 | Ga0207706_10112822 | 3300025933 | Bacteria | 2391 |
| 285 | Ga0207709_10094913 | 3300025935 | Bacteria | 1959 |
| 286 | Ga0207709_10130259 | 3300025935 | Bacteria | 1713 |
| 287 | Ga0207704_10023672 | 3300025938 | Unclassified | 3314 |
| 288 | Ga0207704_10151330 | 3300025938 | Bacteria | 1638 |
| 289 | Ga0207704_10151926 | 3300025938 | Bacteria | 1635 |
| 290 | Ga0207704_10276379 | 3300025938 | Bacteria | 1274 |
| 291 | Ga0207665_10107504 | 3300025939 | Bacteria | 1956 |
| 292 | Ga0207665_10169782 | 3300025939 | Bacteria | 1574 |
| 293 | Ga0207691_10039399 | 3300025940 | Bacteria | 4372 |
| 294 | Ga0207711_10011383 | 3300025941 | Bacteria | 7393 |
| 295 | Ga0207689_10107148 | 3300025942 | Bacteria | 2297 |
| 296 | Ga0207689_10211460 | 3300025942 | Bacteria | 1602 |
| 297 | Ga0207689_10305937 | 3300025942 | Bacteria | 1318 |
| 298 | Ga0207661_10143493 | 3300025944 | Bacteria | 2057 |
| 299 | Ga0207661_10181027 | 3300025944 | Bacteria | 1841 |
| 300 | Ga0207667_10002777 | 3300025949 | Bacteria | 21665 |
| 301 | Ga0207667_10016391 | 3300025949 | Bacteria | 8376 |
| 302 | Ga0207667_10284209 | 3300025949 | Bacteria | 1690 |
| 303 | Ga0207667_10375222 | 3300025949 | Bacteria | 1449 |
| 304 | Ga0207651_10371313 | 3300025960 | Unclassified | 1210 |
| 305 | Ga0207712_10056449 | 3300025961 | Bacteria | 2766 |
| 306 | Ga0207712_10058428 | 3300025961 | Bacteria | 2725 |
| 307 | Ga0207712_10195585 | 3300025961 | Bacteria | 1599 |
| 308 | Ga0207640_10070982 | 3300025981 | Bacteria | 2344 |
| 309 | Ga0207658_10010647 | 3300025986 | Bacteria | 6251 |
| 310 | Ga0207677_10033634 | 3300026023 | Bacteria | 3310 |
| 311 | Ga0207703_10001004 | 3300026035 | Bacteria | 27105 |
| 312 | Ga0207703_10004345 | 3300026035 | Bacteria | 11646 |
| 313 | Ga0207703_10075358 | 3300026035 | Bacteria | 2796 |
| 314 | Ga0207639_10058844 | 3300026041 | Bacteria | 2957 |
| 315 | Ga0207639_10268235 | 3300026041 | Bacteria | 1496 |
| 316 | Ga0207678_10084915 | 3300026067 | Bacteria | 2707 |
| 317 | Ga0207678_10089442 | 3300026067 | Bacteria | 2632 |
| 318 | Ga0207678_10111555 | 3300026067 | Bacteria | 2333 |
| 319 | Ga0207708_10016970 | 3300026075 | Bacteria | 5481 |
| 320 | Ga0207708_10259782 | 3300026075 | Bacteria | 1402 |
| 321 | Ga0207702_10033844 | 3300026078 | Bacteria | 4271 |
| 322 | Ga0207702_10075397 | 3300026078 | Bacteria | 2914 |
| 323 | Ga0207702_10189902 | 3300026078 | Bacteria | 1897 |
| 324 | Ga0207702_10353747 | 3300026078 | Bacteria | 1406 |
| 325 | Ga0207641_10000871 | 3300026088 | Bacteria | 31582 |
| 326 | Ga0207641_10011339 | 3300026088 | Bacteria | 7317 |
| 327 | Ga0207641_10216163 | 3300026088 | Bacteria | 1775 |
| 328 | Ga0207648_10071201 | 3300026089 | Bacteria | 3030 |
| 329 | Ga0207648_10086750 | 3300026089 | Bacteria | 2731 |
| 330 | Ga0207676_10024272 | 3300026095 | Unclassified | 4485 |
| 331 | Ga0207674_10040638 | 3300026116 | Bacteria | 4817 |
| 332 | Ga0207674_10300918 | 3300026116 | Bacteria | 1553 |
| 333 | Ga0207674_10425890 | 3300026116 | Bacteria | 1282 |
| 334 | Ga0207675_100084065 | 3300026118 | Bacteria | 2986 |
| 335 | Ga0207675_100137213 | 3300026118 | Bacteria | 2322 |
| 336 | Ga0207675_100145624 | 3300026118 | Bacteria | 2252 |
| 337 | Ga0207675_100457512 | 3300026118 | Bacteria | 1265 |
| 338 | Ga0207683_10022371 | 3300026121 | Bacteria | 5426 |
| 339 | Ga0207683_10083083 | 3300026121 | Bacteria | 2846 |
| 340 | Ga0207683_10147016 | 3300026121 | Bacteria | 2126 |
| 341 | Ga0207698_10089208 | 3300026142 | Bacteria | 2517 |
| 342 | Ga0207698_10090339 | 3300026142 | Bacteria | 2504 |
| 343 | Ga0207698_10401251 | 3300026142 | Bacteria | 1310 |
| 344 | Ga0207428_10013589 | 3300027907 | Bacteria | 7105 |
| 345 | Ga0268266_10003099 | 3300028379 | Bacteria | 16936 |
| 346 | Ga0268266_10026084 | 3300028379 | Bacteria | 4972 |
| 347 | Ga0268266_10103400 | 3300028379 | Bacteria | 2513 |
| 348 | Ga0268266_10259275 | 3300028379 | Bacteria | 1611 |
| 349 | Ga0268266_10410530 | 3300028379 | Bacteria | 1282 |
| 350 | Ga0268265_10003739 | 3300028380 | Bacteria | 10821 |
| 351 | Ga0268265_10033579 | 3300028380 | Bacteria | 3732 |
| 352 | Ga0268265_10417847 | 3300028380 | Bacteria | 1244 |
| 353 | Ga0268264_10000518 | 3300028381 | Bacteria | 48829 |
| 354 | Ga0268264_10070899 | 3300028381 | Bacteria | 2951 |
| 355 | Ga0265334_10037433 | 3300028573 | Bacteria | 1912 |
| 356 | Ga0265318_10003106 | 3300028577 | Bacteria | 8526 |
| 357 | Ga0265322_10041222 | 3300028654 | Bacteria | 1314 |
| 358 | Ga0265760_10037586 | 3300031090 | Bacteria | 1438 |
| 359 | Ga0265330_10025326 | 3300031235 | Bacteria | 2690 |
| 360 | Ga0265329_10041120 | 3300031242 | Bacteria | 1483 |
| 361 | Ga0265340_10024228 | 3300031247 | Bacteria | 3085 |
| 362 | Ga0265327_10025371 | 3300031251 | Bacteria | 3457 |
| 363 | Ga0265316_10223226 | 3300031344 | Bacteria | 1389 |
| 364 | Ga0307509_10000005 | 3300031507 | Bacteria | 435959 |
| 365 | Ga0265313_10086358 | 3300031595 | Bacteria | 1416 |
| 366 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 367 | Ga0373938_0001126 | 3300034957 | Bacteria | 4302 |
| 368 | Ga0373929_0022239 | 3300035085 | Bacteria | 1293 |
| 369 | Ga0373949_0010749 | 3300035090 | Bacteria | 2010 |
| 370 | Ga0373936_0001046 | 3300035113 | Bacteria | 9889 |
| 371 | Ga0373936_0013375 | 3300035113 | Bacteria | 3133 |
| 372 | Ga0373945_0064041 | 3300035116 | Bacteria | 1378 |
| 373 | Ga0373943_0051206 | 3300035170 | Bacteria | 2032 |
| 374 | Ga0373955_0003012 | 3300035172 | Bacteria | 7383 |
| 375 | Ga0373955_0065762 | 3300035172 | Bacteria | 2014 |
| 376 | Ga0373931_0022264 | 3300035691 | Bacteria | 3188 |
| 377 | Ga0373933_0026509 | 3300035724 | Bacteria | 3329 |
| 378 | Ga0373933_0139129 | 3300035724 | Bacteria | 1532 |
| 379 | Ga0373947_0185605 | 3300035725 | Bacteria | 1356 |
| 380 | Ga0373937_0002672 | 3300036401 | Bacteria | 14863 |
| 381 | Ga0373937_0622993 | 3300036401 | Bacteria | 1024 |
| 382 | Ga0436364_0028511 | 3300037853 | Bacteria | 42380 |
| 383 | Ga0436364_0088869 | 3300037853 | Bacteria | 14691 |
| 384 | Ga0436364_0291817 | 3300037853 | Bacteria | 5502 |
| 385 | Ga0436364_0380016 | 3300037853 | Bacteria | 7125 |
| 386 | Ga0436364_0381743 | 3300037853 | Bacteria | 1578 |
| 387 | Ga0436364_1565546 | 3300037853 | Bacteria | 3551 |
| 388 | Ga0436365_0116219 | 3300039437 | Bacteria | 10872 |
| 389 | Ga0436365_0392316 | 3300039437 | Bacteria | 5703 |
| 390 | Ga0436365_0757770 | 3300039437 | Bacteria | 17434 |
| 391 | Ga0436365_1310673 | 3300039437 | Bacteria | 4156 |
| 392 | Ga0436365_1725271 | 3300039437 | Bacteria | 17905 |
| 393 | Ga0436365_1860495 | 3300039437 | Bacteria | 1838 |
| 394 | Ga0436363_0054480 | 3300039450 | Bacteria | 7588 |
| 395 | Ga0436363_0400823 | 3300039450 | Bacteria | 2114 |
| 396 | Ga0436363_0530445 | 3300039450 | Bacteria | 1522 |
| 397 | Ga0436363_0812143 | 3300039450 | Bacteria | 15027 |
| 398 | Ga0436363_1187238 | 3300039450 | Bacteria | 4830 |
| 399 | Ga0436363_1553426 | 3300039450 | Bacteria | 5153 |
| 400 | Ga0436363_1649388 | 3300039450 | Unclassified | 1187 |
| 401 | Ga0436362_0136684 | 3300039453 | Bacteria | 2120 |
| 402 | Ga0436362_0868892 | 3300039453 | Bacteria | 1794 |
| 403 | Ga0439463_056349 | 3300042016 | Bacteria | 1004 |
| 404 | Ga0466964_0082327 | 3300044706 | Bacteria | 1384 |
| 405 | Ga0466968_0101314 | 3300044735 | Bacteria | 1286 |
| 406 | Ga0466959_0049372 | 3300045049 | Bacteria | 3091 |
| 407 | Ga0466958_0010971 | 3300045836 | Bacteria | 5092 |
| 408 | Ga0466967_0023312 | 3300045976 | Bacteria | 5069 |
| 409 | Ga0466967_0090081 | 3300045976 | Bacteria | 2786 |
| 410 | Ga0466967_0113706 | 3300045976 | Bacteria | 2491 |
| 411 | Ga0466967_0243394 | 3300045976 | Bacteria | 1716 |
| 412 | Ga0466967_0479756 | 3300045976 | Unclassified | 1218 |
| 413 | Ga0495592_0028980 | 3300046454 | Bacteria | 4191 |
| 414 | Ga0495592_0074651 | 3300046454 | Bacteria | 2463 |
| 415 | Ga0495603_0086678 | 3300046455 | Bacteria | 1833 |
| 416 | Ga0495603_0089071 | 3300046455 | Bacteria | 1806 |
| 417 | Ga0495603_0302371 | 3300046455 | Unclassified | 919 |
| 418 | Ga0495641_0049416 | 3300046461 | Bacteria | 1925 |
| 419 | Ga0495651_0007697 | 3300046462 | Bacteria | 8238 |
| 420 | Ga0495651_0028653 | 3300046462 | Bacteria | 4340 |
| 421 | Ga0495651_0103899 | 3300046462 | Bacteria | 2110 |
| 422 | Ga0495653_0026729 | 3300046463 | Bacteria | 4625 |
| 423 | Ga0495580_0001449 | 3300046472 | Bacteria | 20800 |
| 424 | Ga0495580_0036525 | 3300046472 | Bacteria | 3527 |
| 425 | Ga0495582_0038461 | 3300046473 | Bacteria | 2633 |
| 426 | Ga0495582_0191961 | 3300046473 | Bacteria | 1166 |
| 427 | Ga0495664_0088698 | 3300046477 | Bacteria | 1859 |
| 428 | Ga0495584_0068708 | 3300046491 | Bacteria | 1780 |
| 429 | Ga0495584_0082876 | 3300046491 | Bacteria | 1615 |
| 430 | Ga0495596_0069675 | 3300046500 | Bacteria | 1367 |
