F471682

General Info

Members Datasets Scaffolds Average Seq Length
640 270 640 98

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11144345|Ga0105248_111443452
Length 111
Sequence MSLNFENDQEIYFMKKVFVLMLLTASPVFAQGGAAAAGPGVNWIAVTSGFAMAIASSVCALAQGKAIAAACESLARNPGAAPAIRFALLLGLVLIESLGLYTLVIIFVKVV

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
170 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 3.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.34
Rhizosphere 97.03
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11154281 3300004798 Unclassified 556
2 Ga0058861_11369154 3300004800 Bacteria 848
3 Ga0058861_11845831 3300004800 Unclassified 625
4 Ga0058862_12741009 3300004803 Bacteria 1486
5 Ga0070676_10249076 3300005328 Unclassified 1185
6 Ga0070676_10970500 3300005328 Bacteria 636
7 Ga0070683_100039816 3300005329 Bacteria 4317
8 Ga0070683_100068864 3300005329 Unclassified 3297
9 Ga0070683_100152242 3300005329 Unclassified 2193
10 Ga0070683_100523661 3300005329 Unclassified 1133
11 Ga0070683_101623725 3300005329 Unclassified 622
12 Ga0070690_100117501 3300005330 Bacteria 1781
13 Ga0070670_100785838 3300005331 Bacteria 859
14 Ga0070670_101075007 3300005331 Unclassified 733
15 Ga0068869_100024557 3300005334 Unclassified 4175
16 Ga0070666_10089856 3300005335 Bacteria 2109
17 Ga0070666_10181977 3300005335 Unclassified 1474
18 Ga0070680_100910927 3300005336 Bacteria 759
19 Ga0070680_101361144 3300005336 Bacteria 614
20 Ga0070682_100048850 3300005337 Bacteria 2636
21 Ga0070682_100218569 3300005337 Bacteria 1355
22 Ga0068868_100589331 3300005338 Bacteria 984
23 Ga0068868_100786322 3300005338 Unclassified 857
24 Ga0070660_100070274 3300005339 Bacteria 2732
25 Ga0070660_100523189 3300005339 Unclassified 988
26 Ga0070689_100492711 3300005340 Bacteria 1049
27 Ga0070689_101394893 3300005340 Unclassified 633
28 Ga0070687_101380521 3300005343 Unclassified 526
29 Ga0070661_100358962 3300005344 Unclassified 1145
30 Ga0070669_100663989 3300005353 Unclassified 878
31 Ga0070669_100880602 3300005353 Unclassified 764
32 Ga0070669_101931092 3300005353 Bacteria 516
33 Ga0070675_101437403 3300005354 Unclassified 636
34 Ga0070675_101708980 3300005354 Unclassified 581
35 Ga0070671_100093748 3300005355 Bacteria 2516
36 Ga0070671_100197440 3300005355 Bacteria 1706
37 Ga0070671_100664647 3300005355 Unclassified 903
38 Ga0070671_101395222 3300005355 Bacteria 619
39 Ga0070674_100425022 3300005356 Bacteria 1091
40 Ga0070674_102049180 3300005356 Unclassified 521
41 Ga0070673_100006804 3300005364 Bacteria 7468
42 Ga0070673_100109751 3300005364 Bacteria 2286
43 Ga0070673_100333700 3300005364 Unclassified 1342
44 Ga0070688_100924617 3300005365 Bacteria 689
45 Ga0070659_100472612 3300005366 Unclassified 1066
46 Ga0070667_100013365 3300005367 Bacteria 6786
47 Ga0070667_100766083 3300005367 Bacteria 895
48 Ga0070667_100781135 3300005367 Bacteria 886
49 Ga0070709_10105097 3300005434 Bacteria 1888
50 Ga0070709_10346212 3300005434 Bacteria 1097
51 Ga0070709_10519274 3300005434 Unclassified 907
52 Ga0070709_10629475 3300005434 Unclassified 829
53 Ga0070713_100375697 3300005436 Bacteria 1323
54 Ga0070713_100535431 3300005436 Bacteria 1108
55 Ga0070713_101798182 3300005436 Unclassified 595
56 Ga0070710_10011181 3300005437 Unclassified 4429
57 Ga0070711_100000520 3300005439 Bacteria 19955
58 Ga0070711_100217934 3300005439 Bacteria 1482
59 Ga0070711_100300218 3300005439 Unclassified 1277
60 Ga0070711_101255223 3300005439 Bacteria 642
61 Ga0070705_101591311 3300005440 Unclassified 550
62 Ga0070694_100163357 3300005444 Bacteria 1636
63 Ga0070708_101944575 3300005445 Bacteria 545
64 Ga0070663_100495742 3300005455 Unclassified 1013
65 Ga0070678_100496150 3300005456 Unclassified 1076
66 Ga0070662_100448347 3300005457 Bacteria 1071
67 Ga0070681_10069406 3300005458 Unclassified 3490
68 Ga0068867_100313800 3300005459 Unclassified 1296
69 Ga0068867_101339265 3300005459 Bacteria 662
70 Ga0068867_101390973 3300005459 Unclassified 650
71 Ga0070706_100143688 3300005467 Bacteria 2228
72 Ga0070706_100431317 3300005467 Unclassified 1227
73 Ga0070706_101855384 3300005467 Unclassified 547
74 Ga0070699_101657660 3300005518 Unclassified 586
75 Ga0070699_102174711 3300005518 Unclassified 506
76 Ga0070679_100345026 3300005530 Bacteria 1437
77 Ga0070679_100359986 3300005530 Bacteria 1402
78 Ga0070679_100448790 3300005530 Bacteria 1234
79 Ga0070684_100044513 3300005535 Bacteria 3840
80 Ga0070684_100074273 3300005535 Bacteria 2997
81 Ga0070684_100678742 3300005535 Bacteria 960
82 Ga0070697_100642755 3300005536 Bacteria 934
83 Ga0070697_100907664 3300005536 Bacteria 782
84 Ga0070697_101548883 3300005536 Bacteria 593
85 Ga0068853_100290319 3300005539 Bacteria 1510
86 Ga0068853_101530231 3300005539 Bacteria 646
87 Ga0068853_101979889 3300005539 Unclassified 565
88 Ga0070672_100056579 3300005543 Bacteria 3076
89 Ga0070672_100325829 3300005543 Bacteria 1306
90 Ga0070686_100375457 3300005544 Unclassified 1075
91 Ga0070695_100130341 3300005545 Bacteria 1732
92 Ga0070695_100254619 3300005545 Bacteria 1279
93 Ga0070695_100876731 3300005545 Unclassified 723
94 Ga0070695_101404666 3300005545 Unclassified 579
95 Ga0070696_100042694 3300005546 Bacteria 3134
96 Ga0070696_100815951 3300005546 Bacteria 769
97 Ga0070693_101516976 3300005547 Unclassified 524
98 Ga0070665_100027769 3300005548 Bacteria 5698
99 Ga0070665_100735307 3300005548 Bacteria 1000
100 Ga0070665_100860193 3300005548 Bacteria 920
101 Ga0070665_101138278 3300005548 Bacteria 792
102 Ga0070665_101713167 3300005548 Unclassified 636
103 Ga0068855_100567796 3300005563 Bacteria 1226
104 Ga0070664_100028307 3300005564 Bacteria 4660
105 Ga0070664_100047880 3300005564 Bacteria 3613
106 Ga0070664_100197124 3300005564 Bacteria 1795
107 Ga0070664_101377021 3300005564 Unclassified 667
108 Ga0068854_100364238 3300005578 Unclassified 1187
109 Ga0068856_101270801 3300005614 Bacteria 752
110 Ga0070702_101349862 3300005615 Unclassified 581
111 Ga0070702_101541208 3300005615 Bacteria 548
112 Ga0068859_100082419 3300005617 Bacteria 3259
113 Ga0068859_100464785 3300005617 Bacteria 1361
114 Ga0068859_100672367 3300005617 Unclassified 1127
115 Ga0068864_100104402 3300005618 Bacteria 2517
116 Ga0068864_100367480 3300005618 Bacteria 1361
117 Ga0068864_100687298 3300005618 Unclassified 999
118 Ga0068864_101014084 3300005618 Bacteria 824
119 Ga0068864_102273142 3300005618 Unclassified 549
120 Ga0068851_10044782 3300005834 Bacteria 2235
121 Ga0068870_10417689 3300005840 Bacteria 877
122 Ga0068870_10504701 3300005840 Bacteria 807
123 Ga0068863_100049894 3300005841 Unclassified 3968
124 Ga0068863_100087919 3300005841 Unclassified 2945
125 Ga0068863_100251686 3300005841 Bacteria 1707
126 Ga0068863_100635780 3300005841 Bacteria 1058
127 Ga0068858_100046861 3300005842 Bacteria 4008
128 Ga0068858_100224572 3300005842 Unclassified 1779
129 Ga0068858_100398171 3300005842 Bacteria 1323
130 Ga0068858_102000777 3300005842 Bacteria 573
131 Ga0068860_100337821 3300005843 Bacteria 1480
132 Ga0068860_100683613 3300005843 Unclassified 1035
133 Ga0068862_101996394 3300005844 Bacteria 591
134 Ga0070717_11460640 3300006028 Bacteria 620
135 Ga0070715_10005313 3300006163 Unclassified 4288
136 Ga0070716_100030778 3300006173 Unclassified 2916
137 Ga0070716_100061144 3300006173 Bacteria 2179
138 Ga0070716_100131299 3300006173 Bacteria 1584
139 Ga0070716_100360833 3300006173 Unclassified 1032
140 Ga0070716_100561081 3300006173 Unclassified 853
141 Ga0070712_100002059 3300006175 Bacteria 12320
142 Ga0070712_100509330 3300006175 Unclassified 1010
143 Ga0070712_101611791 3300006175 Unclassified 568
144 Ga0097621_100027492 3300006237 Bacteria 4474
145 Ga0097621_100136306 3300006237 Bacteria 2094
146 Ga0097621_100142660 3300006237 Bacteria 2048
147 Ga0097621_100229646 3300006237 Bacteria 1620
148 Ga0097621_100459589 3300006237 Unclassified 1148
149 Ga0097621_100637099 3300006237 Bacteria 977
150 Ga0097621_100668127 3300006237 Unclassified 954
151 Ga0097621_101185674 3300006237 Unclassified 719
152 Ga0097621_101513890 3300006237 Bacteria 637
153 Ga0068871_100173527 3300006358 Bacteria 1849
154 Ga0068871_100375722 3300006358 Unclassified 1262
155 Ga0068871_100504253 3300006358 Bacteria 1091
156 Ga0068871_100529832 3300006358 Unclassified 1065
157 Ga0068871_100687296 3300006358 Unclassified 936
158 Ga0068871_101074000 3300006358 Bacteria 752
159 Ga0075428_100027054 3300006844 Bacteria 6350
160 Ga0075430_100540772 3300006846 Bacteria 961
161 Ga0075430_100598846 3300006846 Bacteria 909
162 Ga0075430_100953351 3300006846 Unclassified 707
163 Ga0075431_100077674 3300006847 Bacteria 3426
164 Ga0075431_100098163 3300006847 Bacteria 3024
165 Ga0075433_10092782 3300006852 Bacteria 2671
166 Ga0075433_10214882 3300006852 Bacteria 1709
167 Ga0075433_10378414 3300006852 Bacteria 1250
168 Ga0075433_11172613 3300006852 Unclassified 667
169 Ga0075434_100029427 3300006871 Bacteria 5405
170 Ga0075434_100037481 3300006871 Bacteria 4799
171 Ga0075434_100242336 3300006871 Bacteria 1823