| 431 | Ga0495608_0007998 | 3300046511 | Bacteria | 7434 |
| 432 | Ga0495608_0254096 | 3300046511 | Bacteria | 1095 |
| 433 | Ga0495618_0093083 | 3300046514 | Unclassified | 1927 |
| 434 | Ga0495620_0061393 | 3300046515 | Bacteria | 1564 |
| 435 | Ga0495628_0153787 | 3300046516 | Unclassified | 1751 |
| 436 | Ga0495628_0304128 | 3300046516 | Bacteria | 1180 |
| 437 | Ga0495643_0127749 | 3300046522 | Bacteria | 1279 |
| 438 | Ga0495652_0090884 | 3300046529 | Bacteria | 2497 |
| 439 | Ga0495652_0119672 | 3300046529 | Bacteria | 2103 |
| 440 | Ga0495652_0174833 | 3300046529 | Bacteria | 1654 |
| 441 | Ga0495652_0212978 | 3300046529 | Bacteria | 1457 |
| 442 | Ga0495587_0022877 | 3300046536 | Bacteria | 3845 |
| 443 | Ga0495587_0042549 | 3300046536 | Bacteria | 2709 |
| 444 | Ga0495587_0147384 | 3300046536 | Bacteria | 1342 |
| 445 | Ga0495667_0001276 | 3300046559 | Bacteria | 16489 |
| 446 | Ga0495667_0275406 | 3300046559 | Bacteria | 1068 |
| 447 | Ga0495668_0264493 | 3300046616 | Bacteria | 942 |
| 448 | Ga0495634_0080484 | 3300046642 | Bacteria | 2132 |
| 449 | Ga0495634_0085852 | 3300046642 | Bacteria | 2051 |
| 450 | Ga0495625_0179760 | 3300046660 | Bacteria | 1408 |
| 451 | Ga0495635_0026046 | 3300046663 | Bacteria | 4073 |
| 452 | Ga0495635_0063848 | 3300046663 | Bacteria | 2528 |
| 453 | Ga0495661_0177574 | 3300046665 | Bacteria | 1131 |
| 454 | Ga0495657_0027846 | 3300046675 | Bacteria | 3981 |
| 455 | Ga0495657_0043330 | 3300046675 | Bacteria | 3070 |
| 456 | Ga0495599_0119708 | 3300046678 | Unclassified | 1637 |
| 457 | Ga0495599_0154948 | 3300046678 | Bacteria | 1418 |
| 458 | Ga0495623_0116829 | 3300046679 | Bacteria | 1611 |
| 459 | Ga0495623_0144909 | 3300046679 | Bacteria | 1409 |
| 460 | Ga0495646_0139755 | 3300046680 | Unclassified | 1355 |
| 461 | Ga0495658_0088312 | 3300046683 | Bacteria | 1832 |
| 462 | Ga0495658_0243503 | 3300046683 | Bacteria | 1130 |
| 463 | Ga0495613_0123626 | 3300046689 | Bacteria | 1857 |
| 464 | Ga0495624_0158971 | 3300046690 | Bacteria | 1381 |
| 465 | Ga0495600_0017357 | 3300046809 | Bacteria | 4578 |
| 466 | Ga0495604_0257411 | 3300047317 | Bacteria | 1187 |
| 467 | Ga0495674_0096394 | 3300047319 | Bacteria | 2521 |
| 468 | Ga0495674_0300657 | 3300047319 | Bacteria | 1311 |
| 469 | Ga0495674_0563750 | 3300047319 | Bacteria | 905 |
| 470 | Ga0495676_0065494 | 3300047321 | Bacteria | 2820 |
| 471 | Ga0495680_0031108 | 3300047322 | Bacteria | 4348 |
| 472 | Ga0495680_0064440 | 3300047322 | Bacteria | 2810 |
| 473 | Ga0495675_0054666 | 3300047444 | Bacteria | 2533 |
| 474 | Ga0495675_0152270 | 3300047444 | Bacteria | 1428 |
| 475 | Ga0495684_0026250 | 3300047471 | Bacteria | 4475 |
| 476 | Ga0495684_0123970 | 3300047471 | Unclassified | 1944 |
| 477 | Ga0495684_0285708 | 3300047471 | Bacteria | 1189 |
| 478 | Ga0495602_0024011 | 3300048088 | Bacteria | 5923 |
| 479 | Ga0495602_0050026 | 3300048088 | Bacteria | 3738 |
| 480 | Ga0495602_0089031 | 3300048088 | Bacteria | 2567 |
| 481 | Ga0495602_0279397 | 3300048088 | Bacteria | 1231 |
| 482 | Ga0496100_0026220 | 3300048903 | Bacteria | 3572 |
| 483 | Ga0496101_0115530 | 3300048904 | Bacteria | 2024 |
| 484 | Ga0496101_0388067 | 3300048904 | Bacteria | 1099 |
| 485 | Ga0496102_0077300 | 3300048905 | Bacteria | 3063 |
| 486 | Ga0496102_0558662 | 3300048905 | Bacteria | 1067 |
| 487 | Ga0496104_0004546 | 3300048907 | Bacteria | 12086 |
| 488 | Ga0496104_0006440 | 3300048907 | Bacteria | 10321 |
| 489 | Ga0496104_0243006 | 3300048907 | Bacteria | 1713 |
| 490 | Ga0496105_0002204 | 3300048908 | Bacteria | 14112 |
| 491 | Ga0496105_0056304 | 3300048908 | Bacteria | 3245 |
| 492 | Ga0496106_0127182 | 3300048909 | Bacteria | 1996 |
| 493 | Ga0496106_0303895 | 3300048909 | Bacteria | 1280 |
| 494 | Ga0496106_0360157 | 3300048909 | Bacteria | 1168 |
| 495 | Ga0496107_0178567 | 3300048910 | Bacteria | 1576 |
| 496 | Ga0496108_0006037 | 3300048911 | Bacteria | 9803 |
| 497 | Ga0496108_0018273 | 3300048911 | Bacteria | 5741 |
| 498 | Ga0496108_0042102 | 3300048911 | Bacteria | 3812 |
| 499 | Ga0496108_0537882 | 3300048911 | Bacteria | 1020 |
| 500 | Ga0496109_0008081 | 3300048912 | Bacteria | 8920 |
| 501 | Ga0496109_0037631 | 3300048912 | Bacteria | 4371 |
| 502 | Ga0496109_0041338 | 3300048912 | Bacteria | 4176 |
| 503 | Ga0496109_0150984 | 3300048912 | Bacteria | 2175 |
| 504 | Ga0496109_0196860 | 3300048912 | Bacteria | 1894 |
| 505 | Ga0496110_0017574 | 3300048913 | Bacteria | 5981 |
| 506 | Ga0496110_0070774 | 3300048913 | Bacteria | 3091 |
| 507 | Ga0496110_0262468 | 3300048913 | Bacteria | 1572 |
| 508 | Ga0496111_0005453 | 3300048914 | Bacteria | 8151 |
| 509 | Ga0496111_0012868 | 3300048914 | Bacteria | 5677 |
| 510 | Ga0496112_0032785 | 3300048915 | Bacteria | 5044 |
| 511 | Ga0496112_0033874 | 3300048915 | Bacteria | 4968 |
| 512 | Ga0496112_0232259 | 3300048915 | Bacteria | 1799 |
| 513 | Ga0496112_0602916 | 3300048915 | Bacteria | 1030 |
| 514 | Ga0496113_0001704 | 3300048916 | Bacteria | 12457 |
| 515 | Ga0496113_0076238 | 3300048916 | Bacteria | 2561 |
| 516 | Ga0496113_0453542 | 3300048916 | Bacteria | 1030 |
| 517 | Ga0496114_0030604 | 3300048917 | Bacteria | 4429 |
| 518 | Ga0496114_0123511 | 3300048917 | Bacteria | 2229 |
| 519 | Ga0496114_0136431 | 3300048917 | Bacteria | 2122 |
| 520 | Ga0496114_0143703 | 3300048917 | Bacteria | 2067 |
| 521 | Ga0496114_0265203 | 3300048917 | Bacteria | 1513 |
| 522 | Ga0496115_0316202 | 3300048918 | Bacteria | 1278 |
| 523 | Ga0496115_0407028 | 3300048918 | Bacteria | 1103 |
| 524 | Ga0496118_0252114 | 3300048921 | Bacteria | 1002 |
| 525 | Ga0496121_0192582 | 3300048924 | Bacteria | 1461 |
| 526 | Ga0496125_0002119 | 3300048928 | Bacteria | 26671 |
| 527 | Ga0496126_0047317 | 3300048929 | Bacteria | 3938 |
| 528 | Ga0501031_0029529 | 3300049568 | Bacteria | 3576 |
| 529 | Ga0501032_0042393 | 3300049569 | Bacteria | 3087 |
| 530 | Ga0501033_0019527 | 3300049570 | Bacteria | 5124 |
| 531 | Ga0501033_0141644 | 3300049570 | Unclassified | 1738 |
| 532 | Ga0501034_0006432 | 3300049571 | Bacteria | 12649 |
| 533 | Ga0501036_0008102 | 3300049572 | Bacteria | 8611 |
| 534 | Ga0501036_0139507 | 3300049572 | Bacteria | 2046 |
| 535 | Ga0501036_0147668 | 3300049572 | Bacteria | 1983 |
| 536 | Ga0501038_0064279 | 3300049574 | Bacteria | 3129 |
| 537 | Ga0501038_0218728 | 3300049574 | Bacteria | 1520 |
| 538 | Ga0501039_0006035 | 3300049575 | Bacteria | 9194 |
| 539 | Ga0501039_0242354 | 3300049575 | Bacteria | 1417 |
| 540 | Ga0501040_0022742 | 3300049576 | Bacteria | 4199 |
| 541 | Ga0501040_0048222 | 3300049576 | Bacteria | 2911 |
| 542 | Ga0501040_0060496 | 3300049576 | Bacteria | 2603 |
| 543 | Ga0501040_0149654 | 3300049576 | Bacteria | 1646 |
| 544 | Ga0501041_0004686 | 3300049577 | Bacteria | 7936 |
| 545 | Ga0501041_0014372 | 3300049577 | Bacteria | 4700 |
| 546 | Ga0501041_0230416 | 3300049577 | Bacteria | 1163 |
| 547 | Ga0501042_0012658 | 3300049578 | Bacteria | 5723 |
| 548 | Ga0501042_0037531 | 3300049578 | Bacteria | 3438 |
| 549 | Ga0501042_0058929 | 3300049578 | Bacteria | 2741 |
| 550 | Ga0501043_0137212 | 3300049579 | Bacteria | 1916 |
| 551 | Ga0501046_0002204 | 3300049580 | Bacteria | 18411 |
| 552 | Ga0501048_0029088 | 3300049582 | Bacteria | 4009 |
| 553 | Ga0501048_0029249 | 3300049582 | Bacteria | 3997 |
| 554 | Ga0501048_0331648 | 3300049582 | Bacteria | 1084 |
| 555 | Ga0501048_0362302 | 3300049582 | Unclassified | 1034 |
| 556 | Ga0501067_0003553 | 3300049583 | Bacteria | 8580 |
| 557 | Ga0501067_0012844 | 3300049583 | Bacteria | 4637 |
| 558 | Ga0501067_0039307 | 3300049583 | Bacteria | 2627 |
| 559 | Ga0501067_0236415 | 3300049583 | Bacteria | 1017 |
| 560 | Ga0501068_0057210 | 3300049584 | Bacteria | 2364 |
| 561 | Ga0501069_0000875 | 3300049585 | Bacteria | 14347 |
| 562 | Ga0501069_0014840 | 3300049585 | Bacteria | 4171 |
| 563 | Ga0501070_0012951 | 3300049586 | Bacteria | 7029 |
| 564 | Ga0501070_0044438 | 3300049586 | Bacteria | 3696 |
| 565 | Ga0501070_0125588 | 3300049586 | Bacteria | 2120 |
| 566 | Ga0501071_0029376 | 3300049587 | Bacteria | 3879 |
| 567 | Ga0501071_0048396 | 3300049587 | Bacteria | 3058 |
| 568 | Ga0501071_0146921 | 3300049587 | Bacteria | 1757 |
| 569 | Ga0501072_0006425 | 3300049588 | Bacteria | 8957 |
| 570 | Ga0501072_0030735 | 3300049588 | Bacteria | 4201 |
| 571 | Ga0501072_0032620 | 3300049588 | Bacteria | 4079 |
| 572 | Ga0501072_0037692 | 3300049588 | Bacteria | 3792 |
| 573 | Ga0501073_0065413 | 3300049589 | Bacteria | 2535 |
| 574 | Ga0501073_0072043 | 3300049589 | Bacteria | 2407 |
| 575 | Ga0501074_0026333 | 3300049590 | Bacteria | 4217 |
| 576 | Ga0501074_0037273 | 3300049590 | Bacteria | 3525 |
| 577 | Ga0501074_0055815 | 3300049590 | Bacteria | 2846 |
| 578 | Ga0501075_0008888 | 3300049591 | Bacteria | 7006 |
| 579 | Ga0501075_0012025 | 3300049591 | Bacteria | 6143 |