172 Ga0075434_100664540 3300006871 Bacteria 1060
173 Ga0075429_100964169 3300006880 Bacteria 746
174 Ga0075429_101320717 3300006880 Bacteria 629
175 Ga0068865_101037662 3300006881 Unclassified 719
176 Ga0075436_100007299 3300006914 Bacteria 7556
177 Ga0075436_100139154 3300006914 Bacteria 1705
178 Ga0075436_101369398 3300006914 Unclassified 536
179 Ga0097620_100082412 3300006931 Bacteria 3259
180 Ga0097620_100464717 3300006931 Bacteria 1361
181 Ga0097620_100672420 3300006931 Unclassified 1127
182 Ga0075435_100039393 3300007076 Bacteria 3771
183 Ga0075435_100304546 3300007076 Unclassified 1363
184 Ga0075435_101105522 3300007076 Unclassified 693
185 Ga0075435_101336512 3300007076 Bacteria 628
186 Ga0105251_10282618 3300009011 Bacteria 750
187 Ga0105240_10001086 3300009093 Bacteria 48011
188 Ga0105240_10331368 3300009093 Unclassified 1732
189 Ga0105240_10360485 3300009093 Bacteria 1647
190 Ga0105240_10386958 3300009093 Bacteria 1578
191 Ga0111539_10635405 3300009094 Unclassified 1243
192 Ga0111539_11363620 3300009094 Unclassified 823
193 Ga0114129_10248011 3300009147 Bacteria 2391
194 Ga0114129_10718704 3300009147 Bacteria 1282
195 Ga0114129_11302412 3300009147 Unclassified 900
196 Ga0105243_10846275 3300009148 Bacteria 905
197 Ga0105243_11076075 3300009148 Unclassified 811
198 Ga0105243_12189425 3300009148 Unclassified 589
199 Ga0105241_10363286 3300009174 Bacteria 1260
200 Ga0105241_10398447 3300009174 Bacteria 1207
201 Ga0105241_11171848 3300009174 Unclassified 727
202 Ga0105241_11466631 3300009174 Unclassified 655
203 Ga0105241_11623083 3300009174 Bacteria 626
204 Ga0105242_10051435 3300009176 Bacteria 3357
205 Ga0105242_10245100 3300009176 Bacteria 1612
206 Ga0105242_10397304 3300009176 Unclassified 1285
207 Ga0105242_10973021 3300009176 Unclassified 854
208 Ga0105242_11404235 3300009176 Bacteria 726
209 Ga0105242_11644258 3300009176 Bacteria 677
210 Ga0105248_10046855 3300009177 Bacteria 4847
211 Ga0105248_10138076 3300009177 Unclassified 2750
212 Ga0105248_10197007 3300009177 Unclassified 2270
213 Ga0105248_10310602 3300009177 Bacteria 1776
214 Ga0105248_10492305 3300009177 Unclassified 1382
215 Ga0105248_10648191 3300009177 Bacteria 1192
216 Ga0105248_10708219 3300009177 Bacteria 1136
217 Ga0105248_10897660 3300009177 Bacteria 1001
218 Ga0105248_10989905 3300009177 Unclassified 950
219 Ga0105248_11144345 3300009177 Bacteria 880
220 Ga0105248_11821069 3300009177 Bacteria 690
221 Ga0105237_10117442 3300009545 Unclassified 2654
222 Ga0105237_10125841 3300009545 Bacteria 2557
223 Ga0105237_10132511 3300009545 Bacteria 2487
224 Ga0105237_10453793 3300009545 Bacteria 1288
225 Ga0105237_10463569 3300009545 Bacteria 1273
226 Ga0105237_10951362 3300009545 Unclassified 866
227 Ga0105237_11369767 3300009545 Unclassified 714
228 Ga0105238_10131891 3300009551 Bacteria 2477
229 Ga0105238_10393564 3300009551 Unclassified 1378
230 Ga0105238_10652211 3300009551 Unclassified 1063
231 Ga0105249_10335901 3300009553 Bacteria 1526
232 Ga0105249_11080558 3300009553 Unclassified 872
233 Ga0105239_10097404 3300010375 Bacteria 3251
234 Ga0105239_10606956 3300010375 Bacteria 1248
235 Ga0105239_10841302 3300010375 Bacteria 1052
236 Ga0105239_13335393 3300010375 Bacteria 522
237 Ga0105246_10435614 3300011119 Unclassified 1098
238 Ga0105246_11083483 3300011119 Bacteria 730
239 Ga0105246_11690807 3300011119 Unclassified 601
240 Ga0157373_10173814 3300013100 Bacteria 1516
241 Ga0157373_10441017 3300013100 Bacteria 936
242 Ga0157373_10491594 3300013100 Bacteria 886
243 Ga0157370_11270668 3300013104 Bacteria 663
244 Ga0157370_11426463 3300013104 Bacteria 623
245 Ga0157370_11808592 3300013104 Unclassified 548
246 Ga0157369_10161448 3300013105 Unclassified 2366
247 Ga0157369_10708371 3300013105 Bacteria 1036
248 Ga0157369_11486042 3300013105 Bacteria 689
249 Ga0157374_10033336 3300013296 Bacteria 4699
250 Ga0157374_10083489 3300013296 Bacteria 3035
251 Ga0157374_10985213 3300013296 Unclassified 862
252 Ga0157374_11191013 3300013296 Bacteria 783
253 Ga0157374_11686371 3300013296 Bacteria 658
254 Ga0157378_10041431 3300013297 Unclassified 4084
255 Ga0157378_10251024 3300013297 Bacteria 1694
256 Ga0157378_10338716 3300013297 Bacteria 1466
257 Ga0157378_10448393 3300013297 Bacteria 1280
258 Ga0157378_10671680 3300013297 Bacteria 1053
259 Ga0157378_10853180 3300013297 Bacteria 939
260 Ga0157378_10995308 3300013297 Bacteria 872
261 Ga0157378_11186195 3300013297 Bacteria 802
262 Ga0157378_11229185 3300013297 Unclassified 789
263 Ga0157378_11900389 3300013297 Unclassified 644
264 Ga0157378_12657595 3300013297 Unclassified 553
265 Ga0163162_10013797 3300013306 Bacteria 7892
266 Ga0163162_10464635 3300013306 Bacteria 1397
267 Ga0163162_10481455 3300013306 Bacteria 1372
268 Ga0163162_10571355 3300013306 Bacteria 1258
269 Ga0163162_10915240 3300013306 Bacteria 990
270 Ga0163162_11037518 3300013306 Bacteria 928
271 Ga0157372_10023879 3300013307 Bacteria 6634
272 Ga0157372_10117600 3300013307 Bacteria 3049
273 Ga0157372_10308763 3300013307 Unclassified 1841
274 Ga0157372_11586517 3300013307 Bacteria 753
275 Ga0157372_11588848 3300013307 Unclassified 753
276 Ga0157372_12544587 3300013307 Unclassified 587
277 Ga0157375_10013753 3300013308 Bacteria 7214
278 Ga0157375_10149587 3300013308 Bacteria 2469
279 Ga0157375_10371864 3300013308 Unclassified 1596
280 Ga0157375_10498997 3300013308 Unclassified 1381
281 Ga0157375_10720361 3300013308 Bacteria 1150
282 Ga0157375_12087978 3300013308 Unclassified 674
283 Ga0157375_12820810 3300013308 Unclassified 581
284 Ga0157375_13754339 3300013308 Unclassified 505
285 Ga0163163_10028533 3300014325 Bacteria 5360
286 Ga0163163_10055760 3300014325 Bacteria 3906
287 Ga0163163_10062121 3300014325 Bacteria 3701
288 Ga0163163_10096938 3300014325 Bacteria 2969
289 Ga0163163_10151255 3300014325 Unclassified 2365
290 Ga0163163_10382025 3300014325 Bacteria 1466
291 Ga0163163_10423745 3300014325 Bacteria 1390
292 Ga0163163_10914610 3300014325 Bacteria 941
293 Ga0157380_10152191 3300014326 Bacteria 2001
294 Ga0157380_11580121 3300014326 Unclassified 711
295 Ga0182008_10093691 3300014497 Bacteria 1482
296 Ga0157377_10226594 3300014745 Unclassified 1199
297 Ga0157377_11105782 3300014745 Bacteria 607
298 Ga0157379_10021300 3300014968 Bacteria 5737
299 Ga0157379_10752213 3300014968 Bacteria 918
300 Ga0157379_11136771 3300014968 Bacteria 749
301 Ga0157376_10102075 3300014969 Bacteria 2508
302 Ga0157376_10439747 3300014969 Unclassified 1270
303 Ga0157376_10800372 3300014969 Bacteria 955
304 Ga0157376_11089933 3300014969 Bacteria 824
305 Ga0157376_11203344 3300014969 Bacteria 786
306 Ga0157376_11695616 3300014969 Bacteria 667
307 Ga0157376_11814175 3300014969 Bacteria 646
308 Ga0157376_12332023 3300014969 Unclassified 574
309 Ga0182007_10031782 3300015262 Bacteria 1796
310 Ga0182005_1078488 3300015265 Unclassified 910
311 Ga0163161_10161597 3300017792 Bacteria 1708
312 Ga0163161_11028778 3300017792 Unclassified 704
313 Ga0163161_11029243 3300017792 Unclassified 704
314 Ga0184593_119779 3300019179 Unclassified 553
315 Ga0184598_142313 3300019182 Bacteria 504
316 Ga0184601_123318 3300019183 Bacteria 527
317 Ga0206352_10258107 3300020078 Bacteria 826
318 Ga0206354_10048515 3300020081 Unclassified 580
319 Ga0213874_10379101 3300021377 Unclassified 547
320 Ga0224570_103130 3300022730 Bacteria 1061
321 Ga0224572_1014433 3300024225 Bacteria 1509
322 Ga0228598_1001630 3300024227 Unclassified 4903
323 Ga0207697_10199031 3300025315 Unclassified 881
324 Ga0207653_10035301 3300025885 Bacteria 1626
325 Ga0207692_10017532 3300025898 Unclassified 3196
326 Ga0207642_10191118 3300025899 Unclassified 1123
327 Ga0207680_10038192 3300025903 Bacteria 2778
328 Ga0207685_10080404 3300025905 Bacteria 1347
329 Ga0207699_10060684 3300025906 Bacteria 2272
330 Ga0207699_10288338 3300025906 Bacteria 1143
331 Ga0207699_10405806 3300025906 Bacteria 971
332 Ga0207699_10624860 3300025906 Bacteria 785
333 Ga0207645_10813367 3300025907 Bacteria 635
334 Ga0207684_10709551 3300025910 Bacteria 854
335 Ga0207654_10807812 3300025911 Unclassified 678
336 Ga0207654_10937484 3300025911 Bacteria 628
337 Ga0207707_10126950 3300025912 Bacteria 2231
338 Ga0207707_10214012 3300025912 Bacteria 1678
339 Ga0207707_11352295 3300025912 Unclassified 570
340 Ga0207695_10005447 3300025913 Bacteria 16868
341 Ga0207671_10018759 3300025914 Bacteria 5301
342 Ga0207671_10500216 3300025914 Bacteria 969
343 Ga0207693_10000152 3300025915 Bacteria 63967
344 Ga0207663_10005842 3300025916 Bacteria 6240
345 Ga0207660_10256378 3300025917 Bacteria 1382
346 Ga0207662_11315465 3300025918 Unclassified 513
347 Ga0207657_11029851 3300025919 Unclassified 631
348 Ga0207652_10055739 3300025921 Bacteria 3401
349 Ga0207652_10305994 3300025921 Bacteria 1435
350 Ga0207652_11616632 3300025921 Bacteria 552
351 Ga0207681_10655939 3300025923 Unclassified 870
352 Ga0207681_11473599 3300025923 Unclassified 571
353 Ga0207681_11567699 3300025923 Bacteria 552
354 Ga0207694_10265192 3300025924 Unclassified 1408
355 Ga0207694_10530644 3300025924 Unclassified 987
356 Ga0207650_10231915 3300025925 Bacteria 1489
357 Ga0207650_11360677 3300025925 Bacteria 604
358 Ga0207659_10516474 3300025926 Unclassified 1012
359 Ga0207687_10349851 3300025927 Unclassified 1204
360 Ga0207687_11749153 3300025927 Bacteria 532
361 Ga0207700_10321145 3300025928 Bacteria 1342
362 Ga0207644_10248625 3300025931 Bacteria 1418
363 Ga0207706_10228815 3300025933 Unclassified 1627
364 Ga0207706_10985158 3300025933 Bacteria 709
365 Ga0207686_10236131 3300025934 Bacteria 1328
366 Ga0207686_10503467 3300025934 Unclassified 940
367 Ga0207709_10825044 3300025935 Bacteria 750
368 Ga0207709_11352463 3300025935 Unclassified 589
369 Ga0207709_11368914 3300025935 Unclassified 586
370 Ga0207670_10541170 3300025936 Bacteria 950
371 Ga0207670_10952303 3300025936 Unclassified 721
372 Ga0207670_11212429 3300025936 Unclassified 639
373 Ga0207669_11486039 3300025937 Unclassified 578
374 Ga0207704_10360957 3300025938 Bacteria 1134
375 Ga0207665_10045369 3300025939 Unclassified 2943
376 Ga0207665_10049699 3300025939 Bacteria 2818
377 Ga0207665_10198725 3300025939 Bacteria 1460
378 Ga0207665_10235664 3300025939 Bacteria 1347
379 Ga0207665_11068647 3300025939 Unclassified 643
380 Ga0207691_10039241 3300025940 Bacteria 4380
381 Ga0207711_10118781 3300025941 Unclassified 2359
382 Ga0207711_10490985 3300025941 Unclassified 1144
383 Ga0207711_11736096 3300025941 Bacteria 567
384 Ga0207689_10103446 3300025942 Unclassified 2340
385 Ga0207689_10633341 3300025942 Unclassified 900
386 Ga0207661_10039258 3300025944 Bacteria 3715
387 Ga0207661_10118455 3300025944 Unclassified 2251
388 Ga0207661_11969682 3300025944 Unclassified 530
389 Ga0207679_10259964 3300025945 Bacteria 1480
390 Ga0207679_10849910 3300025945 Bacteria 833
391 Ga0207679_11762553 3300025945 Unclassified 566
392 Ga0207651_10230206 3300025960 Unclassified 1504
393 Ga0207651_10233078 3300025960 Bacteria 1496
394 Ga0207651_10714991 3300025960 Bacteria 883
395 Ga0207651_11251163 3300025960 Bacteria 667
396 Ga0207651_11483675 3300025960 Bacteria 611
397 Ga0207712_10270553 3300025961 Unclassified 1382
398 Ga0207640_11255864 3300025981 Unclassified 660
399 Ga0207658_10084841 3300025986 Bacteria 2438
400 Ga0207658_10202783 3300025986 Unclassified 1657
401 Ga0207677_10506658 3300026023 Bacteria 1045
402 Ga0207677_10569022 3300026023 Bacteria 990
403 Ga0207677_12213137 3300026023 Unclassified 512
404 Ga0207703_10066023 3300026035 Bacteria 2976
405 Ga0207703_10238923 3300026035 Bacteria 1632
406 Ga0207703_11901474 3300026035 Unclassified 571
407 Ga0207678_11132791 3300026067 Unclassified 693
408 Ga0207641_10010793 3300026088 Bacteria 7489
409 Ga0207641_10473408 3300026088 Bacteria 1213
410 Ga0207641_10555523 3300026088 Unclassified 1120
411 Ga0207641_11737870 3300026088 Unclassified 626
412 Ga0207648_10225146 3300026089 Bacteria 1668
413 Ga0207648_10455558 3300026089 Unclassified 1165
414 Ga0207648_10736276 3300026089 Bacteria 915
415 Ga0207648_11254702 3300026089 Unclassified 696
416 Ga0207648_11308193 3300026089 Unclassified 681
417 Ga0207676_10165367 3300026095 Bacteria 1921
418 Ga0207676_10313197 3300026095 Unclassified 1438
419 Ga0207676_10684184 3300026095 Bacteria 992
420 Ga0207676_10751789 3300026095 Unclassified 948
421 Ga0207676_12251298 3300026095 Unclassified 543
422 Ga0207674_11064209 3300026116 Bacteria 778
423 Ga0207674_11092189 3300026116 Bacteria 767
424 Ga0207675_100254083 3300026118 Bacteria 1702
425 Ga0207675_102401274 3300026118 Unclassified 539
426 Ga0207683_10357494 3300026121 Bacteria 1341
427 Ga0207428_10074611 3300027907 Bacteria 2660
428 Ga0207428_10420456 3300027907 Unclassified 977
429 Ga0265354_1013991 3300028016 Unclassified 760
430 Ga0265356_1007140 3300028017 Unclassified 1293
431 Ga0268266_10091695 3300028379 Unclassified 2665
432 Ga0268265_10371960 3300028380 Bacteria 1312
433 Ga0268265_11748079 3300028380 Bacteria 628
434 Ga0268264_10436768 3300028381 Bacteria 1265
435 Ga0268264_10499046 3300028381 Unclassified 1187
436 Ga0265338_10075035 3300028800 Unclassified 2872
437 Ga0265762_1003341 3300030760 Bacteria 2869
438 Ga0265770_1003487 3300030878 Bacteria 2138
439 Ga0265770_1111501 3300030878 Unclassified 567
440 Ga0265770_1143361 3300030878 Unclassified 519
441 Ga0265765_1001004 3300030879 Bacteria 2497
442 Ga0265765_1024717 3300030879 Unclassified 742
443 Ga0265771_1007422 3300031010 Bacteria 746
444 Ga0265771_1019559 3300031010 Unclassified 577
445 Ga0265760_10002361 3300031090 Bacteria 5523
446 Ga0265760_10003029 3300031090 Bacteria 4915
447 Ga0265760_10383501 3300031090 Bacteria 506
448 Ga0316212_1052520 3300033547 Bacteria 581
449 Ga0373958_0037523 3300034819 Bacteria 978
450 Ga0373959_0071115 3300034820 Unclassified 787
451 Ga0373926_0015059 3300035083 Unclassified 2634
452 Ga0373929_0066746 3300035085 Unclassified 853
453 Ga0373944_0319819 3300035089 Bacteria 586
454 Ga0373951_0183454 3300035091 Unclassified 602
455 Ga0373923_0134470 3300035111 Bacteria 1114
456 Ga0373923_0194919 3300035111 Bacteria 935
457 Ga0373932_0020990 3300035112 Bacteria 1719
458 Ga0373945_0099518 3300035116 Unclassified 1136
459 Ga0373954_0329331 3300035118 Bacteria 754
460 Ga0373954_0464084 3300035118 Bacteria 627
461 Ga0373957_0133947 3300035120 Unclassified 1010
462 Ga0373960_0006687 3300035121 Bacteria 2712
463 Ga0373943_0018141 3300035170 Unclassified 3230
464 Ga0373946_0089599 3300035171 Unclassified 1361
465 Ga0373955_0130463 3300035172 Bacteria 1467
466 Ga0373955_0516756 3300035172 Bacteria 730
467 Ga0373924_0085914 3300035410 Bacteria 1342
468 Ga0373924_0233246 3300035410 Unclassified 814
469 Ga0373931_0162746 3300035691 Bacteria 1309
470 Ga0373931_0192462 3300035691 Bacteria 1214
471 Ga0373931_0373679 3300035691 Unclassified 897
472 Ga0373935_0342332 3300035692 Bacteria 1065
473 Ga0373935_0390871 3300035692 Unclassified 997
474 Ga0373935_0541016 3300035692 Bacteria 848
475 Ga0373927_0006221 3300035695 Bacteria 8151
476 Ga0373927_0273285 3300035695 Bacteria 1111
477 Ga0373927_0724340 3300035695 Unclassified 657
478 Ga0373927_0889707 3300035695 Unclassified 588
479 Ga0373933_0805128 3300035724 Bacteria 618
480 Ga0373933_0843388 3300035724 Unclassified 603
481 Ga0373947_0239250 3300035725 Bacteria 1198
482 Ga0373947_0937818 3300035725 Unclassified 591
483 Ga0373937_0018615 3300036401 Bacteria 6204
484 Ga0373937_0039742 3300036401 Unclassified 4287
485 Ga0373937_0186600 3300036401 Bacteria 1948
486 Ga0373937_0212836 3300036401 Bacteria 1819
487 Ga0373937_0225840 3300036401 Unclassified 1763
488 Ga0373937_0540504 3300036401 Bacteria 1107
489 Ga0373925_0000062 3300037068 Bacteria 114902
490 Ga0373925_0131424 3300037068 Bacteria 1952
491 Ga0373925_0842374 3300037068 Bacteria 756
492 Ga0436360_0068673 3300039438 Bacteria 1597
493 Ga0436363_1666979 3300039450 Bacteria 1230
494 Ga0439448_0164916 3300042005 Unclassified 772
495 Ga0451576_0381180 3300045051 Bacteria 1478
496 Ga0451576_0430924 3300045051 Bacteria 1384
497 Ga0451576_0814453 3300045051 Unclassified 980
498 Ga0451576_1172002 3300045051 Unclassified 803
499 Ga0451576_1570593 3300045051 Unclassified 683
500 Ga0451576_2113054 3300045051 Unclassified 579
501 Ga0495592_0012532 3300046454 Bacteria 6442
502 Ga0495603_0538491 3300046455 Bacteria 669
503 Ga0495629_0050397 3300046459 Bacteria 2916
504 Ga0495651_0165039 3300046462 Unclassified 1583
505 Ga0495653_0591807 3300046463 Bacteria 683
506 Ga0495580_0012519 3300046472 Bacteria 6503
507 Ga0495580_0065269 3300046472 Unclassified 2550
508 Ga0495580_0080149 3300046472 Unclassified 2277
509 Ga0495580_0259864 3300046472 Bacteria 1187
510 Ga0495580_0653061 3300046472 Bacteria 692
511 Ga0495580_0935509 3300046472 Unclassified 555
512 Ga0495582_0437659 3300046473 Bacteria 755
513 Ga0495582_0841351 3300046473 Bacteria 531
514 Ga0495662_0195247 3300046476 Bacteria 998
515 Ga0495662_0206582 3300046476 Bacteria 968
516 Ga0495662_0589492 3300046476 Unclassified 544
517 Ga0495664_0149855 3300046477 Bacteria 1415
518 Ga0495664_0330367 3300046477 Unclassified 919
519 Ga0495594_0191331 3300046499 Unclassified 1166
520 Ga0495594_0416483 3300046499 Unclassified 764
521 Ga0495608_0036099 3300046511 Bacteria 3329
522 Ga0495618_0439576 3300046514 Bacteria 793
523 Ga0495618_0916259 3300046514 Unclassified 505
524 Ga0495628_0216984 3300046516 Bacteria 1438
525 Ga0495628_0220674 3300046516 Unclassified 1424
526 Ga0495628_0273852 3300046516 Unclassified 1255
527 Ga0495630_0587556 3300046517 Bacteria 854
528 Ga0495630_0608303 3300046517 Bacteria 838
529 Ga0495630_0740166 3300046517 Unclassified 752
530 Ga0495630_1148600 3300046517 Unclassified 588
531 Ga0495644_0248175 3300046523 Unclassified 691
532 Ga0495666_0111128 3300046526 Bacteria 1287
533 Ga0495666_0234317 3300046526 Bacteria 839
534 Ga0495652_0280711 3300046529 Bacteria 1220
535 Ga0495652_0842736 3300046529 Unclassified 608
536 Ga0495665_0044581 3300046531 Bacteria 2356
537 Ga0495665_0061982 3300046531 Unclassified 1975
538 Ga0495665_0574180 3300046531 Unclassified 565
539 Ga0495640_0544429 3300046533 Unclassified 704
540 Ga0495586_0058912 3300046535 Bacteria 2086