| 580 | Ga0501075_0316874 | 3300049591 | Bacteria | 1189 |
| 581 | Ga0501076_0003603 | 3300049592 | Bacteria | 10881 |
| 582 | Ga0501076_0040468 | 3300049592 | Bacteria | 3664 |
| 583 | Ga0501076_0126687 | 3300049592 | Bacteria | 2069 |
| 584 | Ga0501076_0243439 | 3300049592 | Bacteria | 1471 |
| 585 | Ga0501077_0023940 | 3300049593 | Bacteria | 3873 |
| 586 | Ga0501077_0050471 | 3300049593 | Bacteria | 2644 |
| 587 | Ga0501077_0197409 | 3300049593 | Bacteria | 1278 |
| 588 | Ga0501079_0006298 | 3300049741 | Bacteria | 8900 |
| 589 | Ga0501079_0011754 | 3300049741 | Bacteria | 6687 |
| 590 | Ga0501079_0165116 | 3300049741 | Bacteria | 1727 |
| 591 | Ga0501079_0193996 | 3300049741 | Bacteria | 1585 |
| 592 | Ga0501079_0262341 | 3300049741 | Bacteria | 1350 |
| 593 | Ga0501080_0048773 | 3300049742 | Bacteria | 3940 |
| 594 | Ga0501080_0380310 | 3300049742 | Bacteria | 1272 |
| 595 | Ga0501080_0506408 | 3300049742 | Unclassified | 1078 |
| 596 | Ga0501081_0000832 | 3300049743 | Bacteria | 18239 |
| 597 | Ga0501081_0099008 | 3300049743 | Bacteria | 2059 |
| 598 | Ga0501081_0122598 | 3300049743 | Bacteria | 1852 |
| 599 | Ga0501081_0159749 | 3300049743 | Bacteria | 1623 |
| 600 | Ga0501083_0007534 | 3300049744 | Bacteria | 7713 |
| 601 | Ga0501083_0023782 | 3300049744 | Bacteria | 4248 |
| 602 | Ga0501083_0041793 | 3300049744 | Bacteria | 3109 |
| 603 | Ga0501083_0181348 | 3300049744 | Bacteria | 1375 |
| 604 | Ga0501035_0021510 | 3300049822 | Bacteria | 5930 |
| 605 | Ga0501035_0054011 | 3300049822 | Bacteria | 3590 |
| 606 | Ga0501044_0046640 | 3300049823 | Bacteria | 4486 |
| 607 | Ga0501045_0000502 | 3300049824 | Bacteria | 24311 |
| 608 | Ga0501045_0034020 | 3300049824 | Bacteria | 3698 |
| 609 | Ga0501045_0046018 | 3300049824 | Bacteria | 3177 |
| 610 | Ga0501045_0168261 | 3300049824 | Bacteria | 1632 |
| 611 | Ga0501045_0213648 | 3300049824 | Bacteria | 1437 |
| 612 | nmdc:mga03n38_116552_c1 | 3300050490 | Bacteria | 1307 |
| 613 | nmdc:mga03n38_147548_c1 | 3300050490 | Bacteria | 1181 |
| 614 | nmdc:mga00v17_185154_c1 | 3300050491 | Bacteria | 1344 |
| 615 | nmdc:mga00v17_340768_c1 | 3300050491 | Bacteria | 975 |
| 616 | nmdc:mga0yw44_25303_c1 | 3300050492 | Bacteria | 3373 |
| 617 | nmdc:mga0yw44_96510_c1 | 3300050492 | Bacteria | 1877 |
| 618 | nmdc:mga0k408_201032_c1 | 3300050493 | Bacteria | 1189 |
| 619 | nmdc:mga06z11_116291_c1 | 3300050494 | Bacteria | 1487 |
| 620 | nmdc:mga06z11_62367_c1 | 3300050494 | Bacteria | 1947 |
| 621 | nmdc:mga06z11_81485_c1 | 3300050494 | Bacteria | 1737 |
| 622 | nmdc:mga08x19_328737_c1 | 3300050514 | Bacteria | 1065 |
| 623 | Ga0495601_0073629 | 3300053077 | Bacteria | 2184 |
| 624 | Ga0495612_0123646 | 3300053078 | Bacteria | 1114 |
| 625 | Ga0495595_0048749 | 3300053084 | Bacteria | 1956 |
| 626 | Ga0495619_0013492 | 3300053085 | Bacteria | 5148 |
| 627 | Ga0495619_0191749 | 3300053085 | Unclassified | 1414 |
| 628 | Ga0495619_0250047 | 3300053085 | Bacteria | 1228 |
| 629 | Ga0495619_0260840 | 3300053085 | Bacteria | 1201 |
| 630 | Ga0500644_0076720 | 3300053088 | Bacteria | 1219 |
| 631 | Ga0500583_0003848 | 3300053092 | Bacteria | 4802 |
| 632 | Ga0500583_0087928 | 3300053092 | Bacteria | 1510 |
| 633 | Ga0500642_0044647 | 3300053130 | Bacteria | 1931 |
| 634 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 635 | Ga0501084_0026444 | 3300054114 | Bacteria | 4843 |
| 636 | Ga0501084_0048089 | 3300054114 | Bacteria | 3571 |
| 637 | Ga0501084_0221497 | 3300054114 | Bacteria | 1596 |
| 638 | Ga0501082_0040761 | 3300060353 | Bacteria | 4005 |
| 639 | Ga0501082_0052163 | 3300060353 | Bacteria | 3525 |
| 640 | Ga0501082_0066684 | 3300060353 | Bacteria | 3099 |
| 641 | Ga0501082_0071321 | 3300060353 | Bacteria | 2992 |
| 642 | Ga0530510_0054568 | 3300061734 | Bacteria | 2887 |
| 643 | Ga0530510_0074563 | 3300061734 | Bacteria | 2463 |
| 644 | Ga0530510_0085167 | 3300061734 | Bacteria | 2303 |
| 645 | Ga0530510_0154817 | 3300061734 | Bacteria | 1694 |
| 646 | Ga0530510_0339537 | 3300061734 | Unclassified | 1127 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025929 | Ga0207664_10675744 | Ga0207664_106757442 | 229 |
| 2 | 3300025928 | Ga0207700_10546833 | Ga0207700_105468331 | 234 |
| 3 | 3300009551 | Ga0105238_10176633 | Ga0105238_101766332 | 236 |
| 4 | 3300046477 | Ga0495664_0088698 | Ga0495664_0088698_261_1004 | 239 |
| 5 | 3300013105 | Ga0157369_10259559 | Ga0157369_102595592 | 250 |
| 6 | 3300048905 | Ga0496102_0558662 | Ga0496102_0558662_76_888 | 258 |
| 7 | 3300048907 | Ga0496104_0243006 | Ga0496104_0243006_377_1189 | 258 |
| 8 | 3300048918 | Ga0496115_0316202 | Ga0496115_0316202_389_1201 | 258 |
| 9 | 3300021384 | Ga0213876_10115109 | Ga0213876_101151091 | 259 |
| 10 | 3300009148 | Ga0105243_10021928 | Ga0105243_100219283 | 260 |
| 11 | 3300025935 | Ga0207709_10130259 | Ga0207709_101302592 | 260 |
| 12 | 3300050514 | nmdc:mga08x19_328737_c1 | nmdc:mga08x19_328737_c1_237_1052 | 260 |
| 13 | 3300006038 | Ga0075365_10057429 | Ga0075365_100574292 | 261 |
| 14 | 3300009177 | Ga0105248_11121230 | Ga0105248_111212301 | 261 |
| 15 | 3300049583 | Ga0501067_0012844 | Ga0501067_0012844_101_934 | 261 |
| 16 | 3300050490 | nmdc:mga03n38_147548_c1 | nmdc:mga03n38_147548_c1_105_965 | 261 |
| 17 | 3300050492 | nmdc:mga0yw44_96510_c1 | nmdc:mga0yw44_96510_c1_418_1278 | 261 |
| 18 | 3300050494 | nmdc:mga06z11_62367_c1 | nmdc:mga06z11_62367_c1_536_1396 | 261 |
| 19 | 3300006048 | Ga0075363_100064994 | Ga0075363_1000649942 | 262 |
| 20 | 3300006051 | Ga0075364_10010262 | Ga0075364_100102626 | 262 |
| 21 | 3300006177 | Ga0075362_10015905 | Ga0075362_100159052 | 262 |
| 22 | 3300006178 | Ga0075367_10109849 | Ga0075367_101098492 | 262 |
| 23 | 3300021377 | Ga0213874_10056154 | Ga0213874_100561542 | 262 |
| 24 | 3300046529 | Ga0495652_0174833 | Ga0495652_0174833_284_1114 | 262 |
| 25 | 3300050493 | nmdc:mga0k408_201032_c1 | nmdc:mga0k408_201032_c1_259_1050 | 262 |
| 26 | 3300053088 | Ga0500644_0076720 | Ga0500644_0076720_47_877 | 262 |
| 27 | 3300053092 | Ga0500583_0087928 | Ga0500583_0087928_54_884 | 262 |
| 28 | 3300053153 | Ga0500616_0000018 | Ga0500616_0000018_187046_187876 | 262 |
| 29 | 3300005435 | Ga0070714_100158669 | Ga0070714_1001586692 | 263 |
| 30 | 3300005439 | Ga0070711_100064815 | Ga0070711_1000648152 | 263 |
| 31 | 3300006028 | Ga0070717_10035797 | Ga0070717_100357972 | 263 |
| 32 | 3300006175 | Ga0070712_100029909 | Ga0070712_1000299092 | 263 |
| 33 | 3300006881 | Ga0068865_100367515 | Ga0068865_1003675152 | 263 |
| 34 | 3300017792 | Ga0163161_10074237 | Ga0163161_100742373 | 263 |
| 35 | 3300025906 | Ga0207699_10097454 | Ga0207699_100974542 | 263 |
| 36 | 3300025915 | Ga0207693_10001765 | Ga0207693_1000176513 | 263 |
| 37 | 3300025938 | Ga0207704_10151330 | Ga0207704_101513302 | 263 |
| 38 | 3300025961 | Ga0207712_10058428 | Ga0207712_100584282 | 263 |
| 39 | 3300026118 | Ga0207675_100145624 | Ga0207675_1001456242 | 263 |
| 40 | 3300035724 | Ga0373933_0139129 | Ga0373933_0139129_171_998 | 263 |
| 41 | 3300046472 | Ga0495580_0036525 | Ga0495580_0036525_1398_2225 | 263 |
| 42 | 3300047444 | Ga0495675_0054666 | Ga0495675_0054666_311_1138 | 263 |
| 43 | 3300048088 | Ga0495602_0279397 | Ga0495602_0279397_183_1010 | 263 |
| 44 | 3300005329 | Ga0070683_100243547 | Ga0070683_1002435472 | 264 |
| 45 | 3300005337 | Ga0070682_100109738 | Ga0070682_1001097382 | 264 |
| 46 | 3300005439 | Ga0070711_100333604 | Ga0070711_1003336042 | 264 |
| 47 | 3300005535 | Ga0070684_100052514 | Ga0070684_1000525144 | 264 |
| 48 | 3300005539 | Ga0068853_100014189 | Ga0068853_1000141895 | 264 |
| 49 | 3300005578 | Ga0068854_100091100 | Ga0068854_1000911004 | 264 |
| 50 | 3300005616 | Ga0068852_100000594 | Ga0068852_10000059420 | 264 |
| 51 | 3300006173 | Ga0070716_100019232 | Ga0070716_1000192321 | 264 |
| 52 | 3300009093 | Ga0105240_10046552 | Ga0105240_100465523 | 264 |
| 53 | 3300013307 | Ga0157372_10199420 | Ga0157372_101994203 | 264 |
| 54 | 3300025928 | Ga0207700_10152790 | Ga0207700_101527902 | 264 |
| 55 | 3300021377 | Ga0213874_10016645 | Ga0213874_100166452 | 265 |
| 56 | 3300039450 | Ga0436363_0054480 | Ga0436363_0054480_1362_2192 | 265 |
| 57 | 3300046472 | Ga0495580_0001449 | Ga0495580_0001449_19529_20359 | 265 |
| 58 | 3300005435 | Ga0070714_100022905 | Ga0070714_1000229055 | 267 |
| 59 | 3300005436 | Ga0070713_100010073 | Ga0070713_1000100732 | 267 |
| 60 | 3300005535 | Ga0070684_100273313 | Ga0070684_1002733132 | 267 |
| 61 | 3300025928 | Ga0207700_10084703 | Ga0207700_100847031 | 267 |
| 62 | 3300025929 | Ga0207664_10009304 | Ga0207664_100093045 | 267 |
| 63 | 3300046511 | Ga0495608_0254096 | Ga0495608_0254096_130_960 | 267 |
| 64 | 3300046642 | Ga0495634_0085852 | Ga0495634_0085852_799_1629 | 267 |
| 65 | 3300046683 | Ga0495658_0088312 | Ga0495658_0088312_845_1675 | 267 |