541 Ga0495587_0118332 3300046536 Bacteria 1518
542 Ga0495587_0266164 3300046536 Bacteria 962
543 Ga0495587_0825700 3300046536 Bacteria 506
544 Ga0495645_0033872 3300046543 Unclassified 3726
545 Ga0495645_0165310 3300046543 Bacteria 1527
546 Ga0495645_0941853 3300046543 Unclassified 511
547 Ga0495667_0001451 3300046559 Bacteria 15608
548 Ga0495667_0716036 3300046559 Bacteria 620
549 Ga0495667_0973818 3300046559 Unclassified 518
550 Ga0495634_0072118 3300046642 Bacteria 2272
551 Ga0495634_0296348 3300046642 Bacteria 979
552 Ga0495634_0603534 3300046642 Bacteria 637
553 Ga0495635_0359444 3300046663 Bacteria 971
554 Ga0495635_0811691 3300046663 Unclassified 602
555 Ga0495635_0963482 3300046663 Bacteria 544
556 Ga0495657_0000672 3300046675 Bacteria 30911
557 Ga0495599_0056864 3300046678 Bacteria 2448
558 Ga0495623_0303097 3300046679 Bacteria 882
559 Ga0495623_0598697 3300046679 Bacteria 573
560 Ga0495658_0064355 3300046683 Bacteria 2113
561 Ga0495669_0244138 3300046684 Unclassified 862
562 Ga0495613_0041827 3300046689 Bacteria 3392
563 Ga0495613_0053407 3300046689 Bacteria 2973
564 Ga0495624_0151765 3300046690 Unclassified 1417
565 Ga0495624_0784292 3300046690 Bacteria 564
566 Ga0495600_0482848 3300046809 Unclassified 763
567 Ga0495581_0140081 3300047315 Bacteria 1411
568 Ga0495581_0315294 3300047315 Unclassified 914
569 Ga0495604_0510088 3300047317 Unclassified 779
570 Ga0495604_0709181 3300047317 Unclassified 638
571 Ga0495636_0231289 3300047318 Unclassified 851
572 Ga0495674_0062623 3300047319 Bacteria 3238
573 Ga0495674_0381587 3300047319 Bacteria 1140
574 Ga0495674_0558358 3300047319 Bacteria 911
575 Ga0495674_0920529 3300047319 Bacteria 674
576 Ga0495674_0942921 3300047319 Unclassified 664
577 Ga0495676_0211708 3300047321 Bacteria 1341
578 Ga0495675_0061064 3300047444 Bacteria 2388
579 Ga0495675_0143762 3300047444 Bacteria 1477
580 Ga0495675_0243587 3300047444 Bacteria 1081
581 Ga0495684_0000857 3300047471 Bacteria 24644
582 Ga0495684_0009288 3300047471 Bacteria 7590
583 Ga0495684_0177030 3300047471 Unclassified 1583
584 Ga0495684_0236328 3300047471 Bacteria 1335
585 Ga0495684_0249997 3300047471 Bacteria 1290
586 Ga0495684_0289653 3300047471 Bacteria 1179
587 Ga0495684_0324300 3300047471 Bacteria 1100
588 Ga0495684_0444994 3300047471 Bacteria 901
589 Ga0495684_0834094 3300047471 Bacteria 599
590 Ga0495602_0003952 3300048088 Bacteria 15448
591 Ga0495602_0847665 3300048088 Bacteria 611
592 Ga0495614_0223078 3300048089 Unclassified 857
593 Ga0495614_0509720 3300048089 Unclassified 573
594 Ga0496102_0160230 3300048905 Unclassified 2116
595 Ga0496102_1473763 3300048905 Bacteria 599
596 Ga0496103_0392695 3300048906 Bacteria 891
597 Ga0496104_0157601 3300048907 Bacteria 2179
598 Ga0496104_0880925 3300048907 Bacteria 800
599 Ga0496104_0929121 3300048907 Unclassified 775
600 Ga0496106_0103693 3300048909 Bacteria 2208
601 Ga0496112_0512913 3300048915 Bacteria 1134
602 Ga0496112_0573915 3300048915 Bacteria 1061
603 Ga0496112_1224840 3300048915 Unclassified 667
604 Ga0496113_1356065 3300048916 Bacteria 552
605 Ga0496114_0914126 3300048917 Bacteria 759
606 Ga0496115_0183146 3300048918 Bacteria 1731
607 Ga0496115_1383338 3300048918 Bacteria 520
608 Ga0496115_1422423 3300048918 Bacteria 511
609 Ga0501031_0408717 3300049568 Unclassified 878
610 Ga0501036_0249162 3300049572 Unclassified 1489
611 nmdc:mga05p37_1126961_c1 3300050507 Unclassified 819
612 nmdc:mga05p37_375291_c1 3300050507 Bacteria 1668
613 nmdc:mga0qj67_1176000_c1 3300050509 Bacteria 597
614 nmdc:mga0qj67_303938_c1 3300050509 Bacteria 1292
615 nmdc:mga0qj67_802001_c1 3300050509 Unclassified 745
616 nmdc:mga06r32_294649_c1 3300050510 Bacteria 1609
617 nmdc:mga06r32_31724_c1 3300050510 Bacteria 4965
618 nmdc:mga08y16_609627_c1 3300050511 Unclassified 1100
619 nmdc:mga08y16_64957_c1 3300050511 Unclassified 3810
620 nmdc:mga0n895_1730480_c1 3300050512 Unclassified 587
621 nmdc:mga0n895_27483_c1 3300050512 Bacteria 5405
622 nmdc:mga0n895_473171_c1 3300050512 Unclassified 1264
623 nmdc:mga0n895_655469_c1 3300050512 Bacteria 1048
624 nmdc:mga0rr50_1193914_c1 3300050513 Unclassified 646
625 nmdc:mga0rr50_1205434_c1 3300050513 Unclassified 643
626 nmdc:mga0rr50_26365_c1 3300050513 Bacteria 4053
627 nmdc:mga0rr50_570046_c1 3300050513 Bacteria 964
628 nmdc:mga0rr50_981600_c1 3300050513 Unclassified 720
629 nmdc:mga08x19_1130200_c1 3300050514 Unclassified 556
630 nmdc:mga08x19_1265_c1 3300050514 Bacteria 15691
631 nmdc:mga08x19_477533_c1 3300050514 Bacteria 879
632 nmdc:mga08x19_853700_c1 3300050514 Bacteria 647
633 nmdc:mga0a205_1089370_c1 3300050515 Unclassified 646
634 nmdc:mga0a205_14400_c1 3300050515 Bacteria 7376
635 nmdc:mga0a205_1473953_c1 3300050515 Bacteria 528
636 nmdc:mga0a205_152273_c1 3300050515 Bacteria 2212
637 Ga0495601_0679260 3300053077 Bacteria 658
638 Ga0495619_0833629 3300053085 Bacteria 623
639 Ga0495619_1100382 3300053085 Bacteria 529
640 Ga0501082_0000185 3300060353 Bacteria 54029

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0408717 Ga0501031_0408717_26_283 70
2 3300005536 Ga0070697_101548883 Ga0070697_1015488831 77
3 3300014326 Ga0157380_11580121 Ga0157380_115801211 77
4 3300036401 Ga0373937_0039742 Ga0373937_0039742_702_1058 77
5 3300046809 Ga0495600_0482848 Ga0495600_0482848_328_678 77
6 3300047471 Ga0495684_0324300 Ga0495684_0324300_619_969 77
7 3300010375 Ga0105239_10841302 Ga0105239_108413022 79
8 3300013100 Ga0157373_10173814 Ga0157373_101738142 79
9 3300013104 Ga0157370_11808592 Ga0157370_118085921 79
10 3300013297 Ga0157378_10251024 Ga0157378_102510242 79
11 3300015265 Ga0182005_1078488 Ga0182005_10784882 79
12 3300025921 Ga0207652_10055739 Ga0207652_100557392 79
13 3300048905 Ga0496102_0160230 Ga0496102_0160230_884_1165 79
14 3300048906 Ga0496103_0392695 Ga0496103_0392695_133_414 79
15 3300050512 nmdc:mga0n895_473171_c1 nmdc:mga0n895_473171_c1_13_294 79
16 3300009093 Ga0105240_10386958 Ga0105240_103869582 80
17 3300009177 Ga0105248_10310602 Ga0105248_103106022 80
18 3300010375 Ga0105239_10097404 Ga0105239_100974042 80
19 3300013297 Ga0157378_10448393 Ga0157378_104483932 80
20 3300013307 Ga0157372_10117600 Ga0157372_101176002 80
21 3300015262 Ga0182007_10031782 Ga0182007_100317822 80
22 3300005434 Ga0070709_10629475 Ga0070709_106294751 81
23 3300005439 Ga0070711_100300218 Ga0070711_1003002182 81
24 3300005440 Ga0070705_101591311 Ga0070705_1015913111 81
25 3300005444 Ga0070694_100163357 Ga0070694_1001633572 81
26 3300005467 Ga0070706_100143688 Ga0070706_1001436883 81
27 3300005545 Ga0070695_100130341 Ga0070695_1001303411 81
28 3300005546 Ga0070696_100815951 Ga0070696_1008159511 81
29 3300006173 Ga0070716_100061144 Ga0070716_1000611445 81
30 3300006914 Ga0075436_100007299 Ga0075436_1000072998 81
31 3300025885 Ga0207653_10035301 Ga0207653_100353011 81
32 3300025939 Ga0207665_10198725 Ga0207665_101987253 81
33 3300050514 nmdc:mga08x19_1265_c1 nmdc:mga08x19_1265_c1_12555_12857 81
34 3300005530 Ga0070679_100345026 Ga0070679_1003450263 82
35 3300005545 Ga0070695_100876731 Ga0070695_1008767311 82
36 3300009545 Ga0105237_10132511 Ga0105237_101325115 82
37 3300009545 Ga0105237_10951362 Ga0105237_109513622 82
38 3300025906 Ga0207699_10624860 Ga0207699_106248601 82
39 3300025912 Ga0207707_10126950 Ga0207707_101269501 82
40 3300025914 Ga0207671_10500216 Ga0207671_105002162 82
41 3300009093 Ga0105240_10331368 Ga0105240_103313682 84
42 3300009545 Ga0105237_10117442 Ga0105237_101174422 84
43 3300009545 Ga0105237_11369767 Ga0105237_113697671 84
44 3300013307 Ga0157372_12544587 Ga0157372_125445871 84
45 3300034819 Ga0373958_0037523 Ga0373958_0037523_143_439 84
46 3300035121 Ga0373960_0006687 Ga0373960_0006687_2057_2353 84
47 3300048915 Ga0496112_1224840 Ga0496112_1224840_226_522 84
48 3300050514 nmdc:mga08x19_477533_c1 nmdc:mga08x19_477533_c1_234_530 84
49 3300009177 Ga0105248_10648191 Ga0105248_106481911 85
50 3300013296 Ga0157374_11191013 Ga0157374_111910132 85
51 3300013308 Ga0157375_12087978 Ga0157375_120879782 85
52 3300006173 Ga0070716_100360833 Ga0070716_1003608332 86
53 3300013297 Ga0157378_10671680 Ga0157378_106716802 86
54 3300025939 Ga0207665_11068647 Ga0207665_110686471 86
55 3300050510 nmdc:mga06r32_294649_c1 nmdc:mga06r32_294649_c1_1135_1440 86
56 3300005329 Ga0070683_100152242 Ga0070683_1001522425 87
57 3300009174 Ga0105241_10398447 Ga0105241_103984471 87
58 3300009545 Ga0105237_10463569 Ga0105237_104635692 87
59 3300013105 Ga0157369_10708371 Ga0157369_107083712 87
60 3300013297 Ga0157378_11900389 Ga0157378_119003891 87
61 3300013307 Ga0157372_10023879 Ga0157372_100238793 87
62 3300014969 Ga0157376_10102075 Ga0157376_101020753 87
63 3300025944 Ga0207661_10118455 Ga0207661_101184551 87
64 3300035111 Ga0373923_0194919 Ga0373923_0194919_611_919 87
65 3300046459 Ga0495629_0050397 Ga0495629_0050397_1146_1499 87
66 3300046472 Ga0495580_0012519 Ga0495580_0012519_5511_5819 87
67 3300046476 Ga0495662_0206582 Ga0495662_0206582_10_363 87
68 3300046499 Ga0495594_0191331 Ga0495594_0191331_179_487 87
69 3300046514 Ga0495618_0439576 Ga0495618_0439576_288_641 87
70 3300046531 Ga0495665_0044581 Ga0495665_0044581_1476_1784 87
71 3300046535 Ga0495586_0058912 Ga0495586_0058912_1681_2034 87
72 3300046536 Ga0495587_0266164 Ga0495587_0266164_217_525 87
73 3300046543 Ga0495645_0941853 Ga0495645_0941853_167_475 87
74 3300046642 Ga0495634_0072118 Ga0495634_0072118_1663_2016 87
75 3300046663 Ga0495635_0811691 Ga0495635_0811691_119_427 87
76 3300046678 Ga0495599_0056864 Ga0495599_0056864_143_451 87
77 3300046689 Ga0495613_0041827 Ga0495613_0041827_121_474 87
78 3300047319 Ga0495674_0558358 Ga0495674_0558358_34_387 87
79 3300047444 Ga0495675_0061064 Ga0495675_0061064_1008_1316 87
80 3300047471 Ga0495684_0000857 Ga0495684_0000857_21664_21972 87
81 3300047471 Ga0495684_0834094 Ga0495684_0834094_120_473 87
82 3300048088 Ga0495602_0003952 Ga0495602_0003952_8857_9165 87
83 3300048918 Ga0496115_1383338 Ga0496115_1383338_141_449 87
84 3300004800 Ga0058861_11369154 Ga0058861_113691541 88
85 3300005328 Ga0070676_10249076 Ga0070676_102490762 88
86 3300005328 Ga0070676_10970500 Ga0070676_109705002 88
87 3300005329 Ga0070683_100523661 Ga0070683_1005236611 88
88 3300005331 Ga0070670_100785838 Ga0070670_1007858382 88
89 3300005334 Ga0068869_100024557 Ga0068869_1000245573 88
90 3300005335 Ga0070666_10181977 Ga0070666_101819772 88
91 3300005336 Ga0070680_100910927 Ga0070680_1009109271 88
92 3300005337 Ga0070682_100048850 Ga0070682_1000488502 88
93 3300005337 Ga0070682_100218569 Ga0070682_1002185692 88
94 3300005339 Ga0070660_100070274 Ga0070660_1000702744 88
95 3300005339 Ga0070660_100523189 Ga0070660_1005231892 88
96 3300005344 Ga0070661_100358962 Ga0070661_1003589621 88
97 3300005353 Ga0070669_100880602 Ga0070669_1008806022 88
98 3300005355 Ga0070671_100197440 Ga0070671_1001974402 88
99 3300005355 Ga0070671_101395222 Ga0070671_1013952221 88
100 3300005356 Ga0070674_100425022 Ga0070674_1004250221 88
101 3300005356 Ga0070674_102049180 Ga0070674_1020491801 88
102 3300005365 Ga0070688_100924617 Ga0070688_1009246171 88
103 3300005366 Ga0070659_100472612 Ga0070659_1004726121 88
104 3300005367 Ga0070667_100766083 Ga0070667_1007660832 88
105 3300005367 Ga0070667_100781135 Ga0070667_1007811351 88
106 3300005434 Ga0070709_10346212 Ga0070709_103462121 88
107 3300005434 Ga0070709_10519274 Ga0070709_105192742 88
108 3300005436 Ga0070713_100375697 Ga0070713_1003756972 88
109 3300005439 Ga0070711_100217934 Ga0070711_1002179342 88
110 3300005439 Ga0070711_101255223 Ga0070711_1012552231 88
111 3300005455 Ga0070663_100495742 Ga0070663_1004957422 88
112 3300005456 Ga0070678_100496150 Ga0070678_1004961502 88
113 3300005457 Ga0070662_100448347 Ga0070662_1004483471 88
114 3300005458 Ga0070681_10069406 Ga0070681_100694063 88
115 3300005459 Ga0068867_100313800 Ga0068867_1003138001 88
116 3300005467 Ga0070706_101855384 Ga0070706_1018553841 88
117 3300005518 Ga0070699_101657660 Ga0070699_1016576602 88
118 3300005518 Ga0070699_102174711 Ga0070699_1021747111 88
119 3300005530 Ga0070679_100448790 Ga0070679_1004487902 88
120 3300005536 Ga0070697_100642755 Ga0070697_1006427552 88
121 3300005539 Ga0068853_100290319 Ga0068853_1002903192 88
122 3300005544 Ga0070686_100375457 Ga0070686_1003754571 88
123 3300005545 Ga0070695_100254619 Ga0070695_1002546191 88
124 3300005546 Ga0070696_100042694 Ga0070696_1000426944 88
125 3300005547 Ga0070693_101516976 Ga0070693_1015169761 88
126 3300005563 Ga0068855_100567796 Ga0068855_1005677961 88
127 3300005564 Ga0070664_100047880 Ga0070664_1000478803 88
128 3300005564 Ga0070664_100197124 Ga0070664_1001971241 88
129 3300005578 Ga0068854_100364238 Ga0068854_1003642382 88
130 3300005614 Ga0068856_101270801 Ga0068856_1012708012 88
131 3300005618 Ga0068864_102273142 Ga0068864_1022731422 88
132 3300005834 Ga0068851_10044782 Ga0068851_100447822 88
133 3300005842 Ga0068858_100398171 Ga0068858_1003981711 88
134 3300005843 Ga0068860_100683613 Ga0068860_1006836132 88
135 3300006173 Ga0070716_100131299 Ga0070716_1001312992 88
136 3300006175 Ga0070712_100509330 Ga0070712_1005093302 88
137 3300006237 Ga0097621_100459589 Ga0097621_1004595891 88
138 3300006358 Ga0068871_100375722 Ga0068871_1003757222 88
139 3300006358 Ga0068871_100504253 Ga0068871_1005042533 88
140 3300006846 Ga0075430_100598846 Ga0075430_1005988462 88
141 3300006852 Ga0075433_10378414 Ga0075433_103784142 88
142 3300006881 Ga0068865_101037662 Ga0068865_1010376622 88
143 3300006914 Ga0075436_100139154 Ga0075436_1001391542 88
144 3300009093 Ga0105240_10360485 Ga0105240_103604852 88
145 3300009148 Ga0105243_11076075 Ga0105243_110760752 88
146 3300009174 Ga0105241_10363286 Ga0105241_103632861 88
147 3300009174 Ga0105241_11466631 Ga0105241_114666311 88
148 3300009176 Ga0105242_10051435 Ga0105242_100514352 88
149 3300009176 Ga0105242_10397304 Ga0105242_103973041 88
150 3300009177 Ga0105248_10492305 Ga0105248_104923051 88
151 3300009545 Ga0105237_10125841 Ga0105237_101258412 88
152 3300009551 Ga0105238_10131891 Ga0105238_101318912 88
153 3300009551 Ga0105238_10652211 Ga0105238_106522111 88
154 3300013100 Ga0157373_10491594 Ga0157373_104915942 88
155 3300013296 Ga0157374_10033336 Ga0157374_100333364 88
156 3300013296 Ga0157374_10985213 Ga0157374_109852131 88
157 3300013307 Ga0157372_10308763 Ga0157372_103087632 88
158 3300014325 Ga0163163_10055760 Ga0163163_100557606 88
159 3300014497 Ga0182008_10093691 Ga0182008_100936912 88
160 3300014968 Ga0157379_10021300 Ga0157379_100213005 88
161 3300014969 Ga0157376_11203344 Ga0157376_112033442 88
162 3300014969 Ga0157376_12332023 Ga0157376_123320231 88
163 3300025899 Ga0207642_10191118 Ga0207642_101911182 88
164 3300025906 Ga0207699_10288338 Ga0207699_102883382 88
165 3300025906 Ga0207699_10405806 Ga0207699_104058062 88
166 3300025907 Ga0207645_10813367 Ga0207645_108133672 88
167 3300025911 Ga0207654_10807812 Ga0207654_108078122 88
168 3300025912 Ga0207707_10214012 Ga0207707_102140121 88
169 3300025912 Ga0207707_11352295 Ga0207707_113522951 88
170 3300025914 Ga0207671_10018759 Ga0207671_100187593 88
171 3300025917 Ga0207660_10256378 Ga0207660_102563782 88
172 3300025919 Ga0207657_11029851 Ga0207657_110298511 88
173 3300025923 Ga0207681_11473599 Ga0207681_114735991 88
174 3300025924 Ga0207694_10530644 Ga0207694_105306441 88
175 3300025927 Ga0207687_10349851 Ga0207687_103498512 88
176 3300025928 Ga0207700_10321145 Ga0207700_103211452 88
177 3300025933 Ga0207706_10228815 Ga0207706_102288152 88
178 3300025934 Ga0207686_10503467 Ga0207686_105034671 88
179 3300025935 Ga0207709_11368914 Ga0207709_113689142 88
180 3300025937 Ga0207669_11486039 Ga0207669_114860392 88
181 3300025938 Ga0207704_10360957 Ga0207704_103609572 88
182 3300025939 Ga0207665_10049699 Ga0207665_100496992 88
183 3300025942 Ga0207689_10103446 Ga0207689_101034461 88
184 3300025944 Ga0207661_11969682 Ga0207661_119696821 88
185 3300025945 Ga0207679_10849910 Ga0207679_108499102 88
186 3300025945 Ga0207679_11762553 Ga0207679_117625532 88
187 3300025981 Ga0207640_11255864 Ga0207640_112558642 88
188 3300025986 Ga0207658_10202783 Ga0207658_102027831 88
189 3300026035 Ga0207703_11901474 Ga0207703_119014741 88
190 3300026067 Ga0207678_11132791 Ga0207678_111327911 88
191 3300026088 Ga0207641_11737870 Ga0207641_117378702 88
192 3300026089 Ga0207648_10455558 Ga0207648_104555581 88
193 3300026095 Ga0207676_12251298 Ga0207676_122512981 88
194 3300026118 Ga0207675_102401274 Ga0207675_1024012741 88
195 3300026121 Ga0207683_10357494 Ga0207683_103574942 88
196 3300028379 Ga0268266_10091695 Ga0268266_100916953 88
197 3300028381 Ga0268264_10499046 Ga0268264_104990462 88
198 3300034820 Ga0373959_0071115 Ga0373959_0071115_115_423 88
199 3300035085 Ga0373929_0066746 Ga0373929_0066746_72_380 88
200 3300035091 Ga0373951_0183454 Ga0373951_0183454_263_571 88
201 3300035112 Ga0373932_0020990 Ga0373932_0020990_1390_1698 88
202 3300035691 Ga0373931_0192462 Ga0373931_0192462_626_934 88
203 3300042005 Ga0439448_0164916 Ga0439448_0164916_42_350 88
204 3300046684 Ga0495669_0244138 Ga0495669_0244138_114_422 88
205 3300048907 Ga0496104_0880925 Ga0496104_0880925_396_704 88
206 3300048909 Ga0496106_0103693 Ga0496106_0103693_893_1201 88
207 3300049572 Ga0501036_0249162 Ga0501036_0249162_1043_1354 88
208 3300050515 nmdc:mga0a205_1473953_c1 nmdc:mga0a205_1473953_c1_160_474 88
209 3300053077 Ga0495601_0679260 Ga0495601_0679260_10_285 88
210 3300009148 Ga0105243_12189425 Ga0105243_121894251 89
211 3300025935 Ga0207709_11352463 Ga0207709_113524631 89
212 3300005340 Ga0070689_101394893 Ga0070689_1013948932 90
213 3300005543 Ga0070672_100325829 Ga0070672_1003258292 90
214 3300006846 Ga0075430_100953351 Ga0075430_1009533512 90
215 3300006847 Ga0075431_100098163 Ga0075431_1000981633 90
216 3300006880 Ga0075429_101320717 Ga0075429_1013207172 90
217 3300009176 Ga0105242_10973021 Ga0105242_109730213 90
218 3300009177 Ga0105248_10897660 Ga0105248_108976602 90
219 3300011119 Ga0105246_11690807 Ga0105246_116908071 90
220 3300014745 Ga0157377_11105782 Ga0157377_111057821 90
221 3300017792 Ga0163161_11028778 Ga0163161_110287782 90
222 3300025936 Ga0207670_10952303 Ga0207670_109523031 90
223 3300025941 Ga0207711_11736096 Ga0207711_117360961 90