| 66 | 3300047319 | Ga0495674_0300657 | Ga0495674_0300657_73_903 | 267 |
| 67 | 3300006028 | Ga0070717_10057790 | Ga0070717_100577902 | 268 |
| 68 | 3300039450 | Ga0436363_1649388 | Ga0436363_1649388_245_1075 | 268 |
| 69 | 3300047319 | Ga0495674_0096394 | Ga0495674_0096394_17_823 | 268 |
| 70 | 3300061734 | Ga0530510_0085167 | Ga0530510_0085167_1450_2256 | 268 |
| 71 | 3300046516 | Ga0495628_0304128 | Ga0495628_0304128_160_990 | 269 |
| 72 | 3300047319 | Ga0495674_0563750 | Ga0495674_0563750_58_888 | 269 |
| 73 | 3300049570 | Ga0501033_0141644 | Ga0501033_0141644_471_1301 | 270 |
| 74 | 3300049575 | Ga0501039_0006035 | Ga0501039_0006035_6166_6996 | 270 |
| 75 | 3300049577 | Ga0501041_0004686 | Ga0501041_0004686_6546_7376 | 270 |
| 76 | 3300049578 | Ga0501042_0012658 | Ga0501042_0012658_139_969 | 270 |
| 77 | 3300049579 | Ga0501043_0137212 | Ga0501043_0137212_904_1734 | 270 |
| 78 | 3300049580 | Ga0501046_0002204 | Ga0501046_0002204_13868_14698 | 270 |
| 79 | 3300049582 | Ga0501048_0029088 | Ga0501048_0029088_702_1532 | 270 |
| 80 | 3300049587 | Ga0501071_0048396 | Ga0501071_0048396_147_977 | 270 |
| 81 | 3300049588 | Ga0501072_0037692 | Ga0501072_0037692_487_1317 | 270 |
| 82 | 3300049592 | Ga0501076_0003603 | Ga0501076_0003603_7948_8778 | 270 |
| 83 | 3300049741 | Ga0501079_0006298 | Ga0501079_0006298_799_1629 | 270 |
| 84 | 3300049743 | Ga0501081_0000832 | Ga0501081_0000832_2881_3711 | 270 |
| 85 | 3300049824 | Ga0501045_0000502 | Ga0501045_0000502_21282_22112 | 270 |
| 86 | 3300050490 | nmdc:mga03n38_116552_c1 | nmdc:mga03n38_116552_c1_474_1289 | 271 |
| 87 | 3300050491 | nmdc:mga00v17_185154_c1 | nmdc:mga00v17_185154_c1_19_834 | 271 |
| 88 | 3300005530 | Ga0070679_100231513 | Ga0070679_1002315132 | 273 |
| 89 | 3300046473 | Ga0495582_0191961 | Ga0495582_0191961_186_1007 | 273 |
| 90 | 3300005336 | Ga0070680_100051214 | Ga0070680_1000512144 | 275 |
| 91 | 3300005439 | Ga0070711_100144382 | Ga0070711_1001443823 | 275 |
| 92 | 3300005458 | Ga0070681_10002016 | Ga0070681_1000201615 | 275 |
| 93 | 3300005458 | Ga0070681_10016015 | Ga0070681_100160152 | 275 |
| 94 | 3300005458 | Ga0070681_10109705 | Ga0070681_101097052 | 275 |
| 95 | 3300005530 | Ga0070679_100053871 | Ga0070679_1000538715 | 275 |
| 96 | 3300005530 | Ga0070679_100120704 | Ga0070679_1001207044 | 275 |
| 97 | 3300005539 | Ga0068853_100405276 | Ga0068853_1004052762 | 275 |
| 98 | 3300005563 | Ga0068855_100057508 | Ga0068855_1000575084 | 275 |
| 99 | 3300006175 | Ga0070712_100020269 | Ga0070712_1000202692 | 275 |
| 100 | 3300009093 | Ga0105240_10001872 | Ga0105240_1000187228 | 275 |
| 101 | 3300009093 | Ga0105240_10022760 | Ga0105240_100227605 | 275 |
| 102 | 3300009551 | Ga0105238_10023381 | Ga0105238_100233812 | 275 |
| 103 | 3300009551 | Ga0105238_10155595 | Ga0105238_101555951 | 275 |
| 104 | 3300013104 | Ga0157370_10271043 | Ga0157370_102710432 | 275 |
| 105 | 3300013105 | Ga0157369_10023185 | Ga0157369_100231852 | 275 |
| 106 | 3300013105 | Ga0157369_10057229 | Ga0157369_100572294 | 275 |
| 107 | 3300013307 | Ga0157372_10669140 | Ga0157372_106691402 | 275 |
| 108 | 3300025912 | Ga0207707_10000659 | Ga0207707_1000065917 | 275 |
| 109 | 3300025912 | Ga0207707_10005489 | Ga0207707_100054893 | 275 |
| 110 | 3300025913 | Ga0207695_10105229 | Ga0207695_101052293 | 275 |
| 111 | 3300025913 | Ga0207695_10109519 | Ga0207695_101095193 | 275 |
| 112 | 3300025917 | Ga0207660_10011567 | Ga0207660_100115672 | 275 |
| 113 | 3300025921 | Ga0207652_10009622 | Ga0207652_100096226 | 275 |
| 114 | 3300025921 | Ga0207652_10039072 | Ga0207652_100390722 | 275 |
| 115 | 3300025924 | Ga0207694_10120723 | Ga0207694_101207231 | 275 |
| 116 | 3300025939 | Ga0207665_10169782 | Ga0207665_101697822 | 275 |
| 117 | 3300025949 | Ga0207667_10016391 | Ga0207667_100163916 | 275 |
| 118 | 3300026116 | Ga0207674_10425890 | Ga0207674_104258902 | 275 |
| 119 | 3300044706 | Ga0466964_0082327 | Ga0466964_0082327_546_1373 | 275 |
| 120 | 3300045976 | Ga0466967_0243394 | Ga0466967_0243394_648_1475 | 275 |
| 121 | 3300002239 | JGI24034J26672_10012152 | JGI24034J26672_100121522 | 276 |
| 122 | 3300003203 | JGI25406J46586_10004166 | JGI25406J46586_100041661 | 276 |
| 123 | 3300003323 | rootH1_10148054 | rootH1_101480544 | 276 |
| 124 | 3300005329 | Ga0070683_100047464 | Ga0070683_1000474642 | 276 |
| 125 | 3300005329 | Ga0070683_100058685 | Ga0070683_1000586855 | 276 |
| 126 | 3300005329 | Ga0070683_100567391 | Ga0070683_1005673912 | 276 |
| 127 | 3300005334 | Ga0068869_100302551 | Ga0068869_1003025512 | 276 |
| 128 | 3300005335 | Ga0070666_10001519 | Ga0070666_1000151913 | 276 |
| 129 | 3300005336 | Ga0070680_100003356 | Ga0070680_1000033568 | 276 |
| 130 | 3300005337 | Ga0070682_100164767 | Ga0070682_1001647672 | 276 |
| 131 | 3300005337 | Ga0070682_100284573 | Ga0070682_1002845732 | 276 |
| 132 | 3300005338 | Ga0068868_100006600 | Ga0068868_1000066007 | 276 |
| 133 | 3300005338 | Ga0068868_100014840 | Ga0068868_1000148403 | 276 |
| 134 | 3300005338 | Ga0068868_100095910 | Ga0068868_1000959103 | 276 |
| 135 | 3300005340 | Ga0070689_100025037 | Ga0070689_1000250374 | 276 |
| 136 | 3300005340 | Ga0070689_100064086 | Ga0070689_1000640862 | 276 |
| 137 | 3300005341 | Ga0070691_10032560 | Ga0070691_100325603 | 276 |
| 138 | 3300005344 | Ga0070661_100027821 | Ga0070661_1000278215 | 276 |
| 139 | 3300005344 | Ga0070661_100056140 | Ga0070661_1000561403 | 276 |
| 140 | 3300005345 | Ga0070692_10004704 | Ga0070692_100047042 | 276 |
| 141 | 3300005347 | Ga0070668_100075688 | Ga0070668_1000756883 | 276 |
| 142 | 3300005353 | Ga0070669_100157035 | Ga0070669_1001570353 | 276 |
| 143 | 3300005353 | Ga0070669_100293112 | Ga0070669_1002931122 | 276 |
| 144 | 3300005354 | Ga0070675_100011459 | Ga0070675_1000114598 | 276 |
| 145 | 3300005355 | Ga0070671_100029020 | Ga0070671_1000290201 | 276 |
| 146 | 3300005355 | Ga0070671_100070390 | Ga0070671_1000703902 | 276 |
| 147 | 3300005356 | Ga0070674_100050806 | Ga0070674_1000508063 | 276 |
| 148 | 3300005364 | Ga0070673_100125100 | Ga0070673_1001251002 | 276 |
| 149 | 3300005364 | Ga0070673_100412284 | Ga0070673_1004122842 | 276 |
| 150 | 3300005365 | Ga0070688_100369600 | Ga0070688_1003696002 | 276 |
| 151 | 3300005366 | Ga0070659_100028160 | Ga0070659_1000281604 | 276 |
| 152 | 3300005366 | Ga0070659_100054054 | Ga0070659_1000540543 | 276 |
| 153 | 3300005366 | Ga0070659_100080470 | Ga0070659_1000804702 | 276 |
| 154 | 3300005366 | Ga0070659_100157125 | Ga0070659_1001571253 | 276 |
| 155 | 3300005367 | Ga0070667_100001319 | Ga0070667_1000013195 | 276 |
| 156 | 3300005367 | Ga0070667_100221405 | Ga0070667_1002214052 | 276 |
| 157 | 3300005435 | Ga0070714_100101954 | Ga0070714_1001019542 | 276 |
| 158 | 3300005436 | Ga0070713_100021283 | Ga0070713_1000212833 | 276 |
| 159 | 3300005436 | Ga0070713_100292336 | Ga0070713_1002923362 | 276 |
| 160 | 3300005438 | Ga0070701_10007973 | Ga0070701_100079735 | 276 |
| 161 | 3300005441 | Ga0070700_100152531 | Ga0070700_1001525311 | 276 |
| 162 | 3300005455 | Ga0070663_100053721 | Ga0070663_1000537213 | 276 |
| 163 | 3300005455 | Ga0070663_100096964 | Ga0070663_1000969642 | 276 |
| 164 | 3300005457 | Ga0070662_100023967 | Ga0070662_1000239671 | 276 |
| 165 | 3300005457 | Ga0070662_100030809 | Ga0070662_1000308093 | 276 |
| 166 | 3300005458 | Ga0070681_10030819 | Ga0070681_100308193 | 276 |
| 167 | 3300005458 | Ga0070681_10124606 | Ga0070681_101246062 | 276 |
| 168 | 3300005458 | Ga0070681_10507820 | Ga0070681_105078201 | 276 |
| 169 | 3300005459 | Ga0068867_100024614 | Ga0068867_1000246145 | 276 |
| 170 | 3300005459 | Ga0068867_100119496 | Ga0068867_1001194963 | 276 |
| 171 | 3300005466 | Ga0070685_10218465 | Ga0070685_102184652 | 276 |
| 172 | 3300005530 | Ga0070679_100007440 | Ga0070679_1000074407 | 276 |
| 173 | 3300005530 | Ga0070679_100081404 | Ga0070679_1000814043 | 276 |
| 174 | 3300005530 | Ga0070679_100093059 | Ga0070679_1000930592 | 276 |
| 175 | 3300005530 | Ga0070679_100406213 | Ga0070679_1004062132 | 276 |
| 176 | 3300005535 | Ga0070684_100040482 | Ga0070684_1000404822 | 276 |
| 177 | 3300005535 | Ga0070684_100084643 | Ga0070684_1000846433 | 276 |
| 178 | 3300005535 | Ga0070684_100111295 | Ga0070684_1001112952 | 276 |
| 179 | 3300005535 | Ga0070684_100363303 | Ga0070684_1003633032 | 276 |
| 180 | 3300005539 | Ga0068853_100300054 | Ga0068853_1003000542 | 276 |
| 181 | 3300005543 | Ga0070672_100205629 | Ga0070672_1002056292 | 276 |
| 182 | 3300005544 | Ga0070686_100017998 | Ga0070686_1000179984 | 276 |
| 183 | 3300005546 | Ga0070696_100265320 | Ga0070696_1002653202 | 276 |
| 184 | 3300005547 | Ga0070693_100138422 | Ga0070693_1001384222 | 276 |
| 185 | 3300005548 | Ga0070665_100004948 | Ga0070665_10000494810 | 276 |
| 186 | 3300005548 | Ga0070665_100006291 | Ga0070665_1000062913 | 276 |
| 187 | 3300005548 | Ga0070665_100083761 | Ga0070665_1000837612 | 276 |