224 3300026089 Ga0207648_11254702 Ga0207648_112547022 90
225 3300035089 Ga0373944_0319819 Ga0373944_0319819_256_561 90
226 3300035691 Ga0373931_0373679 Ga0373931_0373679_387_692 90
227 3300048907 Ga0496104_0157601 Ga0496104_0157601_1136_1441 90
228 3300050509 nmdc:mga0qj67_1176000_c1 nmdc:mga0qj67_1176000_c1_244_561 90
229 3300050515 nmdc:mga0a205_1089370_c1 nmdc:mga0a205_1089370_c1_364_636 90
230 3300013104 Ga0157370_11270668 Ga0157370_112706682 91
231 3300048905 Ga0496102_1473763 Ga0496102_1473763_222_530 91
232 3300005331 Ga0070670_101075007 Ga0070670_1010750072 92
233 3300005364 Ga0070673_100006804 Ga0070673_1000068046 92
234 3300005445 Ga0070708_101944575 Ga0070708_1019445751 92
235 3300005840 Ga0068870_10504701 Ga0068870_105047012 92
236 3300006237 Ga0097621_100637099 Ga0097621_1006370991 92
237 3300009094 Ga0111539_11363620 Ga0111539_113636202 92
238 3300009553 Ga0105249_10335901 Ga0105249_103359012 92
239 3300013297 Ga0157378_11229185 Ga0157378_112291851 92
240 3300013306 Ga0163162_10464635 Ga0163162_104646351 92
241 3300014326 Ga0157380_10152191 Ga0157380_101521914 92
242 3300025960 Ga0207651_10714991 Ga0207651_107149912 92
243 3300009174 Ga0105241_11623083 Ga0105241_116230831 93
244 3300013296 Ga0157374_11686371 Ga0157374_116863712 93
245 3300013297 Ga0157378_10853180 Ga0157378_108531802 93
246 3300014325 Ga0163163_10914610 Ga0163163_109146102 93
247 3300046477 Ga0495664_0330367 Ga0495664_0330367_425_721 93
248 3300046516 Ga0495628_0220674 Ga0495628_0220674_573_869 93
249 3300046543 Ga0495645_0033872 Ga0495645_0033872_3280_3576 93
250 3300050514 nmdc:mga08x19_853700_c1 nmdc:mga08x19_853700_c1_244_531 93
251 3300005329 Ga0070683_101623725 Ga0070683_1016237251 94
252 3300009176 Ga0105242_11404235 Ga0105242_114042351 94
253 3300009177 Ga0105248_10708219 Ga0105248_107082191 94
254 3300013105 Ga0157369_11486042 Ga0157369_114860421 94
255 3300013297 Ga0157378_10338716 Ga0157378_103387161 94
256 3300013308 Ga0157375_12820810 Ga0157375_128208102 94
257 3300014325 Ga0163163_10423745 Ga0163163_104237453 94
258 3300014969 Ga0157376_11695616 Ga0157376_116956161 94
259 3300046663 Ga0495635_0359444 Ga0495635_0359444_625_939 94
260 3300048907 Ga0496104_0929121 Ga0496104_0929121_474_764 94
261 3300048915 Ga0496112_0573915 Ga0496112_0573915_544_837 94
262 3300053085 Ga0495619_1100382 Ga0495619_1100382_223_513 94
263 3300021377 Ga0213874_10379101 Ga0213874_103791011 95
264 3300039450 Ga0436363_1666979 Ga0436363_1666979_471_779 95
265 3300005618 Ga0068864_101014084 Ga0068864_1010140841 96
266 3300025960 Ga0207651_11483675 Ga0207651_114836751 96
267 3300045051 Ga0451576_2113054 Ga0451576_2113054_174_473 96
268 3300007076 Ga0075435_100304546 Ga0075435_1003045461 97
269 3300009177 Ga0105248_11144345 Ga0105248_111443452 97
270 3300013104 Ga0157370_11426463 Ga0157370_114264631 97
271 3300014969 Ga0157376_11089933 Ga0157376_110899332 97
272 3300035695 Ga0373927_0889707 Ga0373927_0889707_117_425 97
273 3300045051 Ga0451576_0814453 Ga0451576_0814453_486_785 97
274 3300045051 Ga0451576_1172002 Ga0451576_1172002_265_573 97
275 3300046472 Ga0495580_0080149 Ga0495580_0080149_717_1025 97
276 3300046476 Ga0495662_0589492 Ga0495662_0589492_121_429 97
277 3300046531 Ga0495665_0574180 Ga0495665_0574180_152_460 97
278 3300046689 Ga0495613_0053407 Ga0495613_0053407_121_474 97
279 3300047315 Ga0495581_0315294 Ga0495581_0315294_329_637 97
280 3300048089 Ga0495614_0509720 Ga0495614_0509720_209_562 97
281 3300050513 nmdc:mga0rr50_981600_c1 nmdc:mga0rr50_981600_c1_352_660 97
282 3300005329 Ga0070683_100068864 Ga0070683_1000688642 98
283 3300005336 Ga0070680_101361144 Ga0070680_1013611441 98
284 3300005436 Ga0070713_100535431 Ga0070713_1005354311 98
285 3300005467 Ga0070706_100431317 Ga0070706_1004313172 98
286 3300005530 Ga0070679_100359986 Ga0070679_1003599861 98
287 3300005535 Ga0070684_100044513 Ga0070684_1000445133 98
288 3300005539 Ga0068853_101530231 Ga0068853_1015302311 98
289 3300005539 Ga0068853_101979889 Ga0068853_1019798891 98
290 3300006028 Ga0070717_11460640 Ga0070717_114606402 98
291 3300006173 Ga0070716_100561081 Ga0070716_1005610812 98
292 3300006358 Ga0068871_101074000 Ga0068871_1010740002 98
293 3300007076 Ga0075435_101336512 Ga0075435_1013365122 98
294 3300009093 Ga0105240_10001086 Ga0105240_1000108617 98
295 3300009545 Ga0105237_10453793 Ga0105237_104537932 98
296 3300009551 Ga0105238_10393564 Ga0105238_103935643 98
297 3300013100 Ga0157373_10441017 Ga0157373_104410172 98
298 3300013105 Ga0157369_10161448 Ga0157369_101614483 98
299 3300020078 Ga0206352_10258107 Ga0206352_102581072 98
300 3300020081 Ga0206354_10048515 Ga0206354_100485151 98
301 3300025910 Ga0207684_10709551 Ga0207684_107095511 98
302 3300025913 Ga0207695_10005447 Ga0207695_100054477 98
303 3300025921 Ga0207652_10305994 Ga0207652_103059941 98
304 3300025924 Ga0207694_10265192 Ga0207694_102651922 98
305 3300025944 Ga0207661_10039258 Ga0207661_100392587 98
306 3300026116 Ga0207674_11064209 Ga0207674_110642091 98
307 3300035083 Ga0373926_0015059 Ga0373926_0015059_513_830 98
308 3300035116 Ga0373945_0099518 Ga0373945_0099518_350_667 98
309 3300035170 Ga0373943_0018141 Ga0373943_0018141_2500_2817 98
310 3300035171 Ga0373946_0089599 Ga0373946_0089599_488_805 98
311 3300035692 Ga0373935_0390871 Ga0373935_0390871_159_476 98
312 3300035692 Ga0373935_0541016 Ga0373935_0541016_497_808 98
313 3300035695 Ga0373927_0006221 Ga0373927_0006221_4691_5008 98
314 3300035695 Ga0373927_0724340 Ga0373927_0724340_269_583 98
315 3300035725 Ga0373947_0937818 Ga0373947_0937818_19_333 98
316 3300037068 Ga0373925_0000062 Ga0373925_0000062_108575_108892 98
317 3300045051 Ga0451576_0381180 Ga0451576_0381180_858_1169 98
318 3300045051 Ga0451576_0430924 Ga0451576_0430924_594_905 98
319 3300046472 Ga0495580_0065269 Ga0495580_0065269_2185_2499 98
320 3300046472 Ga0495580_0259864 Ga0495580_0259864_703_1014 98
321 3300046477 Ga0495664_0149855 Ga0495664_0149855_417_728 98
322 3300046514 Ga0495618_0916259 Ga0495618_0916259_36_347 98
323 3300046516 Ga0495628_0216984 Ga0495628_0216984_861_1166 98
324 3300046523 Ga0495644_0248175 Ga0495644_0248175_106_417 98
325 3300046529 Ga0495652_0842736 Ga0495652_0842736_42_347 98
326 3300046531 Ga0495665_0061982 Ga0495665_0061982_1565_1882 98
327 3300046533 Ga0495640_0544429 Ga0495640_0544429_163_468 98
328 3300046543 Ga0495645_0165310 Ga0495645_0165310_829_1140 98
329 3300046559 Ga0495667_0973818 Ga0495667_0973818_163_468 98
330 3300046679 Ga0495623_0598697 Ga0495623_0598697_184_489 98
331 3300046690 Ga0495624_0151765 Ga0495624_0151765_590_907 98
332 3300046690 Ga0495624_0784292 Ga0495624_0784292_104_415 98
333 3300047317 Ga0495604_0709181 Ga0495604_0709181_175_480 98
334 3300047318 Ga0495636_0231289 Ga0495636_0231289_211_522 98
335 3300047319 Ga0495674_0062623 Ga0495674_0062623_1395_1706 98
336 3300047319 Ga0495674_0942921 Ga0495674_0942921_299_604 98
337 3300047471 Ga0495684_0177030 Ga0495684_0177030_558_863 98
338 3300047471 Ga0495684_0236328 Ga0495684_0236328_182_493 98
339 3300047471 Ga0495684_0249997 Ga0495684_0249997_481_792 98
340 3300048089 Ga0495614_0223078 Ga0495614_0223078_149_460 98
341 3300005340 Ga0070689_100492711 Ga0070689_1004927112 99
342 3300005353 Ga0070669_101931092 Ga0070669_1019310921 99
343 3300005354 Ga0070675_101437403 Ga0070675_1014374032 99
344 3300005355 Ga0070671_100664647 Ga0070671_1006646471 99
345 3300005548 Ga0070665_100027769 Ga0070665_1000277695 99
346 3300005548 Ga0070665_100860193 Ga0070665_1008601931 99
347 3300005548 Ga0070665_101138278 Ga0070665_1011382782 99
348 3300005564 Ga0070664_101377021 Ga0070664_1013770212 99
349 3300005615 Ga0070702_101541208 Ga0070702_1015412081 99
350 3300005618 Ga0068864_100687298 Ga0068864_1006872982 99
351 3300005840 Ga0068870_10417689 Ga0068870_104176892 99
352 3300006237 Ga0097621_100668127 Ga0097621_1006681271 99
353 3300006358 Ga0068871_100687296 Ga0068871_1006872961 99
354 3300009177 Ga0105248_10197007 Ga0105248_101970074 99
355 3300013306 Ga0163162_11037518 Ga0163162_110375181 99
356 3300013308 Ga0157375_10149587 Ga0157375_101495871 99
357 3300013308 Ga0157375_10498997 Ga0157375_104989972 99
358 3300014325 Ga0163163_10151255 Ga0163163_101512555 99
359 3300014969 Ga0157376_10439747 Ga0157376_104397473 99
360 3300019179 Ga0184593_119779 Ga0184593_1197792 99
361 3300025923 Ga0207681_11567699 Ga0207681_115676992 99
362 3300025925 Ga0207650_11360677 Ga0207650_113606772 99
363 3300025936 Ga0207670_10541170 Ga0207670_105411702 99
364 3300025942 Ga0207689_10633341 Ga0207689_106333411 99
365 3300026095 Ga0207676_10751789 Ga0207676_107517892 99
366 3300030760 Ga0265762_1003341 Ga0265762_10033415 99
367 3300030879 Ga0265765_1001004 Ga0265765_10010042 99
368 3300031010 Ga0265771_1019559 Ga0265771_10195591 99
369 3300033547 Ga0316212_1052520 Ga0316212_10525202 99
370 3300035692 Ga0373935_0342332 Ga0373935_0342332_662_970 99
371 3300006175 Ga0070712_101611791 Ga0070712_1016117911 100
372 3300006852 Ga0075433_10214882 Ga0075433_102148822 100
373 3300006871 Ga0075434_100029427 Ga0075434_1000294278 100
374 3300007076 Ga0075435_101105522 Ga0075435_1011055221 100
375 3300009147 Ga0114129_10718704 Ga0114129_107187042 100
376 3300009147 Ga0114129_11302412 Ga0114129_113024122 100
377 3300009553 Ga0105249_11080558 Ga0105249_110805582 100
378 3300010375 Ga0105239_10606956 Ga0105239_106069562 100
379 3300013307 Ga0157372_11588848 Ga0157372_115888481 100
380 3300019182 Ga0184598_142313 Ga0184598_1423131 100
381 3300019183 Ga0184601_123318 Ga0184601_1233181 100
382 3300022730 Ga0224570_103130 Ga0224570_1031302 100
383 3300024225 Ga0224572_1014433 Ga0224572_10144332 100
384 3300024227 Ga0228598_1001630 Ga0228598_10016306 100
385 3300028017 Ga0265356_1007140 Ga0265356_10071402 100
386 3300028800 Ga0265338_10075035 Ga0265338_100750355 100
387 3300030878 Ga0265770_1143361 Ga0265770_11433611 100
388 3300031090 Ga0265760_10002361 Ga0265760_100023615 100
389 3300031090 Ga0265760_10383501 Ga0265760_103835011 100
390 3300035118 Ga0373954_0464084 Ga0373954_0464084_141_449 100
391 3300035410 Ga0373924_0233246 Ga0373924_0233246_402_719 100
392 3300035724 Ga0373933_0805128 Ga0373933_0805128_74_382 100
393 3300036401 Ga0373937_0212836 Ga0373937_0212836_882_1190 100
394 3300036401 Ga0373937_0225840 Ga0373937_0225840_375_692 100
395 3300037068 Ga0373925_0842374 Ga0373925_0842374_409_726 100
396 3300046517 Ga0495630_1148600 Ga0495630_1148600_232_540 100
397 3300050507 nmdc:mga05p37_1126961_c1 nmdc:mga05p37_1126961_c1_68_388 100
398 3300050512 nmdc:mga0n895_27483_c1 nmdc:mga0n895_27483_c1_4838_5158 100
399 3300050513 nmdc:mga0rr50_1205434_c1 nmdc:mga0rr50_1205434_c1_173_493 100
400 3300050515 nmdc:mga0a205_152273_c1 nmdc:mga0a205_152273_c1_109_429 100
401 3300053085 Ga0495619_0833629 Ga0495619_0833629_155_472 100
402 3300060353 Ga0501082_0000185 Ga0501082_0000185_26703_27020 100
403 3300004800 Ga0058861_11845831 Ga0058861_118458311 101
404 3300004803 Ga0058862_12741009 Ga0058862_127410093 101
405 3300005329 Ga0070683_100039816 Ga0070683_1000398165 101
406 3300005338 Ga0068868_100589331 Ga0068868_1005893311 101
407 3300005434 Ga0070709_10105097 Ga0070709_101050972 101
408 3300005436 Ga0070713_101798182 Ga0070713_1017981821 101
409 3300005437 Ga0070710_10011181 Ga0070710_100111815 101
410 3300005439 Ga0070711_100000520 Ga0070711_10000052012 101
411 3300005535 Ga0070684_100074273 Ga0070684_1000742733 101
412 3300005535 Ga0070684_100678742 Ga0070684_1006787421 101
413 3300005536 Ga0070697_100907664 Ga0070697_1009076641 101
414 3300005548 Ga0070665_100735307 Ga0070665_1007353072 101
415 3300005617 Ga0068859_100672367 Ga0068859_1006723672 101
416 3300005618 Ga0068864_100367480 Ga0068864_1003674802 101
417 3300005841 Ga0068863_100087919 Ga0068863_1000879196 101
418 3300005841 Ga0068863_100635780 Ga0068863_1006357802 101
419 3300005844 Ga0068862_101996394 Ga0068862_1019963941 101
420 3300006163 Ga0070715_10005313 Ga0070715_100053135 101
421 3300006173 Ga0070716_100030778 Ga0070716_1000307785 101
422 3300006175 Ga0070712_100002059 Ga0070712_1000020596 101
423 3300006237 Ga0097621_100142660 Ga0097621_1001426601 101
424 3300006237 Ga0097621_100229646 Ga0097621_1002296462 101
425 3300006931 Ga0097620_100672420 Ga0097620_1006724202 101
426 3300009174 Ga0105241_11171848 Ga0105241_111718482 101
427 3300009176 Ga0105242_11644258 Ga0105242_116442582 101
428 3300009177 Ga0105248_10138076 Ga0105248_101380763 101
429 3300009177 Ga0105248_10989905 Ga0105248_109899051 101
430 3300009177 Ga0105248_11821069 Ga0105248_118210692 101
431 3300010375 Ga0105239_13335393 Ga0105239_133353931 101
432 3300013296 Ga0157374_10083489 Ga0157374_100834893 101
433 3300013297 Ga0157378_10995308 Ga0157378_109953082 101
434 3300013297 Ga0157378_11186195 Ga0157378_111861952 101
435 3300013306 Ga0163162_10571355 Ga0163162_105713552 101
436 3300013306 Ga0163162_10915240 Ga0163162_109152401 101
437 3300013307 Ga0157372_11586517 Ga0157372_115865171 101
438 3300013308 Ga0157375_10371864 Ga0157375_103718642 101
439 3300013308 Ga0157375_10720361 Ga0157375_107203612 101
440 3300014325 Ga0163163_10028533 Ga0163163_100285333 101
441 3300014325 Ga0163163_10062121 Ga0163163_100621214 101
442 3300014745 Ga0157377_10226594 Ga0157377_102265943 101
443 3300014968 Ga0157379_10752213 Ga0157379_107522132 101
444 3300014969 Ga0157376_10800372 Ga0157376_108003722 101
445 3300017792 Ga0163161_11029243 Ga0163161_110292431 101
446 3300025898 Ga0207692_10017532 Ga0207692_100175325 101
447 3300025905 Ga0207685_10080404 Ga0207685_100804041 101
448 3300025906 Ga0207699_10060684 Ga0207699_100606842 101
449 3300025911 Ga0207654_10937484 Ga0207654_109374841 101
450 3300025915 Ga0207693_10000152 Ga0207693_1000015213 101
451 3300025916 Ga0207663_10005842 Ga0207663_100058422 101
452 3300025921 Ga0207652_11616632 Ga0207652_116166322 101
453 3300025927 Ga0207687_11749153 Ga0207687_117491531 101
454 3300025933 Ga0207706_10985158 Ga0207706_109851581 101
455 3300025939 Ga0207665_10045369 Ga0207665_100453695 101
456 3300025939 Ga0207665_10235664 Ga0207665_102356642 101
457 3300025941 Ga0207711_10118781 Ga0207711_101187813 101
458 3300025960 Ga0207651_11251163 Ga0207651_112511632 101
459 3300026023 Ga0207677_10506658 Ga0207677_105066582 101
460 3300026035 Ga0207703_10238923 Ga0207703_102389232 101
461 3300026088 Ga0207641_10010793 Ga0207641_100107933 101
462 3300026088 Ga0207641_10555523 Ga0207641_105555232 101
463 3300026089 Ga0207648_10736276 Ga0207648_107362762 101
464 3300026095 Ga0207676_10313197 Ga0207676_103131971 101
465 3300026095 Ga0207676_10684184 Ga0207676_106841842 101
466 3300026116 Ga0207674_11092189 Ga0207674_110921892 101
467 3300028016 Ga0265354_1013991 Ga0265354_10139911 101
468 3300028380 Ga0268265_11748079 Ga0268265_117480791 101
469 3300030878 Ga0265770_1003487 Ga0265770_10034872 101
470 3300030878 Ga0265770_1111501 Ga0265770_11115011 101
471 3300030879 Ga0265765_1024717 Ga0265765_10247171 101
472 3300031010 Ga0265771_1007422 Ga0265771_10074222 101
473 3300031090 Ga0265760_10003029 Ga0265760_100030292 101
474 3300035111 Ga0373923_0134470 Ga0373923_0134470_246_560 101
475 3300035118 Ga0373954_0329331 Ga0373954_0329331_204_518 101
476 3300035691 Ga0373931_0162746 Ga0373931_0162746_473_787 101
477 3300035695 Ga0373927_0273285 Ga0373927_0273285_336_650 101
478 3300035725 Ga0373947_0239250 Ga0373947_0239250_391_705 101
479 3300036401 Ga0373937_0186600 Ga0373937_0186600_1532_1846 101
480 3300036401 Ga0373937_0540504 Ga0373937_0540504_489_800 101
481 3300037068 Ga0373925_0131424 Ga0373925_0131424_787_1101 101
482 3300039438 Ga0436360_0068673 Ga0436360_0068673_729_1037 101
483 3300046472 Ga0495580_0935509 Ga0495580_0935509_174_488 101
484 3300046473 Ga0495582_0437659 Ga0495582_0437659_219_539 101
485 3300046476 Ga0495662_0195247 Ga0495662_0195247_65_379 101
486 3300046499 Ga0495594_0416483 Ga0495594_0416483_351_665 101
487 3300046517 Ga0495630_0587556 Ga0495630_0587556_459_785 101
488 3300046517 Ga0495630_0740166 Ga0495630_0740166_16_330 101
489 3300046526 Ga0495666_0111128 Ga0495666_0111128_724_1038 101
490 3300046529 Ga0495652_0280711 Ga0495652_0280711_817_1131 101
491 3300046536 Ga0495587_0118332 Ga0495587_0118332_121_435 101
492 3300046536 Ga0495587_0825700 Ga0495587_0825700_29_340 101
493 3300046559 Ga0495667_0716036 Ga0495667_0716036_72_386 101
494 3300046642 Ga0495634_0603534 Ga0495634_0603534_126_440 101
495 3300046663 Ga0495635_0963482 Ga0495635_0963482_151_465 101
496 3300046679 Ga0495623_0303097 Ga0495623_0303097_37_351 101
497 3300047315 Ga0495581_0140081 Ga0495581_0140081_946_1260 101
498 3300047317 Ga0495604_0510088 Ga0495604_0510088_424_738 101
499 3300047319 Ga0495674_0381587 Ga0495674_0381587_634_948 101
500 3300047319 Ga0495674_0920529 Ga0495674_0920529_132_446 101
501 3300047321 Ga0495676_0211708 Ga0495676_0211708_567_881 101
502 3300047444 Ga0495675_0143762 Ga0495675_0143762_161_475 101
503 3300047471 Ga0495684_0009288 Ga0495684_0009288_3894_4208 101
504 3300048088 Ga0495602_0847665 Ga0495602_0847665_278_592 101
505 3300048915 Ga0496112_0512913 Ga0496112_0512913_519_833 101
506 3300048916 Ga0496113_1356065 Ga0496113_1356065_14_328 101
507 3300048917 Ga0496114_0914126 Ga0496114_0914126_209_523 101
508 3300048918 Ga0496115_0183146 Ga0496115_0183146_732_1046 101
509 3300048918 Ga0496115_1422423 Ga0496115_1422423_36_350 101
510 3300005330 Ga0070690_100117501 Ga0070690_1001175011 102
511 3300005335 Ga0070666_10089856 Ga0070666_100898565 102
512 3300005338 Ga0068868_100786322 Ga0068868_1007863221 102
513 3300005343 Ga0070687_101380521 Ga0070687_1013805211 102
514 3300005354 Ga0070675_101708980 Ga0070675_1017089802 102
515 3300005355 Ga0070671_100093748 Ga0070671_1000937481 102
516 3300005364 Ga0070673_100109751 Ga0070673_1001097511 102
517 3300005364 Ga0070673_100333700 Ga0070673_1003337003 102
518 3300005367 Ga0070667_100013365 Ga0070667_1000133657 102
519 3300005459 Ga0068867_101339265 Ga0068867_1013392652 102
520 3300005543 Ga0070672_100056579 Ga0070672_1000565791 102
521 3300005548 Ga0070665_101713167 Ga0070665_1017131672 102
522 3300005564 Ga0070664_100028307 Ga0070664_1000283074 102
523 3300005617 Ga0068859_100082419 Ga0068859_1000824195 102
524 3300005617 Ga0068859_100464785 Ga0068859_1004647852 102
525 3300005618 Ga0068864_100104402 Ga0068864_1001044022 102
526 3300005841 Ga0068863_100049894 Ga0068863_1000498943 102
527 3300005841 Ga0068863_100251686 Ga0068863_1002516862 102
528 3300005842 Ga0068858_100046861 Ga0068858_1000468612 102
529 3300005842 Ga0068858_100224572 Ga0068858_1002245722 102
530 3300005842 Ga0068858_102000777 Ga0068858_1020007771 102
531 3300006237 Ga0097621_100027492 Ga0097621_1000274925 102
532 3300006237 Ga0097621_100136306 Ga0097621_1001363063 102
533 3300006358 Ga0068871_100173527 Ga0068871_1001735272 102
534 3300006358 Ga0068871_100529832 Ga0068871_1005298322 102
535 3300006844 Ga0075428_100027054 Ga0075428_1000270543 102
536 3300006847 Ga0075431_100077674 Ga0075431_1000776743 102
537 3300006871 Ga0075434_100242336 Ga0075434_1002423361 102
538 3300006871 Ga0075434_100664540 Ga0075434_1006645401 102
539 3300006931 Ga0097620_100082412 Ga0097620_1000824122 102
540 3300006931 Ga0097620_100464717 Ga0097620_1004647172 102
541 3300009094 Ga0111539_10635405 Ga0111539_106354052 102
542 3300009148 Ga0105243_10846275 Ga0105243_108462752 102
543 3300009177 Ga0105248_10046855 Ga0105248_100468557 102
544 3300011119 Ga0105246_10435614 Ga0105246_104356141 102
545 3300013297 Ga0157378_12657595 Ga0157378_126575951 102
546 3300013306 Ga0163162_10013797 Ga0163162_100137978 102
547 3300013306 Ga0163162_10481455 Ga0163162_104814553 102
548 3300013308 Ga0157375_10013753 Ga0157375_100137537 102
549 3300013308 Ga0157375_13754339 Ga0157375_137543391 102
550 3300014325 Ga0163163_10096938 Ga0163163_100969382 102
551 3300014968 Ga0157379_11136771 Ga0157379_111367711 102
552 3300017792 Ga0163161_10161597 Ga0163161_101615973 102
553 3300025315 Ga0207697_10199031 Ga0207697_101990312 102
554 3300025903 Ga0207680_10038192 Ga0207680_100381921 102
555 3300025918 Ga0207662_11315465 Ga0207662_113154651 102
556 3300025925 Ga0207650_10231915 Ga0207650_102319153 102
557 3300025926 Ga0207659_10516474 Ga0207659_105164741 102
558 3300025931 Ga0207644_10248625 Ga0207644_102486251 102
559 3300025935 Ga0207709_10825044 Ga0207709_108250442 102
560 3300025936 Ga0207670_11212429 Ga0207670_112124292 102
561 3300025940 Ga0207691_10039241 Ga0207691_100392412 102
562 3300025941 Ga0207711_10490985 Ga0207711_104909852 102
563 3300025945 Ga0207679_10259964 Ga0207679_102599641 102
564 3300025960 Ga0207651_10230206 Ga0207651_102302062 102
565 3300025960 Ga0207651_10233078 Ga0207651_102330782 102
566 3300025986 Ga0207658_10084841 Ga0207658_100848411 102
567 3300026023 Ga0207677_10569022 Ga0207677_105690222 102
568 3300026035 Ga0207703_10066023 Ga0207703_100660231 102
569 3300026088 Ga0207641_10473408 Ga0207641_104734082 102
570 3300026089 Ga0207648_10225146 Ga0207648_102251462 102
571 3300026095 Ga0207676_10165367 Ga0207676_101653672 102
572 3300027907 Ga0207428_10420456 Ga0207428_104204562 102
573 3300035120 Ga0373957_0133947 Ga0373957_0133947_409_726 102
574 3300035172 Ga0373955_0516756 Ga0373955_0516756_271_585 102
575 3300046454 Ga0495592_0012532 Ga0495592_0012532_4587_4904 102
576 3300046455 Ga0495603_0538491 Ga0495603_0538491_40_351 102
577 3300046462 Ga0495651_0165039 Ga0495651_0165039_840_1157 102
578 3300046472 Ga0495580_0653061 Ga0495580_0653061_352_663 102
579 3300046473 Ga0495582_0841351 Ga0495582_0841351_21_332 102
580 3300046516 Ga0495628_0273852 Ga0495628_0273852_586_903 102
581 3300046517 Ga0495630_0608303 Ga0495630_0608303_69_380 102
582 3300046526 Ga0495666_0234317 Ga0495666_0234317_226_537 102
583 3300046642 Ga0495634_0296348 Ga0495634_0296348_310_621 102
584 3300046683 Ga0495658_0064355 Ga0495658_0064355_1648_1959 102
585 3300047471 Ga0495684_0289653 Ga0495684_0289653_176_487 102
586 3300050509 nmdc:mga0qj67_303938_c1 nmdc:mga0qj67_303938_c1_154_465 102
587 3300050510 nmdc:mga06r32_31724_c1 nmdc:mga06r32_31724_c1_255_566 102
588 3300050511 nmdc:mga08y16_609627_c1 nmdc:mga08y16_609627_c1_669_977 102
589 3300050512 nmdc:mga0n895_1730480_c1 nmdc:mga0n895_1730480_c1_45_362 102
590 3300050512 nmdc:mga0n895_655469_c1 nmdc:mga0n895_655469_c1_574_882 102
591 3300050513 nmdc:mga0rr50_1193914_c1 nmdc:mga0rr50_1193914_c1_316_624 102
592 3300004798 Ga0058859_11154281 Ga0058859_111542811 103
593 3300005353 Ga0070669_100663989 Ga0070669_1006639891 103
594 3300005459 Ga0068867_101390973 Ga0068867_1013909731 103
595 3300005545 Ga0070695_101404666 Ga0070695_1014046662 103
596 3300005615 Ga0070702_101349862 Ga0070702_1013498622 103
597 3300005843 Ga0068860_100337821 Ga0068860_1003378212 103
598 3300006237 Ga0097621_101185674 Ga0097621_1011856741 103
599 3300006237 Ga0097621_101513890 Ga0097621_1015138902 103
600 3300006846 Ga0075430_100540772 Ga0075430_1005407722 103
601 3300006852 Ga0075433_10092782 Ga0075433_100927824 103
602 3300006852 Ga0075433_11172613 Ga0075433_111726132 103
603 3300006871 Ga0075434_100037481 Ga0075434_1000374811 103
604 3300006880 Ga0075429_100964169 Ga0075429_1009641691 103
605 3300006914 Ga0075436_101369398 Ga0075436_1013693982 103
606 3300007076 Ga0075435_100039393 Ga0075435_1000393935 103
607 3300009011 Ga0105251_10282618 Ga0105251_102826182 103
608 3300009147 Ga0114129_10248011 Ga0114129_102480113 103
609 3300009176 Ga0105242_10245100 Ga0105242_102451002 103
610 3300011119 Ga0105246_11083483 Ga0105246_110834832 103
611 3300013297 Ga0157378_10041431 Ga0157378_100414314 103
612 3300014325 Ga0163163_10382025 Ga0163163_103820252 103
613 3300014969 Ga0157376_11814175 Ga0157376_118141752 103
614 3300025923 Ga0207681_10655939 Ga0207681_106559391 103
615 3300025934 Ga0207686_10236131 Ga0207686_102361312 103
616 3300025961 Ga0207712_10270553 Ga0207712_102705532 103
617 3300026023 Ga0207677_12213137 Ga0207677_122131371 103
618 3300026089 Ga0207648_11308193 Ga0207648_113081932 103
619 3300026118 Ga0207675_100254083 Ga0207675_1002540833 103
620 3300027907 Ga0207428_10074611 Ga0207428_100746111 103
621 3300028380 Ga0268265_10371960 Ga0268265_103719602 103
622 3300028381 Ga0268264_10436768 Ga0268264_104367681 103
623 3300035172 Ga0373955_0130463 Ga0373955_0130463_448_762 103
624 3300035410 Ga0373924_0085914 Ga0373924_0085914_687_1001 103
625 3300035724 Ga0373933_0843388 Ga0373933_0843388_157_471 103
626 3300036401 Ga0373937_0018615 Ga0373937_0018615_1529_1843 103
627 3300045051 Ga0451576_1570593 Ga0451576_1570593_249_560 103
628 3300046463 Ga0495653_0591807 Ga0495653_0591807_111_425 103
629 3300046511 Ga0495608_0036099 Ga0495608_0036099_2272_2586 103
630 3300046559 Ga0495667_0001451 Ga0495667_0001451_3430_3744 103
631 3300046675 Ga0495657_0000672 Ga0495657_0000672_27207_27521 103
632 3300047444 Ga0495675_0243587 Ga0495675_0243587_666_980 103
633 3300047471 Ga0495684_0444994 Ga0495684_0444994_427_741 103
634 3300050507 nmdc:mga05p37_375291_c1 nmdc:mga05p37_375291_c1_1201_1518 103
635 3300050509 nmdc:mga0qj67_802001_c1 nmdc:mga0qj67_802001_c1_217_528 103
636 3300050511 nmdc:mga08y16_64957_c1 nmdc:mga08y16_64957_c1_406_717 103
637 3300050513 nmdc:mga0rr50_26365_c1 nmdc:mga0rr50_26365_c1_1201_1518 103
638 3300050513 nmdc:mga0rr50_570046_c1 nmdc:mga0rr50_570046_c1_449_760 103
639 3300050514 nmdc:mga08x19_1130200_c1 nmdc:mga08x19_1130200_c1_224_541 103
640 3300050515 nmdc:mga0a205_14400_c1 nmdc:mga0a205_14400_c1_1949_2266 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00137

ATP-synt_C

ATP synthase subunit C

46

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tpt-assembly1.cif.gz_A the crystal structure of amyloid precursor-like protein 2 (aplp2) e2 domain 0.8259 42 102
6tmk-assembly1.cif.gz_H1 cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, composite model 0.8159 38 99
4mjn-assembly1.cif.gz_H structure of the c ring of the cf1fo atp synthases. 0.8067 37 100
6vmb-assembly1.cif.gz_Z chloroplast atp synthase (c1, cf1fo) 0.8061 38 100
6von-assembly1.cif.gz_M chloroplast atp synthase (r1, cf1fo) 0.8004 38 100
ID Description Score Start End Superfamily
5tptA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Amyloid precursor protein, E2 domain 0.8259 42 102 1.20.120.770
af_Q9XV49_1_95_1.20.5.170 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8227 37 99 1.20.5.170
af_P42166_494_672_1.10.287.3160 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8135 36 99 1.10.287.3160
af_Q4DRF1_344_623_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7844 36 98 1.20.1270.60
4q25A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.7811 42 101 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A3N0IEE0-F1-model_v4 PhoU domain-containing protein 0.9373 38 98
AF-A0A4Q8ULM4-F1-model_v4 Uncharacterized protein 0.9087 37 99 GO:0016020
AF-A0A7H0H1I7-F1-model_v4 DUF4935 domain-containing protein 0.8948 38 100
AF-A0A838QB01-F1-model_v4 Phosphate uptake regulator PhoU 0.8523 24 98 GO:0030643
GO:0045936
AF-A0A5C0UGT9-F1-model_v4 ATP synthase F(0) sector subunit c (F-type ATPase subunit c) 0.8299 38 101 GO:0008289
GO:0015078
GO:0015986
GO:0045263

Feature Viewer

pLDDT pTM Quality
83.92 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map