| 188 | 3300005563 | Ga0068855_100011077 | Ga0068855_1000110773 | 276 |
| 189 | 3300005563 | Ga0068855_100086916 | Ga0068855_1000869163 | 276 |
| 190 | 3300005563 | Ga0068855_100180377 | Ga0068855_1001803772 | 276 |
| 191 | 3300005563 | Ga0068855_100658154 | Ga0068855_1006581542 | 276 |
| 192 | 3300005564 | Ga0070664_100084290 | Ga0070664_1000842903 | 276 |
| 193 | 3300005564 | Ga0070664_100091280 | Ga0070664_1000912803 | 276 |
| 194 | 3300005577 | Ga0068857_100104153 | Ga0068857_1001041533 | 276 |
| 195 | 3300005577 | Ga0068857_100139635 | Ga0068857_1001396352 | 276 |
| 196 | 3300005578 | Ga0068854_100095301 | Ga0068854_1000953013 | 276 |
| 197 | 3300005614 | Ga0068856_100064942 | Ga0068856_1000649422 | 276 |
| 198 | 3300005614 | Ga0068856_100088563 | Ga0068856_1000885632 | 276 |
| 199 | 3300005614 | Ga0068856_100157713 | Ga0068856_1001577132 | 276 |
| 200 | 3300005614 | Ga0068856_100158055 | Ga0068856_1001580552 | 276 |
| 201 | 3300005615 | Ga0070702_100017087 | Ga0070702_1000170872 | 276 |
| 202 | 3300005615 | Ga0070702_100115386 | Ga0070702_1001153862 | 276 |
| 203 | 3300005616 | Ga0068852_100038941 | Ga0068852_1000389413 | 276 |
| 204 | 3300005616 | Ga0068852_100069521 | Ga0068852_1000695213 | 276 |
| 205 | 3300005617 | Ga0068859_100021328 | Ga0068859_1000213288 | 276 |
| 206 | 3300005617 | Ga0068859_100101825 | Ga0068859_1001018254 | 276 |
| 207 | 3300005617 | Ga0068859_100105639 | Ga0068859_1001056392 | 276 |
| 208 | 3300005618 | Ga0068864_100066963 | Ga0068864_1000669632 | 276 |
| 209 | 3300005618 | Ga0068864_100224665 | Ga0068864_1002246652 | 276 |
| 210 | 3300005719 | Ga0068861_100092209 | Ga0068861_1000922093 | 276 |
| 211 | 3300005719 | Ga0068861_100374091 | Ga0068861_1003740912 | 276 |
| 212 | 3300005841 | Ga0068863_100005225 | Ga0068863_10000522511 | 276 |
| 213 | 3300005841 | Ga0068863_100024338 | Ga0068863_1000243382 | 276 |
| 214 | 3300005841 | Ga0068863_100117596 | Ga0068863_1001175963 | 276 |
| 215 | 3300005842 | Ga0068858_100001170 | Ga0068858_1000011706 | 276 |
| 216 | 3300005842 | Ga0068858_100012191 | Ga0068858_1000121914 | 276 |
| 217 | 3300005843 | Ga0068860_100001012 | Ga0068860_1000010126 | 276 |
| 218 | 3300005843 | Ga0068860_100011906 | Ga0068860_10001190610 | 276 |
| 219 | 3300005843 | Ga0068860_100064414 | Ga0068860_1000644143 | 276 |
| 220 | 3300005844 | Ga0068862_100366184 | Ga0068862_1003661842 | 276 |
| 221 | 3300005844 | Ga0068862_100422282 | Ga0068862_1004222822 | 276 |
| 222 | 3300005937 | Ga0081455_10000289 | Ga0081455_100002896 | 276 |
| 223 | 3300005937 | Ga0081455_10000746 | Ga0081455_1000074615 | 276 |
| 224 | 3300005985 | Ga0081539_10000016 | Ga0081539_10000016117 | 276 |
| 225 | 3300006038 | Ga0075365_10000551 | Ga0075365_100005512 | 276 |
| 226 | 3300006038 | Ga0075365_10032699 | Ga0075365_100326992 | 276 |
| 227 | 3300006051 | Ga0075364_10043556 | Ga0075364_100435563 | 276 |
| 228 | 3300006163 | Ga0070715_10027800 | Ga0070715_100278003 | 276 |
| 229 | 3300006178 | Ga0075367_10039059 | Ga0075367_100390592 | 276 |
| 230 | 3300006237 | Ga0097621_100005410 | Ga0097621_1000054107 | 276 |
| 231 | 3300006358 | Ga0068871_100006591 | Ga0068871_1000065914 | 276 |
| 232 | 3300006358 | Ga0068871_100602945 | Ga0068871_1006029451 | 276 |
| 233 | 3300006871 | Ga0075434_100298348 | Ga0075434_1002983482 | 276 |
| 234 | 3300006881 | Ga0068865_100003888 | Ga0068865_1000038888 | 276 |
| 235 | 3300006881 | Ga0068865_100021428 | Ga0068865_1000214283 | 276 |
| 236 | 3300006931 | Ga0097620_100021327 | Ga0097620_1000213278 | 276 |
| 237 | 3300006931 | Ga0097620_100101822 | Ga0097620_1001018221 | 276 |
| 238 | 3300006931 | Ga0097620_100105638 | Ga0097620_1001056382 | 276 |
| 239 | 3300009093 | Ga0105240_10004116 | Ga0105240_1000411613 | 276 |
| 240 | 3300009093 | Ga0105240_10301250 | Ga0105240_103012502 | 276 |
| 241 | 3300009094 | Ga0111539_10035839 | Ga0111539_100358393 | 276 |
| 242 | 3300009098 | Ga0105245_10004224 | Ga0105245_100042246 | 276 |
| 243 | 3300009098 | Ga0105245_10029226 | Ga0105245_100292263 | 276 |
| 244 | 3300009098 | Ga0105245_10064430 | Ga0105245_100644302 | 276 |
| 245 | 3300009101 | Ga0105247_10033987 | Ga0105247_100339873 | 276 |
| 246 | 3300009148 | Ga0105243_10022526 | Ga0105243_100225266 | 276 |
| 247 | 3300009148 | Ga0105243_10206465 | Ga0105243_102064652 | 276 |
| 248 | 3300009176 | Ga0105242_10061347 | Ga0105242_100613472 | 276 |
| 249 | 3300009176 | Ga0105242_10133319 | Ga0105242_101333192 | 276 |
| 250 | 3300009176 | Ga0105242_10170149 | Ga0105242_101701492 | 276 |
| 251 | 3300009176 | Ga0105242_10332618 | Ga0105242_103326182 | 276 |
| 252 | 3300009177 | Ga0105248_10037253 | Ga0105248_100372534 | 276 |
| 253 | 3300009177 | Ga0105248_10082234 | Ga0105248_100822342 | 276 |
| 254 | 3300009545 | Ga0105237_10154365 | Ga0105237_101543652 | 276 |
| 255 | 3300009545 | Ga0105237_10238997 | Ga0105237_102389972 | 276 |
| 256 | 3300009545 | Ga0105237_10335856 | Ga0105237_103358561 | 276 |
| 257 | 3300009545 | Ga0105237_10434060 | Ga0105237_104340602 | 276 |
| 258 | 3300009551 | Ga0105238_10050839 | Ga0105238_100508393 | 276 |
| 259 | 3300009551 | Ga0105238_10079012 | Ga0105238_100790123 | 276 |
| 260 | 3300009551 | Ga0105238_10079847 | Ga0105238_100798472 | 276 |
| 261 | 3300009551 | Ga0105238_10105397 | Ga0105238_101053973 | 276 |
| 262 | 3300009551 | Ga0105238_10114364 | Ga0105238_101143643 | 276 |
| 263 | 3300009551 | Ga0105238_10247735 | Ga0105238_102477352 | 276 |
| 264 | 3300009553 | Ga0105249_10820173 | Ga0105249_108201731 | 276 |
| 265 | 3300010375 | Ga0105239_10002773 | Ga0105239_1000277318 | 276 |
| 266 | 3300010375 | Ga0105239_10020110 | Ga0105239_100201106 | 276 |
| 267 | 3300010375 | Ga0105239_10143248 | Ga0105239_101432483 | 276 |
| 268 | 3300010375 | Ga0105239_10665722 | Ga0105239_106657222 | 276 |
| 269 | 3300011119 | Ga0105246_10056210 | Ga0105246_100562102 | 276 |
| 270 | 3300013102 | Ga0157371_10108798 | Ga0157371_101087982 | 276 |
| 271 | 3300013104 | Ga0157370_10232674 | Ga0157370_102326742 | 276 |
| 272 | 3300013105 | Ga0157369_10117201 | Ga0157369_101172012 | 276 |
| 273 | 3300013105 | Ga0157369_10137853 | Ga0157369_101378533 | 276 |
| 274 | 3300013105 | Ga0157369_10473266 | Ga0157369_104732662 | 276 |
| 275 | 3300013296 | Ga0157374_10002067 | Ga0157374_100020679 | 276 |
| 276 | 3300013296 | Ga0157374_10136792 | Ga0157374_101367923 | 276 |
| 277 | 3300013297 | Ga0157378_10006201 | Ga0157378_100062017 | 276 |
| 278 | 3300013306 | Ga0163162_10035042 | Ga0163162_100350423 | 276 |
| 279 | 3300013306 | Ga0163162_10152669 | Ga0163162_101526692 | 276 |
| 280 | 3300013307 | Ga0157372_10153125 | Ga0157372_101531253 | 276 |
| 281 | 3300013308 | Ga0157375_10135005 | Ga0157375_101350053 | 276 |
| 282 | 3300014325 | Ga0163163_10014563 | Ga0163163_100145634 | 276 |
| 283 | 3300014325 | Ga0163163_10234542 | Ga0163163_102345422 | 276 |
| 284 | 3300014326 | Ga0157380_10055019 | Ga0157380_100550194 | 276 |
| 285 | 3300014326 | Ga0157380_10107937 | Ga0157380_101079373 | 276 |
| 286 | 3300014745 | Ga0157377_10005003 | Ga0157377_100050035 | 276 |
| 287 | 3300014745 | Ga0157377_10110873 | Ga0157377_101108732 | 276 |
| 288 | 3300014968 | Ga0157379_10008362 | Ga0157379_100083626 | 276 |
| 289 | 3300014968 | Ga0157379_10027551 | Ga0157379_100275513 | 276 |
| 290 | 3300014968 | Ga0157379_10080966 | Ga0157379_100809663 | 276 |
| 291 | 3300014969 | Ga0157376_10005732 | Ga0157376_100057327 | 276 |
| 292 | 3300014969 | Ga0157376_10010199 | Ga0157376_100101995 | 276 |
| 293 | 3300017792 | Ga0163161_10059213 | Ga0163161_100592134 | 276 |
| 294 | 3300021377 | Ga0213874_10000147 | Ga0213874_100001475 | 276 |
| 295 | 3300021384 | Ga0213876_10009597 | Ga0213876_100095973 | 276 |
| 296 | 3300021384 | Ga0213876_10148833 | Ga0213876_101488331 | 276 |
| 297 | 3300021388 | Ga0213875_10019000 | Ga0213875_100190002 | 276 |
| 298 | 3300021388 | Ga0213875_10023583 | Ga0213875_100235832 | 276 |
| 299 | 3300021388 | Ga0213875_10039425 | Ga0213875_100394252 | 276 |
| 300 | 3300021388 | Ga0213875_10077375 | Ga0213875_100773751 | 276 |
| 301 | 3300025885 | Ga0207653_10004249 | Ga0207653_100042492 | 276 |
| 302 | 3300025893 | Ga0207682_10064866 | Ga0207682_100648662 | 276 |
| 303 | 3300025898 | Ga0207692_10038960 | Ga0207692_100389603 | 276 |
| 304 | 3300025898 | Ga0207692_10147049 | Ga0207692_101470492 | 276 |
| 305 | 3300025900 | Ga0207710_10011459 | Ga0207710_100114592 | 276 |
| 306 | 3300025901 | Ga0207688_10033854 | Ga0207688_100338543 | 276 |
| 307 | 3300025901 | Ga0207688_10120245 | Ga0207688_101202452 | 276 |
| 308 | 3300025903 | Ga0207680_10048394 | Ga0207680_100483942 | 276 |
| 309 | 3300025903 | Ga0207680_10074714 | Ga0207680_100747143 | 276 |
| 310 | 3300025906 | Ga0207699_10035364 | Ga0207699_100353643 | 276 |
| 311 | 3300025908 | Ga0207643_10015477 | Ga0207643_100154774 | 276 |
| 312 | 3300025911 | Ga0207654_10072006 | Ga0207654_100720062 | 276 |
| 313 | 3300025912 | Ga0207707_10306500 | Ga0207707_103065002 | 276 |
| 314 | 3300025913 | Ga0207695_10007347 | Ga0207695_1000734710 | 276 |
| 315 | 3300025913 | Ga0207695_10063339 | Ga0207695_100633392 | 276 |
| 316 | 3300025913 | Ga0207695_10081817 | Ga0207695_100818172 | 276 |
| 317 | 3300025914 | Ga0207671_10008474 | Ga0207671_100084748 | 276 |
| 318 | 3300025914 | Ga0207671_10053774 | Ga0207671_100537742 | 276 |
| 319 | 3300025915 | Ga0207693_10331201 | Ga0207693_103312011 | 276 |
| 320 | 3300025916 | Ga0207663_10014787 | Ga0207663_100147873 | 276 |
| 321 | 3300025918 | Ga0207662_10019780 | Ga0207662_100197803 | 276 |
| 322 | 3300025919 | Ga0207657_10035861 | Ga0207657_100358612 | 276 |
| 323 | 3300025919 | Ga0207657_10069646 | Ga0207657_100696463 | 276 |
| 324 | 3300025920 | Ga0207649_10197054 | Ga0207649_101970542 | 276 |
| 325 | 3300025921 | Ga0207652_10037961 | Ga0207652_100379613 | 276 |
| 326 | 3300025923 | Ga0207681_10221204 | Ga0207681_102212042 | 276 |
| 327 | 3300025924 | Ga0207694_10046070 | Ga0207694_100460702 | 276 |
| 328 | 3300025924 | Ga0207694_10084295 | Ga0207694_100842952 | 276 |
| 329 | 3300025925 | Ga0207650_10264004 | Ga0207650_102640042 | 276 |
| 330 | 3300025927 | Ga0207687_10012491 | Ga0207687_100124912 | 276 |
| 331 | 3300025927 | Ga0207687_10142347 | Ga0207687_101423472 | 276 |
| 332 | 3300025928 | Ga0207700_10031445 | Ga0207700_100314454 | 276 |
| 333 | 3300025929 | Ga0207664_10092610 | Ga0207664_100926102 | 276 |
| 334 | 3300025932 | Ga0207690_10064690 | Ga0207690_100646903 | 276 |
| 335 | 3300025932 | Ga0207690_10075950 | Ga0207690_100759502 | 276 |
| 336 | 3300025932 | Ga0207690_10158645 | Ga0207690_101586452 | 276 |
| 337 | 3300025933 | Ga0207706_10023929 | Ga0207706_100239294 | 276 |
| 338 | 3300025933 | Ga0207706_10112822 | Ga0207706_101128222 | 276 |
| 339 | 3300025935 | Ga0207709_10094913 | Ga0207709_100949132 | 276 |
| 340 | 3300025938 | Ga0207704_10023672 | Ga0207704_100236722 | 276 |
| 341 | 3300025938 | Ga0207704_10151926 | Ga0207704_101519263 | 276 |
| 342 | 3300025938 | Ga0207704_10276379 | Ga0207704_102763792 | 276 |
| 343 | 3300025939 | Ga0207665_10107504 | Ga0207665_101075042 | 276 |
| 344 | 3300025940 | Ga0207691_10039399 | Ga0207691_100393996 | 276 |
| 345 | 3300025941 | Ga0207711_10011383 | Ga0207711_100113836 | 276 |
| 346 | 3300025942 | Ga0207689_10107148 | Ga0207689_101071483 | 276 |
| 347 | 3300025942 | Ga0207689_10211460 | Ga0207689_102114602 | 276 |
| 348 | 3300025942 | Ga0207689_10305937 | Ga0207689_103059372 | 276 |
| 349 | 3300025944 | Ga0207661_10143493 | Ga0207661_101434932 | 276 |
| 350 | 3300025944 | Ga0207661_10181027 | Ga0207661_101810272 | 276 |
| 351 | 3300025949 | Ga0207667_10002777 | Ga0207667_100027778 | 276 |
| 352 | 3300025949 | Ga0207667_10284209 | Ga0207667_102842092 | 276 |
| 353 | 3300025949 | Ga0207667_10375222 | Ga0207667_103752222 | 276 |
| 354 | 3300025960 | Ga0207651_10371313 | Ga0207651_103713131 | 276 |
| 355 | 3300025961 | Ga0207712_10056449 | Ga0207712_100564493 | 276 |
| 356 | 3300025961 | Ga0207712_10195585 | Ga0207712_101955852 | 276 |
| 357 | 3300025981 | Ga0207640_10070982 | Ga0207640_100709822 | 276 |
| 358 | 3300025986 | Ga0207658_10010647 | Ga0207658_100106475 | 276 |
| 359 | 3300026023 | Ga0207677_10033634 | Ga0207677_100336342 | 276 |
| 360 | 3300026035 | Ga0207703_10001004 | Ga0207703_100010046 | 276 |
| 361 | 3300026035 | Ga0207703_10004345 | Ga0207703_100043452 | 276 |
| 362 | 3300026035 | Ga0207703_10075358 | Ga0207703_100753582 | 276 |
| 363 | 3300026041 | Ga0207639_10058844 | Ga0207639_100588442 | 276 |
| 364 | 3300026041 | Ga0207639_10268235 | Ga0207639_102682352 | 276 |
| 365 | 3300026067 | Ga0207678_10084915 | Ga0207678_100849152 | 276 |
| 366 | 3300026067 | Ga0207678_10089442 | Ga0207678_100894422 | 276 |
| 367 | 3300026067 | Ga0207678_10111555 | Ga0207678_101115552 | 276 |
| 368 | 3300026075 | Ga0207708_10016970 | Ga0207708_100169705 | 276 |
| 369 | 3300026075 | Ga0207708_10259782 | Ga0207708_102597822 | 276 |
| 370 | 3300026078 | Ga0207702_10033844 | Ga0207702_100338442 | 276 |
| 371 | 3300026078 | Ga0207702_10075397 | Ga0207702_100753973 | 276 |
| 372 | 3300026078 | Ga0207702_10189902 | Ga0207702_101899021 | 276 |
| 373 | 3300026078 | Ga0207702_10353747 | Ga0207702_103537472 | 276 |
| 374 | 3300026088 | Ga0207641_10000871 | Ga0207641_100008714 | 276 |
| 375 | 3300026088 | Ga0207641_10011339 | Ga0207641_100113396 | 276 |
| 376 | 3300026088 | Ga0207641_10216163 | Ga0207641_102161632 | 276 |
| 377 | 3300026089 | Ga0207648_10071201 | Ga0207648_100712013 | 276 |
| 378 | 3300026089 | Ga0207648_10086750 | Ga0207648_100867502 | 276 |
| 379 | 3300026095 | Ga0207676_10024272 | Ga0207676_100242724 | 276 |
| 380 | 3300026116 | Ga0207674_10040638 | Ga0207674_100406383 | 276 |
| 381 | 3300026116 | Ga0207674_10300918 | Ga0207674_103009182 | 276 |
| 382 | 3300026118 | Ga0207675_100084065 | Ga0207675_1000840653 | 276 |
| 383 | 3300026118 | Ga0207675_100137213 | Ga0207675_1001372132 | 276 |
| 384 | 3300026118 | Ga0207675_100457512 | Ga0207675_1004575121 | 276 |
| 385 | 3300026121 | Ga0207683_10022371 | Ga0207683_100223713 | 276 |
| 386 | 3300026121 | Ga0207683_10083083 | Ga0207683_100830833 | 276 |
| 387 | 3300026121 | Ga0207683_10147016 | Ga0207683_101470162 | 276 |
| 388 | 3300026142 | Ga0207698_10089208 | Ga0207698_100892082 | 276 |
| 389 | 3300026142 | Ga0207698_10090339 | Ga0207698_100903393 | 276 |
| 390 | 3300026142 | Ga0207698_10401251 | Ga0207698_104012512 | 276 |
| 391 | 3300027907 | Ga0207428_10013589 | Ga0207428_100135897 | 276 |
| 392 | 3300028379 | Ga0268266_10003099 | Ga0268266_1000309912 | 276 |
| 393 | 3300028379 | Ga0268266_10026084 | Ga0268266_100260846 | 276 |
| 394 | 3300028379 | Ga0268266_10103400 | Ga0268266_101034002 | 276 |
| 395 | 3300028379 | Ga0268266_10259275 | Ga0268266_102592752 | 276 |
| 396 | 3300028379 | Ga0268266_10410530 | Ga0268266_104105301 | 276 |
| 397 | 3300028380 | Ga0268265_10003739 | Ga0268265_100037399 | 276 |
| 398 | 3300028380 | Ga0268265_10033579 | Ga0268265_100335794 | 276 |
| 399 | 3300028380 | Ga0268265_10417847 | Ga0268265_104178471 | 276 |
| 400 | 3300028381 | Ga0268264_10000518 | Ga0268264_1000051814 | 276 |
| 401 | 3300028381 | Ga0268264_10070899 | Ga0268264_100708994 | 276 |
| 402 | 3300028573 | Ga0265334_10037433 | Ga0265334_100374331 | 276 |
| 403 | 3300028577 | Ga0265318_10003106 | Ga0265318_100031064 | 276 |
| 404 | 3300028654 | Ga0265322_10041222 | Ga0265322_100412222 | 276 |
| 405 | 3300031090 | Ga0265760_10037586 | Ga0265760_100375863 | 276 |
| 406 | 3300031235 | Ga0265330_10025326 | Ga0265330_100253263 | 276 |
| 407 | 3300031242 | Ga0265329_10041120 | Ga0265329_100411201 | 276 |
| 408 | 3300031247 | Ga0265340_10024228 | Ga0265340_100242283 | 276 |
| 409 | 3300031251 | Ga0265327_10025371 | Ga0265327_100253713 | 276 |
| 410 | 3300031344 | Ga0265316_10223226 | Ga0265316_102232261 | 276 |
| 411 | 3300031507 | Ga0307509_10000005 | Ga0307509_1000000528 | 276 |
| 412 | 3300031595 | Ga0265313_10086358 | Ga0265313_100863582 | 276 |
| 413 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001593 | 276 |
| 414 | 3300034957 | Ga0373938_0001126 | Ga0373938_0001126_2552_3382 | 276 |
| 415 | 3300035085 | Ga0373929_0022239 | Ga0373929_0022239_451_1281 | 276 |
| 416 | 3300035090 | Ga0373949_0010749 | Ga0373949_0010749_461_1291 | 276 |
| 417 | 3300035113 | Ga0373936_0001046 | Ga0373936_0001046_7742_8572 | 276 |
| 418 | 3300035113 | Ga0373936_0013375 | Ga0373936_0013375_2289_3119 | 276 |
| 419 | 3300035116 | Ga0373945_0064041 | Ga0373945_0064041_368_1198 | 276 |
| 420 | 3300035170 | Ga0373943_0051206 | Ga0373943_0051206_752_1582 | 276 |
| 421 | 3300035172 | Ga0373955_0003012 | Ga0373955_0003012_640_1470 | 276 |
| 422 | 3300035172 | Ga0373955_0065762 | Ga0373955_0065762_1015_1845 | 276 |
| 423 | 3300035691 | Ga0373931_0022264 | Ga0373931_0022264_1629_2459 | 276 |
| 424 | 3300035724 | Ga0373933_0026509 | Ga0373933_0026509_338_1168 | 276 |
| 425 | 3300035725 | Ga0373947_0185605 | Ga0373947_0185605_251_1081 | 276 |
| 426 | 3300036401 | Ga0373937_0002672 | Ga0373937_0002672_87_917 | 276 |
| 427 | 3300036401 | Ga0373937_0622993 | Ga0373937_0622993_146_976 | 276 |
| 428 | 3300037853 | Ga0436364_0028511 | Ga0436364_0028511_17038_17868 | 276 |
| 429 | 3300037853 | Ga0436364_0088869 | Ga0436364_0088869_8226_9056 | 276 |
| 430 | 3300037853 | Ga0436364_0291817 | Ga0436364_0291817_2528_3358 | 276 |
| 431 | 3300037853 | Ga0436364_0380016 | Ga0436364_0380016_1822_2652 | 276 |
| 432 | 3300037853 | Ga0436364_0381743 | Ga0436364_0381743_635_1465 | 276 |
| 433 | 3300037853 | Ga0436364_1565546 | Ga0436364_1565546_2047_2877 | 276 |
| 434 | 3300039437 | Ga0436365_0116219 | Ga0436365_0116219_4964_5794 | 276 |
| 435 | 3300039437 | Ga0436365_0392316 | Ga0436365_0392316_2027_2857 | 276 |
| 436 | 3300039437 | Ga0436365_0757770 | Ga0436365_0757770_9875_10705 | 276 |
| 437 | 3300039437 | Ga0436365_1310673 | Ga0436365_1310673_2850_3680 | 276 |
| 438 | 3300039437 | Ga0436365_1725271 | Ga0436365_1725271_2003_2833 | 276 |
| 439 | 3300039437 | Ga0436365_1860495 | Ga0436365_1860495_812_1648 | 276 |
| 440 | 3300039450 | Ga0436363_0400823 | Ga0436363_0400823_29_859 | 276 |
| 441 | 3300039450 | Ga0436363_0530445 | Ga0436363_0530445_626_1456 | 276 |
| 442 | 3300039450 | Ga0436363_0812143 | Ga0436363_0812143_11136_11966 | 276 |
| 443 | 3300039450 | Ga0436363_1187238 | Ga0436363_1187238_2035_2865 | 276 |
| 444 | 3300039450 | Ga0436363_1553426 | Ga0436363_1553426_4129_4959 | 276 |
| 445 | 3300039453 | Ga0436362_0136684 | Ga0436362_0136684_562_1392 | 276 |
| 446 | 3300039453 | Ga0436362_0868892 | Ga0436362_0868892_582_1412 | 276 |
| 447 | 3300042016 | Ga0439463_056349 | Ga0439463_056349_101_931 | 276 |
| 448 | 3300044735 | Ga0466968_0101314 | Ga0466968_0101314_116_946 | 276 |
| 449 | 3300045049 | Ga0466959_0049372 | Ga0466959_0049372_2077_2907 | 276 |
| 450 | 3300045836 | Ga0466958_0010971 | Ga0466958_0010971_3645_4475 | 276 |
| 451 | 3300045976 | Ga0466967_0023312 | Ga0466967_0023312_1564_2394 | 276 |
| 452 | 3300045976 | Ga0466967_0090081 | Ga0466967_0090081_1179_2009 | 276 |
| 453 | 3300045976 | Ga0466967_0113706 | Ga0466967_0113706_78_908 | 276 |
| 454 | 3300045976 | Ga0466967_0479756 | Ga0466967_0479756_286_1116 | 276 |
| 455 | 3300046454 | Ga0495592_0028980 | Ga0495592_0028980_3192_4022 | 276 |
| 456 | 3300046454 | Ga0495592_0074651 | Ga0495592_0074651_341_1171 | 276 |
| 457 | 3300046455 | Ga0495603_0086678 | Ga0495603_0086678_658_1488 | 276 |
| 458 | 3300046455 | Ga0495603_0089071 | Ga0495603_0089071_249_1079 | 276 |
| 459 | 3300046455 | Ga0495603_0302371 | Ga0495603_0302371_23_853 | 276 |
| 460 | 3300046461 | Ga0495641_0049416 | Ga0495641_0049416_1049_1879 | 276 |
| 461 | 3300046462 | Ga0495651_0007697 | Ga0495651_0007697_1263_2093 | 276 |
| 462 | 3300046462 | Ga0495651_0028653 | Ga0495651_0028653_1460_2290 | 276 |
| 463 | 3300046462 | Ga0495651_0103899 | Ga0495651_0103899_1128_1958 | 276 |
| 464 | 3300046463 | Ga0495653_0026729 | Ga0495653_0026729_564_1394 | 276 |
| 465 | 3300046473 | Ga0495582_0038461 | Ga0495582_0038461_637_1467 | 276 |
| 466 | 3300046491 | Ga0495584_0068708 | Ga0495584_0068708_367_1197 | 276 |
| 467 | 3300046491 | Ga0495584_0082876 | Ga0495584_0082876_514_1344 | 276 |
| 468 | 3300046500 | Ga0495596_0069675 | Ga0495596_0069675_65_895 | 276 |
| 469 | 3300046511 | Ga0495608_0007998 | Ga0495608_0007998_1586_2416 | 276 |
| 470 | 3300046514 | Ga0495618_0093083 | Ga0495618_0093083_109_939 | 276 |
| 471 | 3300046515 | Ga0495620_0061393 | Ga0495620_0061393_698_1528 | 276 |
| 472 | 3300046516 | Ga0495628_0153787 | Ga0495628_0153787_738_1568 | 276 |
| 473 | 3300046522 | Ga0495643_0127749 | Ga0495643_0127749_46_876 | 276 |
| 474 | 3300046529 | Ga0495652_0090884 | Ga0495652_0090884_168_998 | 276 |
| 475 | 3300046529 | Ga0495652_0119672 | Ga0495652_0119672_1239_2069 | 276 |
| 476 | 3300046529 | Ga0495652_0212978 | Ga0495652_0212978_184_1152 | 276 |
| 477 | 3300046536 | Ga0495587_0022877 | Ga0495587_0022877_2052_3020 | 276 |
| 478 | 3300046536 | Ga0495587_0042549 | Ga0495587_0042549_740_1570 | 276 |
| 479 | 3300046536 | Ga0495587_0147384 | Ga0495587_0147384_369_1199 | 276 |
| 480 | 3300046559 | Ga0495667_0001276 | Ga0495667_0001276_14969_15799 | 276 |
| 481 | 3300046559 | Ga0495667_0275406 | Ga0495667_0275406_70_1038 | 276 |
| 482 | 3300046616 | Ga0495668_0264493 | Ga0495668_0264493_18_848 | 276 |
| 483 | 3300046642 | Ga0495634_0080484 | Ga0495634_0080484_1262_2092 | 276 |
| 484 | 3300046660 | Ga0495625_0179760 | Ga0495625_0179760_317_1168 | 276 |
| 485 | 3300046663 | Ga0495635_0026046 | Ga0495635_0026046_34_864 | 276 |
| 486 | 3300046663 | Ga0495635_0063848 | Ga0495635_0063848_178_1008 | 276 |
| 487 | 3300046665 | Ga0495661_0177574 | Ga0495661_0177574_30_860 | 276 |
| 488 | 3300046675 | Ga0495657_0027846 | Ga0495657_0027846_90_920 | 276 |
| 489 | 3300046675 | Ga0495657_0043330 | Ga0495657_0043330_747_1715 | 276 |
| 490 | 3300046678 | Ga0495599_0119708 | Ga0495599_0119708_417_1247 | 276 |
| 491 | 3300046678 | Ga0495599_0154948 | Ga0495599_0154948_110_940 | 276 |
| 492 | 3300046679 | Ga0495623_0116829 | Ga0495623_0116829_101_931 | 276 |
| 493 | 3300046679 | Ga0495623_0144909 | Ga0495623_0144909_382_1212 | 276 |
| 494 | 3300046680 | Ga0495646_0139755 | Ga0495646_0139755_51_881 | 276 |
| 495 | 3300046683 | Ga0495658_0243503 | Ga0495658_0243503_118_948 | 276 |
| 496 | 3300046689 | Ga0495613_0123626 | Ga0495613_0123626_825_1655 | 276 |
| 497 | 3300046690 | Ga0495624_0158971 | Ga0495624_0158971_500_1330 | 276 |
| 498 | 3300046809 | Ga0495600_0017357 | Ga0495600_0017357_159_989 | 276 |
| 499 | 3300047317 | Ga0495604_0257411 | Ga0495604_0257411_101_931 | 276 |
| 500 | 3300047321 | Ga0495676_0065494 | Ga0495676_0065494_1514_2344 | 276 |
| 501 | 3300047322 | Ga0495680_0031108 | Ga0495680_0031108_739_1569 | 276 |
| 502 | 3300047322 | Ga0495680_0064440 | Ga0495680_0064440_703_1533 | 276 |
| 503 | 3300047444 | Ga0495675_0152270 | Ga0495675_0152270_456_1286 | 276 |
| 504 | 3300047471 | Ga0495684_0026250 | Ga0495684_0026250_67_897 | 276 |
| 505 | 3300047471 | Ga0495684_0123970 | Ga0495684_0123970_949_1779 | 276 |
| 506 | 3300047471 | Ga0495684_0285708 | Ga0495684_0285708_246_1076 | 276 |
| 507 | 3300048088 | Ga0495602_0024011 | Ga0495602_0024011_5070_5900 | 276 |
| 508 | 3300048088 | Ga0495602_0050026 | Ga0495602_0050026_1330_2298 | 276 |
| 509 | 3300048088 | Ga0495602_0089031 | Ga0495602_0089031_1222_2052 | 276 |
| 510 | 3300048903 | Ga0496100_0026220 | Ga0496100_0026220_2071_2901 | 276 |
| 511 | 3300048904 | Ga0496101_0115530 | Ga0496101_0115530_802_1632 | 276 |
| 512 | 3300048904 | Ga0496101_0388067 | Ga0496101_0388067_177_1007 | 276 |
| 513 | 3300048905 | Ga0496102_0077300 | Ga0496102_0077300_1207_2037 | 276 |
| 514 | 3300048907 | Ga0496104_0004546 | Ga0496104_0004546_4972_5802 | 276 |
| 515 | 3300048907 | Ga0496104_0006440 | Ga0496104_0006440_1148_1984 | 276 |
| 516 | 3300048908 | Ga0496105_0002204 | Ga0496105_0002204_6090_6926 | 276 |
| 517 | 3300048908 | Ga0496105_0056304 | Ga0496105_0056304_173_1003 | 276 |
| 518 | 3300048909 | Ga0496106_0127182 | Ga0496106_0127182_637_1467 | 276 |
| 519 | 3300048909 | Ga0496106_0303895 | Ga0496106_0303895_219_1052 | 276 |
| 520 | 3300048909 | Ga0496106_0360157 | Ga0496106_0360157_35_865 | 276 |
| 521 | 3300048910 | Ga0496107_0178567 | Ga0496107_0178567_389_1219 | 276 |
| 522 | 3300048911 | Ga0496108_0006037 | Ga0496108_0006037_2180_3016 | 276 |
| 523 | 3300048911 | Ga0496108_0018273 | Ga0496108_0018273_2729_3559 | 276 |
| 524 | 3300048911 | Ga0496108_0042102 | Ga0496108_0042102_47_877 | 276 |
| 525 | 3300048911 | Ga0496108_0537882 | Ga0496108_0537882_55_885 | 276 |
| 526 | 3300048912 | Ga0496109_0008081 | Ga0496109_0008081_2906_3742 | 276 |
| 527 | 3300048912 | Ga0496109_0037631 | Ga0496109_0037631_75_905 | 276 |
| 528 | 3300048912 | Ga0496109_0041338 | Ga0496109_0041338_2892_3722 | 276 |
| 529 | 3300048912 | Ga0496109_0150984 | Ga0496109_0150984_441_1271 | 276 |
| 530 | 3300048912 | Ga0496109_0196860 | Ga0496109_0196860_701_1531 | 276 |
| 531 | 3300048913 | Ga0496110_0017574 | Ga0496110_0017574_3910_4746 | 276 |
| 532 | 3300048913 | Ga0496110_0070774 | Ga0496110_0070774_849_1679 | 276 |
| 533 | 3300048913 | Ga0496110_0262468 | Ga0496110_0262468_181_1011 | 276 |
| 534 | 3300048914 | Ga0496111_0005453 | Ga0496111_0005453_3204_4040 | 276 |
| 535 | 3300048914 | Ga0496111_0012868 | Ga0496111_0012868_1026_1856 | 276 |
| 536 | 3300048915 | Ga0496112_0032785 | Ga0496112_0032785_238_1068 | 276 |
| 537 | 3300048915 | Ga0496112_0033874 | Ga0496112_0033874_987_1817 | 276 |
| 538 | 3300048915 | Ga0496112_0232259 | Ga0496112_0232259_431_1261 | 276 |
| 539 | 3300048915 | Ga0496112_0602916 | Ga0496112_0602916_161_991 | 276 |
| 540 | 3300048916 | Ga0496113_0001704 | Ga0496113_0001704_5736_6566 | 276 |
| 541 | 3300048916 | Ga0496113_0076238 | Ga0496113_0076238_39_869 | 276 |
| 542 | 3300048916 | Ga0496113_0453542 | Ga0496113_0453542_71_901 | 276 |
| 543 | 3300048917 | Ga0496114_0030604 | Ga0496114_0030604_1226_2056 | 276 |
| 544 | 3300048917 | Ga0496114_0123511 | Ga0496114_0123511_691_1521 | 276 |
| 545 | 3300048917 | Ga0496114_0136431 | Ga0496114_0136431_147_977 | 276 |
| 546 | 3300048917 | Ga0496114_0143703 | Ga0496114_0143703_903_1733 | 276 |
| 547 | 3300048917 | Ga0496114_0265203 | Ga0496114_0265203_37_867 | 276 |
| 548 | 3300048918 | Ga0496115_0407028 | Ga0496115_0407028_208_1038 | 276 |
| 549 | 3300048921 | Ga0496118_0252114 | Ga0496118_0252114_157_987 | 276 |
| 550 | 3300048924 | Ga0496121_0192582 | Ga0496121_0192582_586_1416 | 276 |
| 551 | 3300048928 | Ga0496125_0002119 | Ga0496125_0002119_8849_9679 | 276 |
| 552 | 3300048929 | Ga0496126_0047317 | Ga0496126_0047317_1705_2535 | 276 |
| 553 | 3300049568 | Ga0501031_0029529 | Ga0501031_0029529_1026_1856 | 276 |
| 554 | 3300049569 | Ga0501032_0042393 | Ga0501032_0042393_1578_2408 | 276 |
| 555 | 3300049570 | Ga0501033_0019527 | Ga0501033_0019527_2771_3601 | 276 |
| 556 | 3300049571 | Ga0501034_0006432 | Ga0501034_0006432_9404_10234 | 276 |
| 557 | 3300049572 | Ga0501036_0008102 | Ga0501036_0008102_670_1500 | 276 |
| 558 | 3300049572 | Ga0501036_0139507 | Ga0501036_0139507_119_949 | 276 |
| 559 | 3300049572 | Ga0501036_0147668 | Ga0501036_0147668_293_1123 | 276 |
| 560 | 3300049574 | Ga0501038_0064279 | Ga0501038_0064279_579_1409 | 276 |
| 561 | 3300049574 | Ga0501038_0218728 | Ga0501038_0218728_561_1391 | 276 |
| 562 | 3300049575 | Ga0501039_0242354 | Ga0501039_0242354_24_854 | 276 |
| 563 | 3300049576 | Ga0501040_0022742 | Ga0501040_0022742_605_1435 | 276 |
| 564 | 3300049576 | Ga0501040_0048222 | Ga0501040_0048222_1653_2483 | 276 |
| 565 | 3300049576 | Ga0501040_0060496 | Ga0501040_0060496_502_1332 | 276 |
| 566 | 3300049576 | Ga0501040_0149654 | Ga0501040_0149654_152_982 | 276 |
| 567 | 3300049577 | Ga0501041_0014372 | Ga0501041_0014372_2380_3210 | 276 |
| 568 | 3300049577 | Ga0501041_0230416 | Ga0501041_0230416_53_883 | 276 |
| 569 | 3300049578 | Ga0501042_0037531 | Ga0501042_0037531_109_939 | 276 |
| 570 | 3300049578 | Ga0501042_0058929 | Ga0501042_0058929_315_1145 | 276 |
| 571 | 3300049582 | Ga0501048_0029249 | Ga0501048_0029249_946_1776 | 276 |
| 572 | 3300049582 | Ga0501048_0331648 | Ga0501048_0331648_238_1068 | 276 |
| 573 | 3300049582 | Ga0501048_0362302 | Ga0501048_0362302_33_863 | 276 |
| 574 | 3300049583 | Ga0501067_0003553 | Ga0501067_0003553_3318_4148 | 276 |
| 575 | 3300049583 | Ga0501067_0039307 | Ga0501067_0039307_1722_2552 | 276 |
| 576 | 3300049583 | Ga0501067_0236415 | Ga0501067_0236415_157_987 | 276 |
| 577 | 3300049584 | Ga0501068_0057210 | Ga0501068_0057210_156_986 | 276 |
| 578 | 3300049585 | Ga0501069_0000875 | Ga0501069_0000875_3241_4071 | 276 |
| 579 | 3300049585 | Ga0501069_0014840 | Ga0501069_0014840_2604_3434 | 276 |
| 580 | 3300049586 | Ga0501070_0012951 | Ga0501070_0012951_3235_4065 | 276 |
| 581 | 3300049586 | Ga0501070_0044438 | Ga0501070_0044438_834_1664 | 276 |
| 582 | 3300049586 | Ga0501070_0125588 | Ga0501070_0125588_677_1507 | 276 |
| 583 | 3300049587 | Ga0501071_0029376 | Ga0501071_0029376_1026_1856 | 276 |
| 584 | 3300049587 | Ga0501071_0146921 | Ga0501071_0146921_511_1341 | 276 |
| 585 | 3300049588 | Ga0501072_0006425 | Ga0501072_0006425_1443_2273 | 276 |
| 586 | 3300049588 | Ga0501072_0030735 | Ga0501072_0030735_154_984 | 276 |
| 587 | 3300049588 | Ga0501072_0032620 | Ga0501072_0032620_791_1621 | 276 |
| 588 | 3300049589 | Ga0501073_0065413 | Ga0501073_0065413_1142_1972 | 276 |
| 589 | 3300049589 | Ga0501073_0072043 | Ga0501073_0072043_1378_2208 | 276 |
| 590 | 3300049590 | Ga0501074_0026333 | Ga0501074_0026333_570_1400 | 276 |
| 591 | 3300049590 | Ga0501074_0037273 | Ga0501074_0037273_125_955 | 276 |
| 592 | 3300049590 | Ga0501074_0055815 | Ga0501074_0055815_583_1413 | 276 |
| 593 | 3300049591 | Ga0501075_0008888 | Ga0501075_0008888_3449_4279 | 276 |
| 594 | 3300049591 | Ga0501075_0012025 | Ga0501075_0012025_5215_6045 | 276 |
| 595 | 3300049591 | Ga0501075_0316874 | Ga0501075_0316874_203_1033 | 276 |
| 596 | 3300049592 | Ga0501076_0040468 | Ga0501076_0040468_1557_2387 | 276 |
| 597 | 3300049592 | Ga0501076_0126687 | Ga0501076_0126687_293_1123 | 276 |
| 598 | 3300049592 | Ga0501076_0243439 | Ga0501076_0243439_208_1038 | 276 |
| 599 | 3300049593 | Ga0501077_0023940 | Ga0501077_0023940_1553_2383 | 276 |
| 600 | 3300049593 | Ga0501077_0050471 | Ga0501077_0050471_1614_2444 | 276 |
| 601 | 3300049593 | Ga0501077_0197409 | Ga0501077_0197409_95_925 | 276 |
| 602 | 3300049741 | Ga0501079_0011754 | Ga0501079_0011754_3523_4353 | 276 |
| 603 | 3300049741 | Ga0501079_0165116 | Ga0501079_0165116_755_1585 | 276 |
| 604 | 3300049741 | Ga0501079_0193996 | Ga0501079_0193996_464_1294 | 276 |
| 605 | 3300049741 | Ga0501079_0262341 | Ga0501079_0262341_447_1277 | 276 |
| 606 | 3300049742 | Ga0501080_0048773 | Ga0501080_0048773_576_1406 | 276 |
| 607 | 3300049742 | Ga0501080_0380310 | Ga0501080_0380310_94_924 | 276 |
| 608 | 3300049742 | Ga0501080_0506408 | Ga0501080_0506408_72_902 | 276 |
| 609 | 3300049743 | Ga0501081_0099008 | Ga0501081_0099008_238_1068 | 276 |
| 610 | 3300049743 | Ga0501081_0122598 | Ga0501081_0122598_79_909 | 276 |
| 611 | 3300049743 | Ga0501081_0159749 | Ga0501081_0159749_377_1207 | 276 |
| 612 | 3300049744 | Ga0501083_0007534 | Ga0501083_0007534_3730_4560 | 276 |
| 613 | 3300049744 | Ga0501083_0023782 | Ga0501083_0023782_967_1797 | 276 |
| 614 | 3300049744 | Ga0501083_0041793 | Ga0501083_0041793_2083_2913 | 276 |
| 615 | 3300049744 | Ga0501083_0181348 | Ga0501083_0181348_417_1247 | 276 |
| 616 | 3300049822 | Ga0501035_0021510 | Ga0501035_0021510_5049_5879 | 276 |
| 617 | 3300049822 | Ga0501035_0054011 | Ga0501035_0054011_1081_1911 | 276 |
| 618 | 3300049823 | Ga0501044_0046640 | Ga0501044_0046640_2253_3083 | 276 |
| 619 | 3300049824 | Ga0501045_0034020 | Ga0501045_0034020_1920_2750 | 276 |
| 620 | 3300049824 | Ga0501045_0046018 | Ga0501045_0046018_1400_2230 | 276 |
| 621 | 3300049824 | Ga0501045_0168261 | Ga0501045_0168261_664_1494 | 276 |
| 622 | 3300049824 | Ga0501045_0213648 | Ga0501045_0213648_55_885 | 276 |
| 623 | 3300050491 | nmdc:mga00v17_340768_c1 | nmdc:mga00v17_340768_c1_130_960 | 276 |
| 624 | 3300050492 | nmdc:mga0yw44_25303_c1 | nmdc:mga0yw44_25303_c1_334_1164 | 276 |
| 625 | 3300050494 | nmdc:mga06z11_116291_c1 | nmdc:mga06z11_116291_c1_227_1057 | 276 |
| 626 | 3300050494 | nmdc:mga06z11_81485_c1 | nmdc:mga06z11_81485_c1_447_1277 | 276 |
| 627 | 3300053077 | Ga0495601_0073629 | Ga0495601_0073629_272_1102 | 276 |
| 628 | 3300053078 | Ga0495612_0123646 | Ga0495612_0123646_147_977 | 276 |
| 629 | 3300053084 | Ga0495595_0048749 | Ga0495595_0048749_1093_1923 | 276 |
| 630 | 3300053085 | Ga0495619_0013492 | Ga0495619_0013492_146_976 | 276 |
| 631 | 3300053085 | Ga0495619_0191749 | Ga0495619_0191749_300_1130 | 276 |
| 632 | 3300053085 | Ga0495619_0250047 | Ga0495619_0250047_343_1173 | 276 |
| 633 | 3300053085 | Ga0495619_0260840 | Ga0495619_0260840_179_1147 | 276 |
| 634 | 3300053092 | Ga0500583_0003848 | Ga0500583_0003848_3208_4038 | 276 |
| 635 | 3300053130 | Ga0500642_0044647 | Ga0500642_0044647_30_860 | 276 |
| 636 | 3300054114 | Ga0501084_0026444 | Ga0501084_0026444_248_1078 | 276 |
| 637 | 3300054114 | Ga0501084_0048089 | Ga0501084_0048089_1964_2794 | 276 |
| 638 | 3300054114 | Ga0501084_0221497 | Ga0501084_0221497_567_1397 | 276 |
| 639 | 3300060353 | Ga0501082_0040761 | Ga0501082_0040761_1834_2664 | 276 |
| 640 | 3300060353 | Ga0501082_0052163 | Ga0501082_0052163_253_1083 | 276 |
| 641 | 3300060353 | Ga0501082_0066684 | Ga0501082_0066684_213_1043 | 276 |
| 642 | 3300060353 | Ga0501082_0071321 | Ga0501082_0071321_488_1318 | 276 |
| 643 | 3300061734 | Ga0530510_0054568 | Ga0530510_0054568_1861_2691 | 276 |
| 644 | 3300061734 | Ga0530510_0074563 | Ga0530510_0074563_974_1804 | 276 |
| 645 | 3300061734 | Ga0530510_0154817 | Ga0530510_0154817_18_848 | 276 |
| 646 | 3300061734 | Ga0530510_0339537 | Ga0530510_0339537_230_1060 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ftp-assembly1.cif.gz_D | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution | 0.9577 | 6 | 270 |
| 3grp-assembly1.cif.gz_D | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9545 | 5 | 269 |
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.9544 | 8 | 269 |
| 4za2-assembly1.cif.gz_C | crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ | 0.9544 | 2 | 270 |
| 6ixm-assembly1.cif.gz_B | crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad | 0.9543 | 9 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0JEC9_1_74_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9616 | 6 | 67 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9543 | 9 | 270 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9532 | 2 | 209 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9502 | 6 | 272 | 3.40.50.720 |
| 4iinB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9496 | 12 | 270 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534J3R9-F1-model_v4 | SDR family oxidoreductase | 0.9856 | 1 | 276 |
GO:0016616
GO:0030497 |
| AF-A0A534HFF2-F1-model_v4 | SDR family oxidoreductase | 0.983 | 62 | 276 |
GO:0016616
|
| AF-A0A534CWY4-F1-model_v4 | SDR family oxidoreductase | 0.9815 | 76 | 276 |
GO:0016616
|
| AF-A0A1Q4BC21-F1-model_v4 | Short-chain dehydrogenase | 0.9746 | 1 | 276 |
GO:0016491
|
| AF-A0A0C3IF51-F1-model_v4 | Short-chain dehydrogenase | 0.9705 | 1 | 276 |
GO:0050664
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar