F471682
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 640 | 270 | 640 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_11144345|Ga0105248_111443452 |
| Length | 111 |
| Sequence | MSLNFENDQEIYFMKKVFVLMLLTASPVFAQGGAAAAGPGVNWIAVTSGFAMAIASSVCALAQGKAIAAACESLARNPGAAPAIRFALLLGLVLIESLGLYTLVIIFVKVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 170 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 181 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 182 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 184 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.88 |
| Metatranscriptomes | 3.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.34 |
| Rhizosphere | 97.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11154281 | 3300004798 | Unclassified | 556 |
| 2 | Ga0058861_11369154 | 3300004800 | Bacteria | 848 |
| 3 | Ga0058861_11845831 | 3300004800 | Unclassified | 625 |
| 4 | Ga0058862_12741009 | 3300004803 | Bacteria | 1486 |
| 5 | Ga0070676_10249076 | 3300005328 | Unclassified | 1185 |
| 6 | Ga0070676_10970500 | 3300005328 | Bacteria | 636 |
| 7 | Ga0070683_100039816 | 3300005329 | Bacteria | 4317 |
| 8 | Ga0070683_100068864 | 3300005329 | Unclassified | 3297 |
| 9 | Ga0070683_100152242 | 3300005329 | Unclassified | 2193 |
| 10 | Ga0070683_100523661 | 3300005329 | Unclassified | 1133 |
| 11 | Ga0070683_101623725 | 3300005329 | Unclassified | 622 |
| 12 | Ga0070690_100117501 | 3300005330 | Bacteria | 1781 |
| 13 | Ga0070670_100785838 | 3300005331 | Bacteria | 859 |
| 14 | Ga0070670_101075007 | 3300005331 | Unclassified | 733 |
| 15 | Ga0068869_100024557 | 3300005334 | Unclassified | 4175 |
| 16 | Ga0070666_10089856 | 3300005335 | Bacteria | 2109 |
| 17 | Ga0070666_10181977 | 3300005335 | Unclassified | 1474 |
| 18 | Ga0070680_100910927 | 3300005336 | Bacteria | 759 |
| 19 | Ga0070680_101361144 | 3300005336 | Bacteria | 614 |
| 20 | Ga0070682_100048850 | 3300005337 | Bacteria | 2636 |
| 21 | Ga0070682_100218569 | 3300005337 | Bacteria | 1355 |
| 22 | Ga0068868_100589331 | 3300005338 | Bacteria | 984 |
| 23 | Ga0068868_100786322 | 3300005338 | Unclassified | 857 |
| 24 | Ga0070660_100070274 | 3300005339 | Bacteria | 2732 |
| 25 | Ga0070660_100523189 | 3300005339 | Unclassified | 988 |
| 26 | Ga0070689_100492711 | 3300005340 | Bacteria | 1049 |
| 27 | Ga0070689_101394893 | 3300005340 | Unclassified | 633 |
| 28 | Ga0070687_101380521 | 3300005343 | Unclassified | 526 |
| 29 | Ga0070661_100358962 | 3300005344 | Unclassified | 1145 |
| 30 | Ga0070669_100663989 | 3300005353 | Unclassified | 878 |
| 31 | Ga0070669_100880602 | 3300005353 | Unclassified | 764 |
| 32 | Ga0070669_101931092 | 3300005353 | Bacteria | 516 |
| 33 | Ga0070675_101437403 | 3300005354 | Unclassified | 636 |
| 34 | Ga0070675_101708980 | 3300005354 | Unclassified | 581 |
| 35 | Ga0070671_100093748 | 3300005355 | Bacteria | 2516 |
| 36 | Ga0070671_100197440 | 3300005355 | Bacteria | 1706 |
| 37 | Ga0070671_100664647 | 3300005355 | Unclassified | 903 |
| 38 | Ga0070671_101395222 | 3300005355 | Bacteria | 619 |
| 39 | Ga0070674_100425022 | 3300005356 | Bacteria | 1091 |
| 40 | Ga0070674_102049180 | 3300005356 | Unclassified | 521 |
| 41 | Ga0070673_100006804 | 3300005364 | Bacteria | 7468 |
| 42 | Ga0070673_100109751 | 3300005364 | Bacteria | 2286 |
| 43 | Ga0070673_100333700 | 3300005364 | Unclassified | 1342 |
| 44 | Ga0070688_100924617 | 3300005365 | Bacteria | 689 |
| 45 | Ga0070659_100472612 | 3300005366 | Unclassified | 1066 |
| 46 | Ga0070667_100013365 | 3300005367 | Bacteria | 6786 |
| 47 | Ga0070667_100766083 | 3300005367 | Bacteria | 895 |
| 48 | Ga0070667_100781135 | 3300005367 | Bacteria | 886 |
| 49 | Ga0070709_10105097 | 3300005434 | Bacteria | 1888 |
| 50 | Ga0070709_10346212 | 3300005434 | Bacteria | 1097 |
| 51 | Ga0070709_10519274 | 3300005434 | Unclassified | 907 |
| 52 | Ga0070709_10629475 | 3300005434 | Unclassified | 829 |
| 53 | Ga0070713_100375697 | 3300005436 | Bacteria | 1323 |
| 54 | Ga0070713_100535431 | 3300005436 | Bacteria | 1108 |
| 55 | Ga0070713_101798182 | 3300005436 | Unclassified | 595 |
| 56 | Ga0070710_10011181 | 3300005437 | Unclassified | 4429 |
| 57 | Ga0070711_100000520 | 3300005439 | Bacteria | 19955 |
| 58 | Ga0070711_100217934 | 3300005439 | Bacteria | 1482 |
| 59 | Ga0070711_100300218 | 3300005439 | Unclassified | 1277 |
| 60 | Ga0070711_101255223 | 3300005439 | Bacteria | 642 |
| 61 | Ga0070705_101591311 | 3300005440 | Unclassified | 550 |
| 62 | Ga0070694_100163357 | 3300005444 | Bacteria | 1636 |
| 63 | Ga0070708_101944575 | 3300005445 | Bacteria | 545 |
| 64 | Ga0070663_100495742 | 3300005455 | Unclassified | 1013 |
| 65 | Ga0070678_100496150 | 3300005456 | Unclassified | 1076 |
| 66 | Ga0070662_100448347 | 3300005457 | Bacteria | 1071 |
| 67 | Ga0070681_10069406 | 3300005458 | Unclassified | 3490 |
| 68 | Ga0068867_100313800 | 3300005459 | Unclassified | 1296 |
| 69 | Ga0068867_101339265 | 3300005459 | Bacteria | 662 |
| 70 | Ga0068867_101390973 | 3300005459 | Unclassified | 650 |
| 71 | Ga0070706_100143688 | 3300005467 | Bacteria | 2228 |
| 72 | Ga0070706_100431317 | 3300005467 | Unclassified | 1227 |
| 73 | Ga0070706_101855384 | 3300005467 | Unclassified | 547 |
| 74 | Ga0070699_101657660 | 3300005518 | Unclassified | 586 |
| 75 | Ga0070699_102174711 | 3300005518 | Unclassified | 506 |
| 76 | Ga0070679_100345026 | 3300005530 | Bacteria | 1437 |
| 77 | Ga0070679_100359986 | 3300005530 | Bacteria | 1402 |
| 78 | Ga0070679_100448790 | 3300005530 | Bacteria | 1234 |
| 79 | Ga0070684_100044513 | 3300005535 | Bacteria | 3840 |
| 80 | Ga0070684_100074273 | 3300005535 | Bacteria | 2997 |
| 81 | Ga0070684_100678742 | 3300005535 | Bacteria | 960 |
| 82 | Ga0070697_100642755 | 3300005536 | Bacteria | 934 |
| 83 | Ga0070697_100907664 | 3300005536 | Bacteria | 782 |
| 84 | Ga0070697_101548883 | 3300005536 | Bacteria | 593 |
| 85 | Ga0068853_100290319 | 3300005539 | Bacteria | 1510 |
| 86 | Ga0068853_101530231 | 3300005539 | Bacteria | 646 |
| 87 | Ga0068853_101979889 | 3300005539 | Unclassified | 565 |
| 88 | Ga0070672_100056579 | 3300005543 | Bacteria | 3076 |
| 89 | Ga0070672_100325829 | 3300005543 | Bacteria | 1306 |
| 90 | Ga0070686_100375457 | 3300005544 | Unclassified | 1075 |
| 91 | Ga0070695_100130341 | 3300005545 | Bacteria | 1732 |
| 92 | Ga0070695_100254619 | 3300005545 | Bacteria | 1279 |
| 93 | Ga0070695_100876731 | 3300005545 | Unclassified | 723 |
| 94 | Ga0070695_101404666 | 3300005545 | Unclassified | 579 |
| 95 | Ga0070696_100042694 | 3300005546 | Bacteria | 3134 |
| 96 | Ga0070696_100815951 | 3300005546 | Bacteria | 769 |
| 97 | Ga0070693_101516976 | 3300005547 | Unclassified | 524 |
| 98 | Ga0070665_100027769 | 3300005548 | Bacteria | 5698 |
| 99 | Ga0070665_100735307 | 3300005548 | Bacteria | 1000 |
| 100 | Ga0070665_100860193 | 3300005548 | Bacteria | 920 |
| 101 | Ga0070665_101138278 | 3300005548 | Bacteria | 792 |
| 102 | Ga0070665_101713167 | 3300005548 | Unclassified | 636 |
| 103 | Ga0068855_100567796 | 3300005563 | Bacteria | 1226 |
| 104 | Ga0070664_100028307 | 3300005564 | Bacteria | 4660 |
| 105 | Ga0070664_100047880 | 3300005564 | Bacteria | 3613 |
| 106 | Ga0070664_100197124 | 3300005564 | Bacteria | 1795 |
| 107 | Ga0070664_101377021 | 3300005564 | Unclassified | 667 |
| 108 | Ga0068854_100364238 | 3300005578 | Unclassified | 1187 |
| 109 | Ga0068856_101270801 | 3300005614 | Bacteria | 752 |
| 110 | Ga0070702_101349862 | 3300005615 | Unclassified | 581 |
| 111 | Ga0070702_101541208 | 3300005615 | Bacteria | 548 |
| 112 | Ga0068859_100082419 | 3300005617 | Bacteria | 3259 |
| 113 | Ga0068859_100464785 | 3300005617 | Bacteria | 1361 |
| 114 | Ga0068859_100672367 | 3300005617 | Unclassified | 1127 |
| 115 | Ga0068864_100104402 | 3300005618 | Bacteria | 2517 |
| 116 | Ga0068864_100367480 | 3300005618 | Bacteria | 1361 |
| 117 | Ga0068864_100687298 | 3300005618 | Unclassified | 999 |
| 118 | Ga0068864_101014084 | 3300005618 | Bacteria | 824 |
| 119 | Ga0068864_102273142 | 3300005618 | Unclassified | 549 |
| 120 | Ga0068851_10044782 | 3300005834 | Bacteria | 2235 |
| 121 | Ga0068870_10417689 | 3300005840 | Bacteria | 877 |
| 122 | Ga0068870_10504701 | 3300005840 | Bacteria | 807 |
| 123 | Ga0068863_100049894 | 3300005841 | Unclassified | 3968 |
| 124 | Ga0068863_100087919 | 3300005841 | Unclassified | 2945 |
| 125 | Ga0068863_100251686 | 3300005841 | Bacteria | 1707 |
| 126 | Ga0068863_100635780 | 3300005841 | Bacteria | 1058 |
| 127 | Ga0068858_100046861 | 3300005842 | Bacteria | 4008 |
| 128 | Ga0068858_100224572 | 3300005842 | Unclassified | 1779 |
| 129 | Ga0068858_100398171 | 3300005842 | Bacteria | 1323 |
| 130 | Ga0068858_102000777 | 3300005842 | Bacteria | 573 |
| 131 | Ga0068860_100337821 | 3300005843 | Bacteria | 1480 |
| 132 | Ga0068860_100683613 | 3300005843 | Unclassified | 1035 |
| 133 | Ga0068862_101996394 | 3300005844 | Bacteria | 591 |
| 134 | Ga0070717_11460640 | 3300006028 | Bacteria | 620 |
| 135 | Ga0070715_10005313 | 3300006163 | Unclassified | 4288 |
| 136 | Ga0070716_100030778 | 3300006173 | Unclassified | 2916 |
| 137 | Ga0070716_100061144 | 3300006173 | Bacteria | 2179 |
| 138 | Ga0070716_100131299 | 3300006173 | Bacteria | 1584 |
| 139 | Ga0070716_100360833 | 3300006173 | Unclassified | 1032 |
| 140 | Ga0070716_100561081 | 3300006173 | Unclassified | 853 |
| 141 | Ga0070712_100002059 | 3300006175 | Bacteria | 12320 |
| 142 | Ga0070712_100509330 | 3300006175 | Unclassified | 1010 |
| 143 | Ga0070712_101611791 | 3300006175 | Unclassified | 568 |
| 144 | Ga0097621_100027492 | 3300006237 | Bacteria | 4474 |
| 145 | Ga0097621_100136306 | 3300006237 | Bacteria | 2094 |
| 146 | Ga0097621_100142660 | 3300006237 | Bacteria | 2048 |
| 147 | Ga0097621_100229646 | 3300006237 | Bacteria | 1620 |
| 148 | Ga0097621_100459589 | 3300006237 | Unclassified | 1148 |
| 149 | Ga0097621_100637099 | 3300006237 | Bacteria | 977 |
| 150 | Ga0097621_100668127 | 3300006237 | Unclassified | 954 |
| 151 | Ga0097621_101185674 | 3300006237 | Unclassified | 719 |
| 152 | Ga0097621_101513890 | 3300006237 | Bacteria | 637 |
| 153 | Ga0068871_100173527 | 3300006358 | Bacteria | 1849 |
| 154 | Ga0068871_100375722 | 3300006358 | Unclassified | 1262 |
| 155 | Ga0068871_100504253 | 3300006358 | Bacteria | 1091 |
| 156 | Ga0068871_100529832 | 3300006358 | Unclassified | 1065 |
| 157 | Ga0068871_100687296 | 3300006358 | Unclassified | 936 |
| 158 | Ga0068871_101074000 | 3300006358 | Bacteria | 752 |
| 159 | Ga0075428_100027054 | 3300006844 | Bacteria | 6350 |
| 160 | Ga0075430_100540772 | 3300006846 | Bacteria | 961 |
| 161 | Ga0075430_100598846 | 3300006846 | Bacteria | 909 |
| 162 | Ga0075430_100953351 | 3300006846 | Unclassified | 707 |
| 163 | Ga0075431_100077674 | 3300006847 | Bacteria | 3426 |
| 164 | Ga0075431_100098163 | 3300006847 | Bacteria | 3024 |
| 165 | Ga0075433_10092782 | 3300006852 | Bacteria | 2671 |
| 166 | Ga0075433_10214882 | 3300006852 | Bacteria | 1709 |
| 167 | Ga0075433_10378414 | 3300006852 | Bacteria | 1250 |
| 168 | Ga0075433_11172613 | 3300006852 | Unclassified | 667 |
| 169 | Ga0075434_100029427 | 3300006871 | Bacteria | 5405 |
| 170 | Ga0075434_100037481 | 3300006871 | Bacteria | 4799 |
| 171 | Ga0075434_100242336 | 3300006871 | Bacteria | 1823 |
| 172 | Ga0075434_100664540 | 3300006871 | Bacteria | 1060 |
| 173 | Ga0075429_100964169 | 3300006880 | Bacteria | 746 |
| 174 | Ga0075429_101320717 | 3300006880 | Bacteria | 629 |
| 175 | Ga0068865_101037662 | 3300006881 | Unclassified | 719 |
| 176 | Ga0075436_100007299 | 3300006914 | Bacteria | 7556 |
| 177 | Ga0075436_100139154 | 3300006914 | Bacteria | 1705 |
| 178 | Ga0075436_101369398 | 3300006914 | Unclassified | 536 |
| 179 | Ga0097620_100082412 | 3300006931 | Bacteria | 3259 |
| 180 | Ga0097620_100464717 | 3300006931 | Bacteria | 1361 |
| 181 | Ga0097620_100672420 | 3300006931 | Unclassified | 1127 |
| 182 | Ga0075435_100039393 | 3300007076 | Bacteria | 3771 |
| 183 | Ga0075435_100304546 | 3300007076 | Unclassified | 1363 |
| 184 | Ga0075435_101105522 | 3300007076 | Unclassified | 693 |
| 185 | Ga0075435_101336512 | 3300007076 | Bacteria | 628 |
| 186 | Ga0105251_10282618 | 3300009011 | Bacteria | 750 |
| 187 | Ga0105240_10001086 | 3300009093 | Bacteria | 48011 |
| 188 | Ga0105240_10331368 | 3300009093 | Unclassified | 1732 |
| 189 | Ga0105240_10360485 | 3300009093 | Bacteria | 1647 |
| 190 | Ga0105240_10386958 | 3300009093 | Bacteria | 1578 |
| 191 | Ga0111539_10635405 | 3300009094 | Unclassified | 1243 |
| 192 | Ga0111539_11363620 | 3300009094 | Unclassified | 823 |
| 193 | Ga0114129_10248011 | 3300009147 | Bacteria | 2391 |
| 194 | Ga0114129_10718704 | 3300009147 | Bacteria | 1282 |
| 195 | Ga0114129_11302412 | 3300009147 | Unclassified | 900 |
| 196 | Ga0105243_10846275 | 3300009148 | Bacteria | 905 |
| 197 | Ga0105243_11076075 | 3300009148 | Unclassified | 811 |
| 198 | Ga0105243_12189425 | 3300009148 | Unclassified | 589 |
| 199 | Ga0105241_10363286 | 3300009174 | Bacteria | 1260 |
| 200 | Ga0105241_10398447 | 3300009174 | Bacteria | 1207 |
| 201 | Ga0105241_11171848 | 3300009174 | Unclassified | 727 |
| 202 | Ga0105241_11466631 | 3300009174 | Unclassified | 655 |
| 203 | Ga0105241_11623083 | 3300009174 | Bacteria | 626 |
| 204 | Ga0105242_10051435 | 3300009176 | Bacteria | 3357 |
| 205 | Ga0105242_10245100 | 3300009176 | Bacteria | 1612 |
| 206 | Ga0105242_10397304 | 3300009176 | Unclassified | 1285 |
| 207 | Ga0105242_10973021 | 3300009176 | Unclassified | 854 |
| 208 | Ga0105242_11404235 | 3300009176 | Bacteria | 726 |
| 209 | Ga0105242_11644258 | 3300009176 | Bacteria | 677 |
| 210 | Ga0105248_10046855 | 3300009177 | Bacteria | 4847 |
| 211 | Ga0105248_10138076 | 3300009177 | Unclassified | 2750 |
| 212 | Ga0105248_10197007 | 3300009177 | Unclassified | 2270 |
| 213 | Ga0105248_10310602 | 3300009177 | Bacteria | 1776 |
| 214 | Ga0105248_10492305 | 3300009177 | Unclassified | 1382 |
| 215 | Ga0105248_10648191 | 3300009177 | Bacteria | 1192 |
| 216 | Ga0105248_10708219 | 3300009177 | Bacteria | 1136 |
| 217 | Ga0105248_10897660 | 3300009177 | Bacteria | 1001 |
| 218 | Ga0105248_10989905 | 3300009177 | Unclassified | 950 |
| 219 | Ga0105248_11144345 | 3300009177 | Bacteria | 880 |
| 220 | Ga0105248_11821069 | 3300009177 | Bacteria | 690 |
| 221 | Ga0105237_10117442 | 3300009545 | Unclassified | 2654 |
| 222 | Ga0105237_10125841 | 3300009545 | Bacteria | 2557 |
| 223 | Ga0105237_10132511 | 3300009545 | Bacteria | 2487 |
| 224 | Ga0105237_10453793 | 3300009545 | Bacteria | 1288 |
| 225 | Ga0105237_10463569 | 3300009545 | Bacteria | 1273 |
| 226 | Ga0105237_10951362 | 3300009545 | Unclassified | 866 |
| 227 | Ga0105237_11369767 | 3300009545 | Unclassified | 714 |
| 228 | Ga0105238_10131891 | 3300009551 | Bacteria | 2477 |
| 229 | Ga0105238_10393564 | 3300009551 | Unclassified | 1378 |
| 230 | Ga0105238_10652211 | 3300009551 | Unclassified | 1063 |
| 231 | Ga0105249_10335901 | 3300009553 | Bacteria | 1526 |
| 232 | Ga0105249_11080558 | 3300009553 | Unclassified | 872 |
| 233 | Ga0105239_10097404 | 3300010375 | Bacteria | 3251 |
| 234 | Ga0105239_10606956 | 3300010375 | Bacteria | 1248 |
| 235 | Ga0105239_10841302 | 3300010375 | Bacteria | 1052 |
| 236 | Ga0105239_13335393 | 3300010375 | Bacteria | 522 |
| 237 | Ga0105246_10435614 | 3300011119 | Unclassified | 1098 |
| 238 | Ga0105246_11083483 | 3300011119 | Bacteria | 730 |
| 239 | Ga0105246_11690807 | 3300011119 | Unclassified | 601 |
| 240 | Ga0157373_10173814 | 3300013100 | Bacteria | 1516 |
| 241 | Ga0157373_10441017 | 3300013100 | Bacteria | 936 |
| 242 | Ga0157373_10491594 | 3300013100 | Bacteria | 886 |
| 243 | Ga0157370_11270668 | 3300013104 | Bacteria | 663 |
| 244 | Ga0157370_11426463 | 3300013104 | Bacteria | 623 |
| 245 | Ga0157370_11808592 | 3300013104 | Unclassified | 548 |
| 246 | Ga0157369_10161448 | 3300013105 | Unclassified | 2366 |
| 247 | Ga0157369_10708371 | 3300013105 | Bacteria | 1036 |
| 248 | Ga0157369_11486042 | 3300013105 | Bacteria | 689 |
| 249 | Ga0157374_10033336 | 3300013296 | Bacteria | 4699 |
| 250 | Ga0157374_10083489 | 3300013296 | Bacteria | 3035 |
| 251 | Ga0157374_10985213 | 3300013296 | Unclassified | 862 |
| 252 | Ga0157374_11191013 | 3300013296 | Bacteria | 783 |
| 253 | Ga0157374_11686371 | 3300013296 | Bacteria | 658 |
| 254 | Ga0157378_10041431 | 3300013297 | Unclassified | 4084 |
| 255 | Ga0157378_10251024 | 3300013297 | Bacteria | 1694 |
| 256 | Ga0157378_10338716 | 3300013297 | Bacteria | 1466 |
| 257 | Ga0157378_10448393 | 3300013297 | Bacteria | 1280 |
| 258 | Ga0157378_10671680 | 3300013297 | Bacteria | 1053 |
| 259 | Ga0157378_10853180 | 3300013297 | Bacteria | 939 |
| 260 | Ga0157378_10995308 | 3300013297 | Bacteria | 872 |
| 261 | Ga0157378_11186195 | 3300013297 | Bacteria | 802 |
| 262 | Ga0157378_11229185 | 3300013297 | Unclassified | 789 |
| 263 | Ga0157378_11900389 | 3300013297 | Unclassified | 644 |
| 264 | Ga0157378_12657595 | 3300013297 | Unclassified | 553 |
| 265 | Ga0163162_10013797 | 3300013306 | Bacteria | 7892 |
| 266 | Ga0163162_10464635 | 3300013306 | Bacteria | 1397 |
| 267 | Ga0163162_10481455 | 3300013306 | Bacteria | 1372 |
| 268 | Ga0163162_10571355 | 3300013306 | Bacteria | 1258 |
| 269 | Ga0163162_10915240 | 3300013306 | Bacteria | 990 |
| 270 | Ga0163162_11037518 | 3300013306 | Bacteria | 928 |
| 271 | Ga0157372_10023879 | 3300013307 | Bacteria | 6634 |
| 272 | Ga0157372_10117600 | 3300013307 | Bacteria | 3049 |
| 273 | Ga0157372_10308763 | 3300013307 | Unclassified | 1841 |
| 274 | Ga0157372_11586517 | 3300013307 | Bacteria | 753 |
| 275 | Ga0157372_11588848 | 3300013307 | Unclassified | 753 |
| 276 | Ga0157372_12544587 | 3300013307 | Unclassified | 587 |
| 277 | Ga0157375_10013753 | 3300013308 | Bacteria | 7214 |
| 278 | Ga0157375_10149587 | 3300013308 | Bacteria | 2469 |
| 279 | Ga0157375_10371864 | 3300013308 | Unclassified | 1596 |
| 280 | Ga0157375_10498997 | 3300013308 | Unclassified | 1381 |
| 281 | Ga0157375_10720361 | 3300013308 | Bacteria | 1150 |
| 282 | Ga0157375_12087978 | 3300013308 | Unclassified | 674 |
| 283 | Ga0157375_12820810 | 3300013308 | Unclassified | 581 |
| 284 | Ga0157375_13754339 | 3300013308 | Unclassified | 505 |
| 285 | Ga0163163_10028533 | 3300014325 | Bacteria | 5360 |
| 286 | Ga0163163_10055760 | 3300014325 | Bacteria | 3906 |
| 287 | Ga0163163_10062121 | 3300014325 | Bacteria | 3701 |
| 288 | Ga0163163_10096938 | 3300014325 | Bacteria | 2969 |
| 289 | Ga0163163_10151255 | 3300014325 | Unclassified | 2365 |
| 290 | Ga0163163_10382025 | 3300014325 | Bacteria | 1466 |
| 291 | Ga0163163_10423745 | 3300014325 | Bacteria | 1390 |
| 292 | Ga0163163_10914610 | 3300014325 | Bacteria | 941 |
| 293 | Ga0157380_10152191 | 3300014326 | Bacteria | 2001 |
| 294 | Ga0157380_11580121 | 3300014326 | Unclassified | 711 |
| 295 | Ga0182008_10093691 | 3300014497 | Bacteria | 1482 |
| 296 | Ga0157377_10226594 | 3300014745 | Unclassified | 1199 |
| 297 | Ga0157377_11105782 | 3300014745 | Bacteria | 607 |
| 298 | Ga0157379_10021300 | 3300014968 | Bacteria | 5737 |
| 299 | Ga0157379_10752213 | 3300014968 | Bacteria | 918 |
| 300 | Ga0157379_11136771 | 3300014968 | Bacteria | 749 |
| 301 | Ga0157376_10102075 | 3300014969 | Bacteria | 2508 |
| 302 | Ga0157376_10439747 | 3300014969 | Unclassified | 1270 |
| 303 | Ga0157376_10800372 | 3300014969 | Bacteria | 955 |
| 304 | Ga0157376_11089933 | 3300014969 | Bacteria | 824 |
| 305 | Ga0157376_11203344 | 3300014969 | Bacteria | 786 |
| 306 | Ga0157376_11695616 | 3300014969 | Bacteria | 667 |
| 307 | Ga0157376_11814175 | 3300014969 | Bacteria | 646 |
| 308 | Ga0157376_12332023 | 3300014969 | Unclassified | 574 |
| 309 | Ga0182007_10031782 | 3300015262 | Bacteria | 1796 |
| 310 | Ga0182005_1078488 | 3300015265 | Unclassified | 910 |
| 311 | Ga0163161_10161597 | 3300017792 | Bacteria | 1708 |
| 312 | Ga0163161_11028778 | 3300017792 | Unclassified | 704 |
| 313 | Ga0163161_11029243 | 3300017792 | Unclassified | 704 |
| 314 | Ga0184593_119779 | 3300019179 | Unclassified | 553 |
| 315 | Ga0184598_142313 | 3300019182 | Bacteria | 504 |
| 316 | Ga0184601_123318 | 3300019183 | Bacteria | 527 |
| 317 | Ga0206352_10258107 | 3300020078 | Bacteria | 826 |
| 318 | Ga0206354_10048515 | 3300020081 | Unclassified | 580 |
| 319 | Ga0213874_10379101 | 3300021377 | Unclassified | 547 |
| 320 | Ga0224570_103130 | 3300022730 | Bacteria | 1061 |
| 321 | Ga0224572_1014433 | 3300024225 | Bacteria | 1509 |
| 322 | Ga0228598_1001630 | 3300024227 | Unclassified | 4903 |
| 323 | Ga0207697_10199031 | 3300025315 | Unclassified | 881 |
| 324 | Ga0207653_10035301 | 3300025885 | Bacteria | 1626 |
| 325 | Ga0207692_10017532 | 3300025898 | Unclassified | 3196 |
| 326 | Ga0207642_10191118 | 3300025899 | Unclassified | 1123 |
| 327 | Ga0207680_10038192 | 3300025903 | Bacteria | 2778 |
| 328 | Ga0207685_10080404 | 3300025905 | Bacteria | 1347 |
| 329 | Ga0207699_10060684 | 3300025906 | Bacteria | 2272 |
| 330 | Ga0207699_10288338 | 3300025906 | Bacteria | 1143 |
| 331 | Ga0207699_10405806 | 3300025906 | Bacteria | 971 |
| 332 | Ga0207699_10624860 | 3300025906 | Bacteria | 785 |
| 333 | Ga0207645_10813367 | 3300025907 | Bacteria | 635 |
| 334 | Ga0207684_10709551 | 3300025910 | Bacteria | 854 |
| 335 | Ga0207654_10807812 | 3300025911 | Unclassified | 678 |
| 336 | Ga0207654_10937484 | 3300025911 | Bacteria | 628 |
| 337 | Ga0207707_10126950 | 3300025912 | Bacteria | 2231 |
| 338 | Ga0207707_10214012 | 3300025912 | Bacteria | 1678 |
| 339 | Ga0207707_11352295 | 3300025912 | Unclassified | 570 |
| 340 | Ga0207695_10005447 | 3300025913 | Bacteria | 16868 |
| 341 | Ga0207671_10018759 | 3300025914 | Bacteria | 5301 |
| 342 | Ga0207671_10500216 | 3300025914 | Bacteria | 969 |
| 343 | Ga0207693_10000152 | 3300025915 | Bacteria | 63967 |
| 344 | Ga0207663_10005842 | 3300025916 | Bacteria | 6240 |
| 345 | Ga0207660_10256378 | 3300025917 | Bacteria | 1382 |
| 346 | Ga0207662_11315465 | 3300025918 | Unclassified | 513 |
| 347 | Ga0207657_11029851 | 3300025919 | Unclassified | 631 |
| 348 | Ga0207652_10055739 | 3300025921 | Bacteria | 3401 |
| 349 | Ga0207652_10305994 | 3300025921 | Bacteria | 1435 |
| 350 | Ga0207652_11616632 | 3300025921 | Bacteria | 552 |
| 351 | Ga0207681_10655939 | 3300025923 | Unclassified | 870 |
| 352 | Ga0207681_11473599 | 3300025923 | Unclassified | 571 |
| 353 | Ga0207681_11567699 | 3300025923 | Bacteria | 552 |
| 354 | Ga0207694_10265192 | 3300025924 | Unclassified | 1408 |
| 355 | Ga0207694_10530644 | 3300025924 | Unclassified | 987 |
| 356 | Ga0207650_10231915 | 3300025925 | Bacteria | 1489 |
| 357 | Ga0207650_11360677 | 3300025925 | Bacteria | 604 |
| 358 | Ga0207659_10516474 | 3300025926 | Unclassified | 1012 |
| 359 | Ga0207687_10349851 | 3300025927 | Unclassified | 1204 |
| 360 | Ga0207687_11749153 | 3300025927 | Bacteria | 532 |
| 361 | Ga0207700_10321145 | 3300025928 | Bacteria | 1342 |
| 362 | Ga0207644_10248625 | 3300025931 | Bacteria | 1418 |
| 363 | Ga0207706_10228815 | 3300025933 | Unclassified | 1627 |
| 364 | Ga0207706_10985158 | 3300025933 | Bacteria | 709 |
| 365 | Ga0207686_10236131 | 3300025934 | Bacteria | 1328 |
| 366 | Ga0207686_10503467 | 3300025934 | Unclassified | 940 |
| 367 | Ga0207709_10825044 | 3300025935 | Bacteria | 750 |
| 368 | Ga0207709_11352463 | 3300025935 | Unclassified | 589 |
| 369 | Ga0207709_11368914 | 3300025935 | Unclassified | 586 |
| 370 | Ga0207670_10541170 | 3300025936 | Bacteria | 950 |
| 371 | Ga0207670_10952303 | 3300025936 | Unclassified | 721 |
| 372 | Ga0207670_11212429 | 3300025936 | Unclassified | 639 |
| 373 | Ga0207669_11486039 | 3300025937 | Unclassified | 578 |
| 374 | Ga0207704_10360957 | 3300025938 | Bacteria | 1134 |
| 375 | Ga0207665_10045369 | 3300025939 | Unclassified | 2943 |
| 376 | Ga0207665_10049699 | 3300025939 | Bacteria | 2818 |
| 377 | Ga0207665_10198725 | 3300025939 | Bacteria | 1460 |
| 378 | Ga0207665_10235664 | 3300025939 | Bacteria | 1347 |
| 379 | Ga0207665_11068647 | 3300025939 | Unclassified | 643 |
| 380 | Ga0207691_10039241 | 3300025940 | Bacteria | 4380 |
| 381 | Ga0207711_10118781 | 3300025941 | Unclassified | 2359 |
| 382 | Ga0207711_10490985 | 3300025941 | Unclassified | 1144 |
| 383 | Ga0207711_11736096 | 3300025941 | Bacteria | 567 |
| 384 | Ga0207689_10103446 | 3300025942 | Unclassified | 2340 |
| 385 | Ga0207689_10633341 | 3300025942 | Unclassified | 900 |
| 386 | Ga0207661_10039258 | 3300025944 | Bacteria | 3715 |
| 387 | Ga0207661_10118455 | 3300025944 | Unclassified | 2251 |
| 388 | Ga0207661_11969682 | 3300025944 | Unclassified | 530 |
| 389 | Ga0207679_10259964 | 3300025945 | Bacteria | 1480 |
| 390 | Ga0207679_10849910 | 3300025945 | Bacteria | 833 |
| 391 | Ga0207679_11762553 | 3300025945 | Unclassified | 566 |
| 392 | Ga0207651_10230206 | 3300025960 | Unclassified | 1504 |
| 393 | Ga0207651_10233078 | 3300025960 | Bacteria | 1496 |
| 394 | Ga0207651_10714991 | 3300025960 | Bacteria | 883 |
| 395 | Ga0207651_11251163 | 3300025960 | Bacteria | 667 |
| 396 | Ga0207651_11483675 | 3300025960 | Bacteria | 611 |
| 397 | Ga0207712_10270553 | 3300025961 | Unclassified | 1382 |
| 398 | Ga0207640_11255864 | 3300025981 | Unclassified | 660 |
| 399 | Ga0207658_10084841 | 3300025986 | Bacteria | 2438 |
| 400 | Ga0207658_10202783 | 3300025986 | Unclassified | 1657 |
| 401 | Ga0207677_10506658 | 3300026023 | Bacteria | 1045 |
| 402 | Ga0207677_10569022 | 3300026023 | Bacteria | 990 |
| 403 | Ga0207677_12213137 | 3300026023 | Unclassified | 512 |
| 404 | Ga0207703_10066023 | 3300026035 | Bacteria | 2976 |
| 405 | Ga0207703_10238923 | 3300026035 | Bacteria | 1632 |
| 406 | Ga0207703_11901474 | 3300026035 | Unclassified | 571 |
| 407 | Ga0207678_11132791 | 3300026067 | Unclassified | 693 |
| 408 | Ga0207641_10010793 | 3300026088 | Bacteria | 7489 |
| 409 | Ga0207641_10473408 | 3300026088 | Bacteria | 1213 |
| 410 | Ga0207641_10555523 | 3300026088 | Unclassified | 1120 |
| 411 | Ga0207641_11737870 | 3300026088 | Unclassified | 626 |
| 412 | Ga0207648_10225146 | 3300026089 | Bacteria | 1668 |
| 413 | Ga0207648_10455558 | 3300026089 | Unclassified | 1165 |
| 414 | Ga0207648_10736276 | 3300026089 | Bacteria | 915 |
| 415 | Ga0207648_11254702 | 3300026089 | Unclassified | 696 |
| 416 | Ga0207648_11308193 | 3300026089 | Unclassified | 681 |
| 417 | Ga0207676_10165367 | 3300026095 | Bacteria | 1921 |
| 418 | Ga0207676_10313197 | 3300026095 | Unclassified | 1438 |
| 419 | Ga0207676_10684184 | 3300026095 | Bacteria | 992 |
| 420 | Ga0207676_10751789 | 3300026095 | Unclassified | 948 |
| 421 | Ga0207676_12251298 | 3300026095 | Unclassified | 543 |
| 422 | Ga0207674_11064209 | 3300026116 | Bacteria | 778 |
| 423 | Ga0207674_11092189 | 3300026116 | Bacteria | 767 |
| 424 | Ga0207675_100254083 | 3300026118 | Bacteria | 1702 |
| 425 | Ga0207675_102401274 | 3300026118 | Unclassified | 539 |
| 426 | Ga0207683_10357494 | 3300026121 | Bacteria | 1341 |
| 427 | Ga0207428_10074611 | 3300027907 | Bacteria | 2660 |
| 428 | Ga0207428_10420456 | 3300027907 | Unclassified | 977 |
| 429 | Ga0265354_1013991 | 3300028016 | Unclassified | 760 |
| 430 | Ga0265356_1007140 | 3300028017 | Unclassified | 1293 |
| 431 | Ga0268266_10091695 | 3300028379 | Unclassified | 2665 |
| 432 | Ga0268265_10371960 | 3300028380 | Bacteria | 1312 |
| 433 | Ga0268265_11748079 | 3300028380 | Bacteria | 628 |
| 434 | Ga0268264_10436768 | 3300028381 | Bacteria | 1265 |
| 435 | Ga0268264_10499046 | 3300028381 | Unclassified | 1187 |
| 436 | Ga0265338_10075035 | 3300028800 | Unclassified | 2872 |
| 437 | Ga0265762_1003341 | 3300030760 | Bacteria | 2869 |
| 438 | Ga0265770_1003487 | 3300030878 | Bacteria | 2138 |
| 439 | Ga0265770_1111501 | 3300030878 | Unclassified | 567 |
| 440 | Ga0265770_1143361 | 3300030878 | Unclassified | 519 |
| 441 | Ga0265765_1001004 | 3300030879 | Bacteria | 2497 |
| 442 | Ga0265765_1024717 | 3300030879 | Unclassified | 742 |
| 443 | Ga0265771_1007422 | 3300031010 | Bacteria | 746 |
| 444 | Ga0265771_1019559 | 3300031010 | Unclassified | 577 |
| 445 | Ga0265760_10002361 | 3300031090 | Bacteria | 5523 |
| 446 | Ga0265760_10003029 | 3300031090 | Bacteria | 4915 |
| 447 | Ga0265760_10383501 | 3300031090 | Bacteria | 506 |
| 448 | Ga0316212_1052520 | 3300033547 | Bacteria | 581 |
| 449 | Ga0373958_0037523 | 3300034819 | Bacteria | 978 |
| 450 | Ga0373959_0071115 | 3300034820 | Unclassified | 787 |
| 451 | Ga0373926_0015059 | 3300035083 | Unclassified | 2634 |
| 452 | Ga0373929_0066746 | 3300035085 | Unclassified | 853 |
| 453 | Ga0373944_0319819 | 3300035089 | Bacteria | 586 |
| 454 | Ga0373951_0183454 | 3300035091 | Unclassified | 602 |
| 455 | Ga0373923_0134470 | 3300035111 | Bacteria | 1114 |
| 456 | Ga0373923_0194919 | 3300035111 | Bacteria | 935 |
| 457 | Ga0373932_0020990 | 3300035112 | Bacteria | 1719 |
| 458 | Ga0373945_0099518 | 3300035116 | Unclassified | 1136 |
| 459 | Ga0373954_0329331 | 3300035118 | Bacteria | 754 |
| 460 | Ga0373954_0464084 | 3300035118 | Bacteria | 627 |
| 461 | Ga0373957_0133947 | 3300035120 | Unclassified | 1010 |
| 462 | Ga0373960_0006687 | 3300035121 | Bacteria | 2712 |
| 463 | Ga0373943_0018141 | 3300035170 | Unclassified | 3230 |
| 464 | Ga0373946_0089599 | 3300035171 | Unclassified | 1361 |
| 465 | Ga0373955_0130463 | 3300035172 | Bacteria | 1467 |
| 466 | Ga0373955_0516756 | 3300035172 | Bacteria | 730 |
| 467 | Ga0373924_0085914 | 3300035410 | Bacteria | 1342 |
| 468 | Ga0373924_0233246 | 3300035410 | Unclassified | 814 |
| 469 | Ga0373931_0162746 | 3300035691 | Bacteria | 1309 |
| 470 | Ga0373931_0192462 | 3300035691 | Bacteria | 1214 |
| 471 | Ga0373931_0373679 | 3300035691 | Unclassified | 897 |
| 472 | Ga0373935_0342332 | 3300035692 | Bacteria | 1065 |
| 473 | Ga0373935_0390871 | 3300035692 | Unclassified | 997 |
| 474 | Ga0373935_0541016 | 3300035692 | Bacteria | 848 |
| 475 | Ga0373927_0006221 | 3300035695 | Bacteria | 8151 |
| 476 | Ga0373927_0273285 | 3300035695 | Bacteria | 1111 |
| 477 | Ga0373927_0724340 | 3300035695 | Unclassified | 657 |
| 478 | Ga0373927_0889707 | 3300035695 | Unclassified | 588 |
| 479 | Ga0373933_0805128 | 3300035724 | Bacteria | 618 |
| 480 | Ga0373933_0843388 | 3300035724 | Unclassified | 603 |
| 481 | Ga0373947_0239250 | 3300035725 | Bacteria | 1198 |
| 482 | Ga0373947_0937818 | 3300035725 | Unclassified | 591 |
| 483 | Ga0373937_0018615 | 3300036401 | Bacteria | 6204 |
| 484 | Ga0373937_0039742 | 3300036401 | Unclassified | 4287 |
| 485 | Ga0373937_0186600 | 3300036401 | Bacteria | 1948 |
| 486 | Ga0373937_0212836 | 3300036401 | Bacteria | 1819 |
| 487 | Ga0373937_0225840 | 3300036401 | Unclassified | 1763 |
| 488 | Ga0373937_0540504 | 3300036401 | Bacteria | 1107 |
| 489 | Ga0373925_0000062 | 3300037068 | Bacteria | 114902 |
| 490 | Ga0373925_0131424 | 3300037068 | Bacteria | 1952 |
| 491 | Ga0373925_0842374 | 3300037068 | Bacteria | 756 |
| 492 | Ga0436360_0068673 | 3300039438 | Bacteria | 1597 |
| 493 | Ga0436363_1666979 | 3300039450 | Bacteria | 1230 |
| 494 | Ga0439448_0164916 | 3300042005 | Unclassified | 772 |
| 495 | Ga0451576_0381180 | 3300045051 | Bacteria | 1478 |
| 496 | Ga0451576_0430924 | 3300045051 | Bacteria | 1384 |
| 497 | Ga0451576_0814453 | 3300045051 | Unclassified | 980 |
| 498 | Ga0451576_1172002 | 3300045051 | Unclassified | 803 |
| 499 | Ga0451576_1570593 | 3300045051 | Unclassified | 683 |
| 500 | Ga0451576_2113054 | 3300045051 | Unclassified | 579 |
| 501 | Ga0495592_0012532 | 3300046454 | Bacteria | 6442 |
| 502 | Ga0495603_0538491 | 3300046455 | Bacteria | 669 |
| 503 | Ga0495629_0050397 | 3300046459 | Bacteria | 2916 |
| 504 | Ga0495651_0165039 | 3300046462 | Unclassified | 1583 |
| 505 | Ga0495653_0591807 | 3300046463 | Bacteria | 683 |
| 506 | Ga0495580_0012519 | 3300046472 | Bacteria | 6503 |
| 507 | Ga0495580_0065269 | 3300046472 | Unclassified | 2550 |
| 508 | Ga0495580_0080149 | 3300046472 | Unclassified | 2277 |
| 509 | Ga0495580_0259864 | 3300046472 | Bacteria | 1187 |
| 510 | Ga0495580_0653061 | 3300046472 | Bacteria | 692 |
| 511 | Ga0495580_0935509 | 3300046472 | Unclassified | 555 |
| 512 | Ga0495582_0437659 | 3300046473 | Bacteria | 755 |
| 513 | Ga0495582_0841351 | 3300046473 | Bacteria | 531 |
| 514 | Ga0495662_0195247 | 3300046476 | Bacteria | 998 |
| 515 | Ga0495662_0206582 | 3300046476 | Bacteria | 968 |
| 516 | Ga0495662_0589492 | 3300046476 | Unclassified | 544 |
| 517 | Ga0495664_0149855 | 3300046477 | Bacteria | 1415 |
| 518 | Ga0495664_0330367 | 3300046477 | Unclassified | 919 |
| 519 | Ga0495594_0191331 | 3300046499 | Unclassified | 1166 |
| 520 | Ga0495594_0416483 | 3300046499 | Unclassified | 764 |
| 521 | Ga0495608_0036099 | 3300046511 | Bacteria | 3329 |
| 522 | Ga0495618_0439576 | 3300046514 | Bacteria | 793 |
| 523 | Ga0495618_0916259 | 3300046514 | Unclassified | 505 |
| 524 | Ga0495628_0216984 | 3300046516 | Bacteria | 1438 |
| 525 | Ga0495628_0220674 | 3300046516 | Unclassified | 1424 |
| 526 | Ga0495628_0273852 | 3300046516 | Unclassified | 1255 |
| 527 | Ga0495630_0587556 | 3300046517 | Bacteria | 854 |
| 528 | Ga0495630_0608303 | 3300046517 | Bacteria | 838 |
| 529 | Ga0495630_0740166 | 3300046517 | Unclassified | 752 |
| 530 | Ga0495630_1148600 | 3300046517 | Unclassified | 588 |
| 531 | Ga0495644_0248175 | 3300046523 | Unclassified | 691 |
| 532 | Ga0495666_0111128 | 3300046526 | Bacteria | 1287 |
| 533 | Ga0495666_0234317 | 3300046526 | Bacteria | 839 |
| 534 | Ga0495652_0280711 | 3300046529 | Bacteria | 1220 |
| 535 | Ga0495652_0842736 | 3300046529 | Unclassified | 608 |
| 536 | Ga0495665_0044581 | 3300046531 | Bacteria | 2356 |
| 537 | Ga0495665_0061982 | 3300046531 | Unclassified | 1975 |
| 538 | Ga0495665_0574180 | 3300046531 | Unclassified | 565 |
| 539 | Ga0495640_0544429 | 3300046533 | Unclassified | 704 |
| 540 | Ga0495586_0058912 | 3300046535 | Bacteria | 2086 |
| 541 | Ga0495587_0118332 | 3300046536 | Bacteria | 1518 |
| 542 | Ga0495587_0266164 | 3300046536 | Bacteria | 962 |
| 543 | Ga0495587_0825700 | 3300046536 | Bacteria | 506 |
| 544 | Ga0495645_0033872 | 3300046543 | Unclassified | 3726 |
| 545 | Ga0495645_0165310 | 3300046543 | Bacteria | 1527 |
| 546 | Ga0495645_0941853 | 3300046543 | Unclassified | 511 |
| 547 | Ga0495667_0001451 | 3300046559 | Bacteria | 15608 |
| 548 | Ga0495667_0716036 | 3300046559 | Bacteria | 620 |
| 549 | Ga0495667_0973818 | 3300046559 | Unclassified | 518 |
| 550 | Ga0495634_0072118 | 3300046642 | Bacteria | 2272 |
| 551 | Ga0495634_0296348 | 3300046642 | Bacteria | 979 |
| 552 | Ga0495634_0603534 | 3300046642 | Bacteria | 637 |
| 553 | Ga0495635_0359444 | 3300046663 | Bacteria | 971 |
| 554 | Ga0495635_0811691 | 3300046663 | Unclassified | 602 |
| 555 | Ga0495635_0963482 | 3300046663 | Bacteria | 544 |
| 556 | Ga0495657_0000672 | 3300046675 | Bacteria | 30911 |
| 557 | Ga0495599_0056864 | 3300046678 | Bacteria | 2448 |
| 558 | Ga0495623_0303097 | 3300046679 | Bacteria | 882 |
| 559 | Ga0495623_0598697 | 3300046679 | Bacteria | 573 |
| 560 | Ga0495658_0064355 | 3300046683 | Bacteria | 2113 |
| 561 | Ga0495669_0244138 | 3300046684 | Unclassified | 862 |
| 562 | Ga0495613_0041827 | 3300046689 | Bacteria | 3392 |
| 563 | Ga0495613_0053407 | 3300046689 | Bacteria | 2973 |
| 564 | Ga0495624_0151765 | 3300046690 | Unclassified | 1417 |
| 565 | Ga0495624_0784292 | 3300046690 | Bacteria | 564 |
| 566 | Ga0495600_0482848 | 3300046809 | Unclassified | 763 |
| 567 | Ga0495581_0140081 | 3300047315 | Bacteria | 1411 |
| 568 | Ga0495581_0315294 | 3300047315 | Unclassified | 914 |
| 569 | Ga0495604_0510088 | 3300047317 | Unclassified | 779 |
| 570 | Ga0495604_0709181 | 3300047317 | Unclassified | 638 |
| 571 | Ga0495636_0231289 | 3300047318 | Unclassified | 851 |
| 572 | Ga0495674_0062623 | 3300047319 | Bacteria | 3238 |
| 573 | Ga0495674_0381587 | 3300047319 | Bacteria | 1140 |
| 574 | Ga0495674_0558358 | 3300047319 | Bacteria | 911 |
| 575 | Ga0495674_0920529 | 3300047319 | Bacteria | 674 |
| 576 | Ga0495674_0942921 | 3300047319 | Unclassified | 664 |
| 577 | Ga0495676_0211708 | 3300047321 | Bacteria | 1341 |
| 578 | Ga0495675_0061064 | 3300047444 | Bacteria | 2388 |
| 579 | Ga0495675_0143762 | 3300047444 | Bacteria | 1477 |
| 580 | Ga0495675_0243587 | 3300047444 | Bacteria | 1081 |
| 581 | Ga0495684_0000857 | 3300047471 | Bacteria | 24644 |
| 582 | Ga0495684_0009288 | 3300047471 | Bacteria | 7590 |
| 583 | Ga0495684_0177030 | 3300047471 | Unclassified | 1583 |
| 584 | Ga0495684_0236328 | 3300047471 | Bacteria | 1335 |
| 585 | Ga0495684_0249997 | 3300047471 | Bacteria | 1290 |
| 586 | Ga0495684_0289653 | 3300047471 | Bacteria | 1179 |
| 587 | Ga0495684_0324300 | 3300047471 | Bacteria | 1100 |
| 588 | Ga0495684_0444994 | 3300047471 | Bacteria | 901 |
| 589 | Ga0495684_0834094 | 3300047471 | Bacteria | 599 |
| 590 | Ga0495602_0003952 | 3300048088 | Bacteria | 15448 |
| 591 | Ga0495602_0847665 | 3300048088 | Bacteria | 611 |
| 592 | Ga0495614_0223078 | 3300048089 | Unclassified | 857 |
| 593 | Ga0495614_0509720 | 3300048089 | Unclassified | 573 |
| 594 | Ga0496102_0160230 | 3300048905 | Unclassified | 2116 |
| 595 | Ga0496102_1473763 | 3300048905 | Bacteria | 599 |
| 596 | Ga0496103_0392695 | 3300048906 | Bacteria | 891 |
| 597 | Ga0496104_0157601 | 3300048907 | Bacteria | 2179 |
| 598 | Ga0496104_0880925 | 3300048907 | Bacteria | 800 |
| 599 | Ga0496104_0929121 | 3300048907 | Unclassified | 775 |
| 600 | Ga0496106_0103693 | 3300048909 | Bacteria | 2208 |
| 601 | Ga0496112_0512913 | 3300048915 | Bacteria | 1134 |
| 602 | Ga0496112_0573915 | 3300048915 | Bacteria | 1061 |
| 603 | Ga0496112_1224840 | 3300048915 | Unclassified | 667 |
| 604 | Ga0496113_1356065 | 3300048916 | Bacteria | 552 |
| 605 | Ga0496114_0914126 | 3300048917 | Bacteria | 759 |
| 606 | Ga0496115_0183146 | 3300048918 | Bacteria | 1731 |
| 607 | Ga0496115_1383338 | 3300048918 | Bacteria | 520 |
| 608 | Ga0496115_1422423 | 3300048918 | Bacteria | 511 |
| 609 | Ga0501031_0408717 | 3300049568 | Unclassified | 878 |
| 610 | Ga0501036_0249162 | 3300049572 | Unclassified | 1489 |
| 611 | nmdc:mga05p37_1126961_c1 | 3300050507 | Unclassified | 819 |
| 612 | nmdc:mga05p37_375291_c1 | 3300050507 | Bacteria | 1668 |
| 613 | nmdc:mga0qj67_1176000_c1 | 3300050509 | Bacteria | 597 |
| 614 | nmdc:mga0qj67_303938_c1 | 3300050509 | Bacteria | 1292 |
| 615 | nmdc:mga0qj67_802001_c1 | 3300050509 | Unclassified | 745 |
| 616 | nmdc:mga06r32_294649_c1 | 3300050510 | Bacteria | 1609 |
| 617 | nmdc:mga06r32_31724_c1 | 3300050510 | Bacteria | 4965 |
| 618 | nmdc:mga08y16_609627_c1 | 3300050511 | Unclassified | 1100 |
| 619 | nmdc:mga08y16_64957_c1 | 3300050511 | Unclassified | 3810 |
| 620 | nmdc:mga0n895_1730480_c1 | 3300050512 | Unclassified | 587 |
| 621 | nmdc:mga0n895_27483_c1 | 3300050512 | Bacteria | 5405 |
| 622 | nmdc:mga0n895_473171_c1 | 3300050512 | Unclassified | 1264 |
| 623 | nmdc:mga0n895_655469_c1 | 3300050512 | Bacteria | 1048 |
| 624 | nmdc:mga0rr50_1193914_c1 | 3300050513 | Unclassified | 646 |
| 625 | nmdc:mga0rr50_1205434_c1 | 3300050513 | Unclassified | 643 |
| 626 | nmdc:mga0rr50_26365_c1 | 3300050513 | Bacteria | 4053 |
| 627 | nmdc:mga0rr50_570046_c1 | 3300050513 | Bacteria | 964 |
| 628 | nmdc:mga0rr50_981600_c1 | 3300050513 | Unclassified | 720 |
| 629 | nmdc:mga08x19_1130200_c1 | 3300050514 | Unclassified | 556 |
| 630 | nmdc:mga08x19_1265_c1 | 3300050514 | Bacteria | 15691 |
| 631 | nmdc:mga08x19_477533_c1 | 3300050514 | Bacteria | 879 |
| 632 | nmdc:mga08x19_853700_c1 | 3300050514 | Bacteria | 647 |
| 633 | nmdc:mga0a205_1089370_c1 | 3300050515 | Unclassified | 646 |
| 634 | nmdc:mga0a205_14400_c1 | 3300050515 | Bacteria | 7376 |
| 635 | nmdc:mga0a205_1473953_c1 | 3300050515 | Bacteria | 528 |
| 636 | nmdc:mga0a205_152273_c1 | 3300050515 | Bacteria | 2212 |
| 637 | Ga0495601_0679260 | 3300053077 | Bacteria | 658 |
| 638 | Ga0495619_0833629 | 3300053085 | Bacteria | 623 |
| 639 | Ga0495619_1100382 | 3300053085 | Bacteria | 529 |
| 640 | Ga0501082_0000185 | 3300060353 | Bacteria | 54029 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0408717 | Ga0501031_0408717_26_283 | 70 |
| 2 | 3300005536 | Ga0070697_101548883 | Ga0070697_1015488831 | 77 |
| 3 | 3300014326 | Ga0157380_11580121 | Ga0157380_115801211 | 77 |
| 4 | 3300036401 | Ga0373937_0039742 | Ga0373937_0039742_702_1058 | 77 |
| 5 | 3300046809 | Ga0495600_0482848 | Ga0495600_0482848_328_678 | 77 |
| 6 | 3300047471 | Ga0495684_0324300 | Ga0495684_0324300_619_969 | 77 |
| 7 | 3300010375 | Ga0105239_10841302 | Ga0105239_108413022 | 79 |
| 8 | 3300013100 | Ga0157373_10173814 | Ga0157373_101738142 | 79 |
| 9 | 3300013104 | Ga0157370_11808592 | Ga0157370_118085921 | 79 |
| 10 | 3300013297 | Ga0157378_10251024 | Ga0157378_102510242 | 79 |
| 11 | 3300015265 | Ga0182005_1078488 | Ga0182005_10784882 | 79 |
| 12 | 3300025921 | Ga0207652_10055739 | Ga0207652_100557392 | 79 |
| 13 | 3300048905 | Ga0496102_0160230 | Ga0496102_0160230_884_1165 | 79 |
| 14 | 3300048906 | Ga0496103_0392695 | Ga0496103_0392695_133_414 | 79 |
| 15 | 3300050512 | nmdc:mga0n895_473171_c1 | nmdc:mga0n895_473171_c1_13_294 | 79 |
| 16 | 3300009093 | Ga0105240_10386958 | Ga0105240_103869582 | 80 |
| 17 | 3300009177 | Ga0105248_10310602 | Ga0105248_103106022 | 80 |
| 18 | 3300010375 | Ga0105239_10097404 | Ga0105239_100974042 | 80 |
| 19 | 3300013297 | Ga0157378_10448393 | Ga0157378_104483932 | 80 |
| 20 | 3300013307 | Ga0157372_10117600 | Ga0157372_101176002 | 80 |
| 21 | 3300015262 | Ga0182007_10031782 | Ga0182007_100317822 | 80 |
| 22 | 3300005434 | Ga0070709_10629475 | Ga0070709_106294751 | 81 |
| 23 | 3300005439 | Ga0070711_100300218 | Ga0070711_1003002182 | 81 |
| 24 | 3300005440 | Ga0070705_101591311 | Ga0070705_1015913111 | 81 |
| 25 | 3300005444 | Ga0070694_100163357 | Ga0070694_1001633572 | 81 |
| 26 | 3300005467 | Ga0070706_100143688 | Ga0070706_1001436883 | 81 |
| 27 | 3300005545 | Ga0070695_100130341 | Ga0070695_1001303411 | 81 |
| 28 | 3300005546 | Ga0070696_100815951 | Ga0070696_1008159511 | 81 |
| 29 | 3300006173 | Ga0070716_100061144 | Ga0070716_1000611445 | 81 |
| 30 | 3300006914 | Ga0075436_100007299 | Ga0075436_1000072998 | 81 |
| 31 | 3300025885 | Ga0207653_10035301 | Ga0207653_100353011 | 81 |
| 32 | 3300025939 | Ga0207665_10198725 | Ga0207665_101987253 | 81 |
| 33 | 3300050514 | nmdc:mga08x19_1265_c1 | nmdc:mga08x19_1265_c1_12555_12857 | 81 |
| 34 | 3300005530 | Ga0070679_100345026 | Ga0070679_1003450263 | 82 |
| 35 | 3300005545 | Ga0070695_100876731 | Ga0070695_1008767311 | 82 |
| 36 | 3300009545 | Ga0105237_10132511 | Ga0105237_101325115 | 82 |
| 37 | 3300009545 | Ga0105237_10951362 | Ga0105237_109513622 | 82 |
| 38 | 3300025906 | Ga0207699_10624860 | Ga0207699_106248601 | 82 |
| 39 | 3300025912 | Ga0207707_10126950 | Ga0207707_101269501 | 82 |
| 40 | 3300025914 | Ga0207671_10500216 | Ga0207671_105002162 | 82 |
| 41 | 3300009093 | Ga0105240_10331368 | Ga0105240_103313682 | 84 |
| 42 | 3300009545 | Ga0105237_10117442 | Ga0105237_101174422 | 84 |
| 43 | 3300009545 | Ga0105237_11369767 | Ga0105237_113697671 | 84 |
| 44 | 3300013307 | Ga0157372_12544587 | Ga0157372_125445871 | 84 |
| 45 | 3300034819 | Ga0373958_0037523 | Ga0373958_0037523_143_439 | 84 |
| 46 | 3300035121 | Ga0373960_0006687 | Ga0373960_0006687_2057_2353 | 84 |
| 47 | 3300048915 | Ga0496112_1224840 | Ga0496112_1224840_226_522 | 84 |
| 48 | 3300050514 | nmdc:mga08x19_477533_c1 | nmdc:mga08x19_477533_c1_234_530 | 84 |
| 49 | 3300009177 | Ga0105248_10648191 | Ga0105248_106481911 | 85 |
| 50 | 3300013296 | Ga0157374_11191013 | Ga0157374_111910132 | 85 |
| 51 | 3300013308 | Ga0157375_12087978 | Ga0157375_120879782 | 85 |
| 52 | 3300006173 | Ga0070716_100360833 | Ga0070716_1003608332 | 86 |
| 53 | 3300013297 | Ga0157378_10671680 | Ga0157378_106716802 | 86 |
| 54 | 3300025939 | Ga0207665_11068647 | Ga0207665_110686471 | 86 |
| 55 | 3300050510 | nmdc:mga06r32_294649_c1 | nmdc:mga06r32_294649_c1_1135_1440 | 86 |
| 56 | 3300005329 | Ga0070683_100152242 | Ga0070683_1001522425 | 87 |
| 57 | 3300009174 | Ga0105241_10398447 | Ga0105241_103984471 | 87 |
| 58 | 3300009545 | Ga0105237_10463569 | Ga0105237_104635692 | 87 |
| 59 | 3300013105 | Ga0157369_10708371 | Ga0157369_107083712 | 87 |
| 60 | 3300013297 | Ga0157378_11900389 | Ga0157378_119003891 | 87 |
| 61 | 3300013307 | Ga0157372_10023879 | Ga0157372_100238793 | 87 |
| 62 | 3300014969 | Ga0157376_10102075 | Ga0157376_101020753 | 87 |
| 63 | 3300025944 | Ga0207661_10118455 | Ga0207661_101184551 | 87 |
| 64 | 3300035111 | Ga0373923_0194919 | Ga0373923_0194919_611_919 | 87 |
| 65 | 3300046459 | Ga0495629_0050397 | Ga0495629_0050397_1146_1499 | 87 |
| 66 | 3300046472 | Ga0495580_0012519 | Ga0495580_0012519_5511_5819 | 87 |
| 67 | 3300046476 | Ga0495662_0206582 | Ga0495662_0206582_10_363 | 87 |
| 68 | 3300046499 | Ga0495594_0191331 | Ga0495594_0191331_179_487 | 87 |
| 69 | 3300046514 | Ga0495618_0439576 | Ga0495618_0439576_288_641 | 87 |
| 70 | 3300046531 | Ga0495665_0044581 | Ga0495665_0044581_1476_1784 | 87 |
| 71 | 3300046535 | Ga0495586_0058912 | Ga0495586_0058912_1681_2034 | 87 |
| 72 | 3300046536 | Ga0495587_0266164 | Ga0495587_0266164_217_525 | 87 |
| 73 | 3300046543 | Ga0495645_0941853 | Ga0495645_0941853_167_475 | 87 |
| 74 | 3300046642 | Ga0495634_0072118 | Ga0495634_0072118_1663_2016 | 87 |
| 75 | 3300046663 | Ga0495635_0811691 | Ga0495635_0811691_119_427 | 87 |
| 76 | 3300046678 | Ga0495599_0056864 | Ga0495599_0056864_143_451 | 87 |
| 77 | 3300046689 | Ga0495613_0041827 | Ga0495613_0041827_121_474 | 87 |
| 78 | 3300047319 | Ga0495674_0558358 | Ga0495674_0558358_34_387 | 87 |
| 79 | 3300047444 | Ga0495675_0061064 | Ga0495675_0061064_1008_1316 | 87 |
| 80 | 3300047471 | Ga0495684_0000857 | Ga0495684_0000857_21664_21972 | 87 |
| 81 | 3300047471 | Ga0495684_0834094 | Ga0495684_0834094_120_473 | 87 |
| 82 | 3300048088 | Ga0495602_0003952 | Ga0495602_0003952_8857_9165 | 87 |
| 83 | 3300048918 | Ga0496115_1383338 | Ga0496115_1383338_141_449 | 87 |
| 84 | 3300004800 | Ga0058861_11369154 | Ga0058861_113691541 | 88 |
| 85 | 3300005328 | Ga0070676_10249076 | Ga0070676_102490762 | 88 |
| 86 | 3300005328 | Ga0070676_10970500 | Ga0070676_109705002 | 88 |
| 87 | 3300005329 | Ga0070683_100523661 | Ga0070683_1005236611 | 88 |
| 88 | 3300005331 | Ga0070670_100785838 | Ga0070670_1007858382 | 88 |
| 89 | 3300005334 | Ga0068869_100024557 | Ga0068869_1000245573 | 88 |
| 90 | 3300005335 | Ga0070666_10181977 | Ga0070666_101819772 | 88 |
| 91 | 3300005336 | Ga0070680_100910927 | Ga0070680_1009109271 | 88 |
| 92 | 3300005337 | Ga0070682_100048850 | Ga0070682_1000488502 | 88 |
| 93 | 3300005337 | Ga0070682_100218569 | Ga0070682_1002185692 | 88 |
| 94 | 3300005339 | Ga0070660_100070274 | Ga0070660_1000702744 | 88 |
| 95 | 3300005339 | Ga0070660_100523189 | Ga0070660_1005231892 | 88 |
| 96 | 3300005344 | Ga0070661_100358962 | Ga0070661_1003589621 | 88 |
| 97 | 3300005353 | Ga0070669_100880602 | Ga0070669_1008806022 | 88 |
| 98 | 3300005355 | Ga0070671_100197440 | Ga0070671_1001974402 | 88 |
| 99 | 3300005355 | Ga0070671_101395222 | Ga0070671_1013952221 | 88 |
| 100 | 3300005356 | Ga0070674_100425022 | Ga0070674_1004250221 | 88 |
| 101 | 3300005356 | Ga0070674_102049180 | Ga0070674_1020491801 | 88 |
| 102 | 3300005365 | Ga0070688_100924617 | Ga0070688_1009246171 | 88 |
| 103 | 3300005366 | Ga0070659_100472612 | Ga0070659_1004726121 | 88 |
| 104 | 3300005367 | Ga0070667_100766083 | Ga0070667_1007660832 | 88 |
| 105 | 3300005367 | Ga0070667_100781135 | Ga0070667_1007811351 | 88 |
| 106 | 3300005434 | Ga0070709_10346212 | Ga0070709_103462121 | 88 |
| 107 | 3300005434 | Ga0070709_10519274 | Ga0070709_105192742 | 88 |
| 108 | 3300005436 | Ga0070713_100375697 | Ga0070713_1003756972 | 88 |
| 109 | 3300005439 | Ga0070711_100217934 | Ga0070711_1002179342 | 88 |
| 110 | 3300005439 | Ga0070711_101255223 | Ga0070711_1012552231 | 88 |
| 111 | 3300005455 | Ga0070663_100495742 | Ga0070663_1004957422 | 88 |
| 112 | 3300005456 | Ga0070678_100496150 | Ga0070678_1004961502 | 88 |
| 113 | 3300005457 | Ga0070662_100448347 | Ga0070662_1004483471 | 88 |
| 114 | 3300005458 | Ga0070681_10069406 | Ga0070681_100694063 | 88 |
| 115 | 3300005459 | Ga0068867_100313800 | Ga0068867_1003138001 | 88 |
| 116 | 3300005467 | Ga0070706_101855384 | Ga0070706_1018553841 | 88 |
| 117 | 3300005518 | Ga0070699_101657660 | Ga0070699_1016576602 | 88 |
| 118 | 3300005518 | Ga0070699_102174711 | Ga0070699_1021747111 | 88 |
| 119 | 3300005530 | Ga0070679_100448790 | Ga0070679_1004487902 | 88 |
| 120 | 3300005536 | Ga0070697_100642755 | Ga0070697_1006427552 | 88 |
| 121 | 3300005539 | Ga0068853_100290319 | Ga0068853_1002903192 | 88 |
| 122 | 3300005544 | Ga0070686_100375457 | Ga0070686_1003754571 | 88 |
| 123 | 3300005545 | Ga0070695_100254619 | Ga0070695_1002546191 | 88 |
| 124 | 3300005546 | Ga0070696_100042694 | Ga0070696_1000426944 | 88 |
| 125 | 3300005547 | Ga0070693_101516976 | Ga0070693_1015169761 | 88 |
| 126 | 3300005563 | Ga0068855_100567796 | Ga0068855_1005677961 | 88 |
| 127 | 3300005564 | Ga0070664_100047880 | Ga0070664_1000478803 | 88 |
| 128 | 3300005564 | Ga0070664_100197124 | Ga0070664_1001971241 | 88 |
| 129 | 3300005578 | Ga0068854_100364238 | Ga0068854_1003642382 | 88 |
| 130 | 3300005614 | Ga0068856_101270801 | Ga0068856_1012708012 | 88 |
| 131 | 3300005618 | Ga0068864_102273142 | Ga0068864_1022731422 | 88 |
| 132 | 3300005834 | Ga0068851_10044782 | Ga0068851_100447822 | 88 |
| 133 | 3300005842 | Ga0068858_100398171 | Ga0068858_1003981711 | 88 |
| 134 | 3300005843 | Ga0068860_100683613 | Ga0068860_1006836132 | 88 |
| 135 | 3300006173 | Ga0070716_100131299 | Ga0070716_1001312992 | 88 |
| 136 | 3300006175 | Ga0070712_100509330 | Ga0070712_1005093302 | 88 |
| 137 | 3300006237 | Ga0097621_100459589 | Ga0097621_1004595891 | 88 |
| 138 | 3300006358 | Ga0068871_100375722 | Ga0068871_1003757222 | 88 |
| 139 | 3300006358 | Ga0068871_100504253 | Ga0068871_1005042533 | 88 |
| 140 | 3300006846 | Ga0075430_100598846 | Ga0075430_1005988462 | 88 |
| 141 | 3300006852 | Ga0075433_10378414 | Ga0075433_103784142 | 88 |
| 142 | 3300006881 | Ga0068865_101037662 | Ga0068865_1010376622 | 88 |
| 143 | 3300006914 | Ga0075436_100139154 | Ga0075436_1001391542 | 88 |
| 144 | 3300009093 | Ga0105240_10360485 | Ga0105240_103604852 | 88 |
| 145 | 3300009148 | Ga0105243_11076075 | Ga0105243_110760752 | 88 |
| 146 | 3300009174 | Ga0105241_10363286 | Ga0105241_103632861 | 88 |
| 147 | 3300009174 | Ga0105241_11466631 | Ga0105241_114666311 | 88 |
| 148 | 3300009176 | Ga0105242_10051435 | Ga0105242_100514352 | 88 |
| 149 | 3300009176 | Ga0105242_10397304 | Ga0105242_103973041 | 88 |
| 150 | 3300009177 | Ga0105248_10492305 | Ga0105248_104923051 | 88 |
| 151 | 3300009545 | Ga0105237_10125841 | Ga0105237_101258412 | 88 |
| 152 | 3300009551 | Ga0105238_10131891 | Ga0105238_101318912 | 88 |
| 153 | 3300009551 | Ga0105238_10652211 | Ga0105238_106522111 | 88 |
| 154 | 3300013100 | Ga0157373_10491594 | Ga0157373_104915942 | 88 |
| 155 | 3300013296 | Ga0157374_10033336 | Ga0157374_100333364 | 88 |
| 156 | 3300013296 | Ga0157374_10985213 | Ga0157374_109852131 | 88 |
| 157 | 3300013307 | Ga0157372_10308763 | Ga0157372_103087632 | 88 |
| 158 | 3300014325 | Ga0163163_10055760 | Ga0163163_100557606 | 88 |
| 159 | 3300014497 | Ga0182008_10093691 | Ga0182008_100936912 | 88 |
| 160 | 3300014968 | Ga0157379_10021300 | Ga0157379_100213005 | 88 |
| 161 | 3300014969 | Ga0157376_11203344 | Ga0157376_112033442 | 88 |
| 162 | 3300014969 | Ga0157376_12332023 | Ga0157376_123320231 | 88 |
| 163 | 3300025899 | Ga0207642_10191118 | Ga0207642_101911182 | 88 |
| 164 | 3300025906 | Ga0207699_10288338 | Ga0207699_102883382 | 88 |
| 165 | 3300025906 | Ga0207699_10405806 | Ga0207699_104058062 | 88 |
| 166 | 3300025907 | Ga0207645_10813367 | Ga0207645_108133672 | 88 |
| 167 | 3300025911 | Ga0207654_10807812 | Ga0207654_108078122 | 88 |
| 168 | 3300025912 | Ga0207707_10214012 | Ga0207707_102140121 | 88 |
| 169 | 3300025912 | Ga0207707_11352295 | Ga0207707_113522951 | 88 |
| 170 | 3300025914 | Ga0207671_10018759 | Ga0207671_100187593 | 88 |
| 171 | 3300025917 | Ga0207660_10256378 | Ga0207660_102563782 | 88 |
| 172 | 3300025919 | Ga0207657_11029851 | Ga0207657_110298511 | 88 |
| 173 | 3300025923 | Ga0207681_11473599 | Ga0207681_114735991 | 88 |
| 174 | 3300025924 | Ga0207694_10530644 | Ga0207694_105306441 | 88 |
| 175 | 3300025927 | Ga0207687_10349851 | Ga0207687_103498512 | 88 |
| 176 | 3300025928 | Ga0207700_10321145 | Ga0207700_103211452 | 88 |
| 177 | 3300025933 | Ga0207706_10228815 | Ga0207706_102288152 | 88 |
| 178 | 3300025934 | Ga0207686_10503467 | Ga0207686_105034671 | 88 |
| 179 | 3300025935 | Ga0207709_11368914 | Ga0207709_113689142 | 88 |
| 180 | 3300025937 | Ga0207669_11486039 | Ga0207669_114860392 | 88 |
| 181 | 3300025938 | Ga0207704_10360957 | Ga0207704_103609572 | 88 |
| 182 | 3300025939 | Ga0207665_10049699 | Ga0207665_100496992 | 88 |
| 183 | 3300025942 | Ga0207689_10103446 | Ga0207689_101034461 | 88 |
| 184 | 3300025944 | Ga0207661_11969682 | Ga0207661_119696821 | 88 |
| 185 | 3300025945 | Ga0207679_10849910 | Ga0207679_108499102 | 88 |
| 186 | 3300025945 | Ga0207679_11762553 | Ga0207679_117625532 | 88 |
| 187 | 3300025981 | Ga0207640_11255864 | Ga0207640_112558642 | 88 |
| 188 | 3300025986 | Ga0207658_10202783 | Ga0207658_102027831 | 88 |
| 189 | 3300026035 | Ga0207703_11901474 | Ga0207703_119014741 | 88 |
| 190 | 3300026067 | Ga0207678_11132791 | Ga0207678_111327911 | 88 |
| 191 | 3300026088 | Ga0207641_11737870 | Ga0207641_117378702 | 88 |
| 192 | 3300026089 | Ga0207648_10455558 | Ga0207648_104555581 | 88 |
| 193 | 3300026095 | Ga0207676_12251298 | Ga0207676_122512981 | 88 |
| 194 | 3300026118 | Ga0207675_102401274 | Ga0207675_1024012741 | 88 |
| 195 | 3300026121 | Ga0207683_10357494 | Ga0207683_103574942 | 88 |
| 196 | 3300028379 | Ga0268266_10091695 | Ga0268266_100916953 | 88 |
| 197 | 3300028381 | Ga0268264_10499046 | Ga0268264_104990462 | 88 |
| 198 | 3300034820 | Ga0373959_0071115 | Ga0373959_0071115_115_423 | 88 |
| 199 | 3300035085 | Ga0373929_0066746 | Ga0373929_0066746_72_380 | 88 |
| 200 | 3300035091 | Ga0373951_0183454 | Ga0373951_0183454_263_571 | 88 |
| 201 | 3300035112 | Ga0373932_0020990 | Ga0373932_0020990_1390_1698 | 88 |
| 202 | 3300035691 | Ga0373931_0192462 | Ga0373931_0192462_626_934 | 88 |
| 203 | 3300042005 | Ga0439448_0164916 | Ga0439448_0164916_42_350 | 88 |
| 204 | 3300046684 | Ga0495669_0244138 | Ga0495669_0244138_114_422 | 88 |
| 205 | 3300048907 | Ga0496104_0880925 | Ga0496104_0880925_396_704 | 88 |
| 206 | 3300048909 | Ga0496106_0103693 | Ga0496106_0103693_893_1201 | 88 |
| 207 | 3300049572 | Ga0501036_0249162 | Ga0501036_0249162_1043_1354 | 88 |
| 208 | 3300050515 | nmdc:mga0a205_1473953_c1 | nmdc:mga0a205_1473953_c1_160_474 | 88 |
| 209 | 3300053077 | Ga0495601_0679260 | Ga0495601_0679260_10_285 | 88 |
| 210 | 3300009148 | Ga0105243_12189425 | Ga0105243_121894251 | 89 |
| 211 | 3300025935 | Ga0207709_11352463 | Ga0207709_113524631 | 89 |
| 212 | 3300005340 | Ga0070689_101394893 | Ga0070689_1013948932 | 90 |
| 213 | 3300005543 | Ga0070672_100325829 | Ga0070672_1003258292 | 90 |
| 214 | 3300006846 | Ga0075430_100953351 | Ga0075430_1009533512 | 90 |
| 215 | 3300006847 | Ga0075431_100098163 | Ga0075431_1000981633 | 90 |
| 216 | 3300006880 | Ga0075429_101320717 | Ga0075429_1013207172 | 90 |
| 217 | 3300009176 | Ga0105242_10973021 | Ga0105242_109730213 | 90 |
| 218 | 3300009177 | Ga0105248_10897660 | Ga0105248_108976602 | 90 |
| 219 | 3300011119 | Ga0105246_11690807 | Ga0105246_116908071 | 90 |
| 220 | 3300014745 | Ga0157377_11105782 | Ga0157377_111057821 | 90 |
| 221 | 3300017792 | Ga0163161_11028778 | Ga0163161_110287782 | 90 |
| 222 | 3300025936 | Ga0207670_10952303 | Ga0207670_109523031 | 90 |
| 223 | 3300025941 | Ga0207711_11736096 | Ga0207711_117360961 | 90 |
| 224 | 3300026089 | Ga0207648_11254702 | Ga0207648_112547022 | 90 |
| 225 | 3300035089 | Ga0373944_0319819 | Ga0373944_0319819_256_561 | 90 |
| 226 | 3300035691 | Ga0373931_0373679 | Ga0373931_0373679_387_692 | 90 |
| 227 | 3300048907 | Ga0496104_0157601 | Ga0496104_0157601_1136_1441 | 90 |
| 228 | 3300050509 | nmdc:mga0qj67_1176000_c1 | nmdc:mga0qj67_1176000_c1_244_561 | 90 |
| 229 | 3300050515 | nmdc:mga0a205_1089370_c1 | nmdc:mga0a205_1089370_c1_364_636 | 90 |
| 230 | 3300013104 | Ga0157370_11270668 | Ga0157370_112706682 | 91 |
| 231 | 3300048905 | Ga0496102_1473763 | Ga0496102_1473763_222_530 | 91 |
| 232 | 3300005331 | Ga0070670_101075007 | Ga0070670_1010750072 | 92 |
| 233 | 3300005364 | Ga0070673_100006804 | Ga0070673_1000068046 | 92 |
| 234 | 3300005445 | Ga0070708_101944575 | Ga0070708_1019445751 | 92 |
| 235 | 3300005840 | Ga0068870_10504701 | Ga0068870_105047012 | 92 |
| 236 | 3300006237 | Ga0097621_100637099 | Ga0097621_1006370991 | 92 |
| 237 | 3300009094 | Ga0111539_11363620 | Ga0111539_113636202 | 92 |
| 238 | 3300009553 | Ga0105249_10335901 | Ga0105249_103359012 | 92 |
| 239 | 3300013297 | Ga0157378_11229185 | Ga0157378_112291851 | 92 |
| 240 | 3300013306 | Ga0163162_10464635 | Ga0163162_104646351 | 92 |
| 241 | 3300014326 | Ga0157380_10152191 | Ga0157380_101521914 | 92 |
| 242 | 3300025960 | Ga0207651_10714991 | Ga0207651_107149912 | 92 |
| 243 | 3300009174 | Ga0105241_11623083 | Ga0105241_116230831 | 93 |
| 244 | 3300013296 | Ga0157374_11686371 | Ga0157374_116863712 | 93 |
| 245 | 3300013297 | Ga0157378_10853180 | Ga0157378_108531802 | 93 |
| 246 | 3300014325 | Ga0163163_10914610 | Ga0163163_109146102 | 93 |
| 247 | 3300046477 | Ga0495664_0330367 | Ga0495664_0330367_425_721 | 93 |
| 248 | 3300046516 | Ga0495628_0220674 | Ga0495628_0220674_573_869 | 93 |
| 249 | 3300046543 | Ga0495645_0033872 | Ga0495645_0033872_3280_3576 | 93 |
| 250 | 3300050514 | nmdc:mga08x19_853700_c1 | nmdc:mga08x19_853700_c1_244_531 | 93 |
| 251 | 3300005329 | Ga0070683_101623725 | Ga0070683_1016237251 | 94 |
| 252 | 3300009176 | Ga0105242_11404235 | Ga0105242_114042351 | 94 |
| 253 | 3300009177 | Ga0105248_10708219 | Ga0105248_107082191 | 94 |
| 254 | 3300013105 | Ga0157369_11486042 | Ga0157369_114860421 | 94 |
| 255 | 3300013297 | Ga0157378_10338716 | Ga0157378_103387161 | 94 |
| 256 | 3300013308 | Ga0157375_12820810 | Ga0157375_128208102 | 94 |
| 257 | 3300014325 | Ga0163163_10423745 | Ga0163163_104237453 | 94 |
| 258 | 3300014969 | Ga0157376_11695616 | Ga0157376_116956161 | 94 |
| 259 | 3300046663 | Ga0495635_0359444 | Ga0495635_0359444_625_939 | 94 |
| 260 | 3300048907 | Ga0496104_0929121 | Ga0496104_0929121_474_764 | 94 |
| 261 | 3300048915 | Ga0496112_0573915 | Ga0496112_0573915_544_837 | 94 |
| 262 | 3300053085 | Ga0495619_1100382 | Ga0495619_1100382_223_513 | 94 |
| 263 | 3300021377 | Ga0213874_10379101 | Ga0213874_103791011 | 95 |
| 264 | 3300039450 | Ga0436363_1666979 | Ga0436363_1666979_471_779 | 95 |
| 265 | 3300005618 | Ga0068864_101014084 | Ga0068864_1010140841 | 96 |
| 266 | 3300025960 | Ga0207651_11483675 | Ga0207651_114836751 | 96 |
| 267 | 3300045051 | Ga0451576_2113054 | Ga0451576_2113054_174_473 | 96 |
| 268 | 3300007076 | Ga0075435_100304546 | Ga0075435_1003045461 | 97 |
| 269 | 3300009177 | Ga0105248_11144345 | Ga0105248_111443452 | 97 |
| 270 | 3300013104 | Ga0157370_11426463 | Ga0157370_114264631 | 97 |
| 271 | 3300014969 | Ga0157376_11089933 | Ga0157376_110899332 | 97 |
| 272 | 3300035695 | Ga0373927_0889707 | Ga0373927_0889707_117_425 | 97 |
| 273 | 3300045051 | Ga0451576_0814453 | Ga0451576_0814453_486_785 | 97 |
| 274 | 3300045051 | Ga0451576_1172002 | Ga0451576_1172002_265_573 | 97 |
| 275 | 3300046472 | Ga0495580_0080149 | Ga0495580_0080149_717_1025 | 97 |
| 276 | 3300046476 | Ga0495662_0589492 | Ga0495662_0589492_121_429 | 97 |
| 277 | 3300046531 | Ga0495665_0574180 | Ga0495665_0574180_152_460 | 97 |
| 278 | 3300046689 | Ga0495613_0053407 | Ga0495613_0053407_121_474 | 97 |
| 279 | 3300047315 | Ga0495581_0315294 | Ga0495581_0315294_329_637 | 97 |
| 280 | 3300048089 | Ga0495614_0509720 | Ga0495614_0509720_209_562 | 97 |
| 281 | 3300050513 | nmdc:mga0rr50_981600_c1 | nmdc:mga0rr50_981600_c1_352_660 | 97 |
| 282 | 3300005329 | Ga0070683_100068864 | Ga0070683_1000688642 | 98 |
| 283 | 3300005336 | Ga0070680_101361144 | Ga0070680_1013611441 | 98 |
| 284 | 3300005436 | Ga0070713_100535431 | Ga0070713_1005354311 | 98 |
| 285 | 3300005467 | Ga0070706_100431317 | Ga0070706_1004313172 | 98 |
| 286 | 3300005530 | Ga0070679_100359986 | Ga0070679_1003599861 | 98 |
| 287 | 3300005535 | Ga0070684_100044513 | Ga0070684_1000445133 | 98 |
| 288 | 3300005539 | Ga0068853_101530231 | Ga0068853_1015302311 | 98 |
| 289 | 3300005539 | Ga0068853_101979889 | Ga0068853_1019798891 | 98 |
| 290 | 3300006028 | Ga0070717_11460640 | Ga0070717_114606402 | 98 |
| 291 | 3300006173 | Ga0070716_100561081 | Ga0070716_1005610812 | 98 |
| 292 | 3300006358 | Ga0068871_101074000 | Ga0068871_1010740002 | 98 |
| 293 | 3300007076 | Ga0075435_101336512 | Ga0075435_1013365122 | 98 |
| 294 | 3300009093 | Ga0105240_10001086 | Ga0105240_1000108617 | 98 |
| 295 | 3300009545 | Ga0105237_10453793 | Ga0105237_104537932 | 98 |
| 296 | 3300009551 | Ga0105238_10393564 | Ga0105238_103935643 | 98 |
| 297 | 3300013100 | Ga0157373_10441017 | Ga0157373_104410172 | 98 |
| 298 | 3300013105 | Ga0157369_10161448 | Ga0157369_101614483 | 98 |
| 299 | 3300020078 | Ga0206352_10258107 | Ga0206352_102581072 | 98 |
| 300 | 3300020081 | Ga0206354_10048515 | Ga0206354_100485151 | 98 |
| 301 | 3300025910 | Ga0207684_10709551 | Ga0207684_107095511 | 98 |
| 302 | 3300025913 | Ga0207695_10005447 | Ga0207695_100054477 | 98 |
| 303 | 3300025921 | Ga0207652_10305994 | Ga0207652_103059941 | 98 |
| 304 | 3300025924 | Ga0207694_10265192 | Ga0207694_102651922 | 98 |
| 305 | 3300025944 | Ga0207661_10039258 | Ga0207661_100392587 | 98 |
| 306 | 3300026116 | Ga0207674_11064209 | Ga0207674_110642091 | 98 |
| 307 | 3300035083 | Ga0373926_0015059 | Ga0373926_0015059_513_830 | 98 |
| 308 | 3300035116 | Ga0373945_0099518 | Ga0373945_0099518_350_667 | 98 |
| 309 | 3300035170 | Ga0373943_0018141 | Ga0373943_0018141_2500_2817 | 98 |
| 310 | 3300035171 | Ga0373946_0089599 | Ga0373946_0089599_488_805 | 98 |
| 311 | 3300035692 | Ga0373935_0390871 | Ga0373935_0390871_159_476 | 98 |
| 312 | 3300035692 | Ga0373935_0541016 | Ga0373935_0541016_497_808 | 98 |
| 313 | 3300035695 | Ga0373927_0006221 | Ga0373927_0006221_4691_5008 | 98 |
| 314 | 3300035695 | Ga0373927_0724340 | Ga0373927_0724340_269_583 | 98 |
| 315 | 3300035725 | Ga0373947_0937818 | Ga0373947_0937818_19_333 | 98 |
| 316 | 3300037068 | Ga0373925_0000062 | Ga0373925_0000062_108575_108892 | 98 |
| 317 | 3300045051 | Ga0451576_0381180 | Ga0451576_0381180_858_1169 | 98 |
| 318 | 3300045051 | Ga0451576_0430924 | Ga0451576_0430924_594_905 | 98 |
| 319 | 3300046472 | Ga0495580_0065269 | Ga0495580_0065269_2185_2499 | 98 |
| 320 | 3300046472 | Ga0495580_0259864 | Ga0495580_0259864_703_1014 | 98 |
| 321 | 3300046477 | Ga0495664_0149855 | Ga0495664_0149855_417_728 | 98 |
| 322 | 3300046514 | Ga0495618_0916259 | Ga0495618_0916259_36_347 | 98 |
| 323 | 3300046516 | Ga0495628_0216984 | Ga0495628_0216984_861_1166 | 98 |
| 324 | 3300046523 | Ga0495644_0248175 | Ga0495644_0248175_106_417 | 98 |
| 325 | 3300046529 | Ga0495652_0842736 | Ga0495652_0842736_42_347 | 98 |
| 326 | 3300046531 | Ga0495665_0061982 | Ga0495665_0061982_1565_1882 | 98 |
| 327 | 3300046533 | Ga0495640_0544429 | Ga0495640_0544429_163_468 | 98 |
| 328 | 3300046543 | Ga0495645_0165310 | Ga0495645_0165310_829_1140 | 98 |
| 329 | 3300046559 | Ga0495667_0973818 | Ga0495667_0973818_163_468 | 98 |
| 330 | 3300046679 | Ga0495623_0598697 | Ga0495623_0598697_184_489 | 98 |
| 331 | 3300046690 | Ga0495624_0151765 | Ga0495624_0151765_590_907 | 98 |
| 332 | 3300046690 | Ga0495624_0784292 | Ga0495624_0784292_104_415 | 98 |
| 333 | 3300047317 | Ga0495604_0709181 | Ga0495604_0709181_175_480 | 98 |
| 334 | 3300047318 | Ga0495636_0231289 | Ga0495636_0231289_211_522 | 98 |
| 335 | 3300047319 | Ga0495674_0062623 | Ga0495674_0062623_1395_1706 | 98 |
| 336 | 3300047319 | Ga0495674_0942921 | Ga0495674_0942921_299_604 | 98 |
| 337 | 3300047471 | Ga0495684_0177030 | Ga0495684_0177030_558_863 | 98 |
| 338 | 3300047471 | Ga0495684_0236328 | Ga0495684_0236328_182_493 | 98 |
| 339 | 3300047471 | Ga0495684_0249997 | Ga0495684_0249997_481_792 | 98 |
| 340 | 3300048089 | Ga0495614_0223078 | Ga0495614_0223078_149_460 | 98 |
| 341 | 3300005340 | Ga0070689_100492711 | Ga0070689_1004927112 | 99 |
| 342 | 3300005353 | Ga0070669_101931092 | Ga0070669_1019310921 | 99 |
| 343 | 3300005354 | Ga0070675_101437403 | Ga0070675_1014374032 | 99 |
| 344 | 3300005355 | Ga0070671_100664647 | Ga0070671_1006646471 | 99 |
| 345 | 3300005548 | Ga0070665_100027769 | Ga0070665_1000277695 | 99 |
| 346 | 3300005548 | Ga0070665_100860193 | Ga0070665_1008601931 | 99 |
| 347 | 3300005548 | Ga0070665_101138278 | Ga0070665_1011382782 | 99 |
| 348 | 3300005564 | Ga0070664_101377021 | Ga0070664_1013770212 | 99 |
| 349 | 3300005615 | Ga0070702_101541208 | Ga0070702_1015412081 | 99 |
| 350 | 3300005618 | Ga0068864_100687298 | Ga0068864_1006872982 | 99 |
| 351 | 3300005840 | Ga0068870_10417689 | Ga0068870_104176892 | 99 |
| 352 | 3300006237 | Ga0097621_100668127 | Ga0097621_1006681271 | 99 |
| 353 | 3300006358 | Ga0068871_100687296 | Ga0068871_1006872961 | 99 |
| 354 | 3300009177 | Ga0105248_10197007 | Ga0105248_101970074 | 99 |
| 355 | 3300013306 | Ga0163162_11037518 | Ga0163162_110375181 | 99 |
| 356 | 3300013308 | Ga0157375_10149587 | Ga0157375_101495871 | 99 |
| 357 | 3300013308 | Ga0157375_10498997 | Ga0157375_104989972 | 99 |
| 358 | 3300014325 | Ga0163163_10151255 | Ga0163163_101512555 | 99 |
| 359 | 3300014969 | Ga0157376_10439747 | Ga0157376_104397473 | 99 |
| 360 | 3300019179 | Ga0184593_119779 | Ga0184593_1197792 | 99 |
| 361 | 3300025923 | Ga0207681_11567699 | Ga0207681_115676992 | 99 |
| 362 | 3300025925 | Ga0207650_11360677 | Ga0207650_113606772 | 99 |
| 363 | 3300025936 | Ga0207670_10541170 | Ga0207670_105411702 | 99 |
| 364 | 3300025942 | Ga0207689_10633341 | Ga0207689_106333411 | 99 |
| 365 | 3300026095 | Ga0207676_10751789 | Ga0207676_107517892 | 99 |
| 366 | 3300030760 | Ga0265762_1003341 | Ga0265762_10033415 | 99 |
| 367 | 3300030879 | Ga0265765_1001004 | Ga0265765_10010042 | 99 |
| 368 | 3300031010 | Ga0265771_1019559 | Ga0265771_10195591 | 99 |
| 369 | 3300033547 | Ga0316212_1052520 | Ga0316212_10525202 | 99 |
| 370 | 3300035692 | Ga0373935_0342332 | Ga0373935_0342332_662_970 | 99 |
| 371 | 3300006175 | Ga0070712_101611791 | Ga0070712_1016117911 | 100 |
| 372 | 3300006852 | Ga0075433_10214882 | Ga0075433_102148822 | 100 |
| 373 | 3300006871 | Ga0075434_100029427 | Ga0075434_1000294278 | 100 |
| 374 | 3300007076 | Ga0075435_101105522 | Ga0075435_1011055221 | 100 |
| 375 | 3300009147 | Ga0114129_10718704 | Ga0114129_107187042 | 100 |
| 376 | 3300009147 | Ga0114129_11302412 | Ga0114129_113024122 | 100 |
| 377 | 3300009553 | Ga0105249_11080558 | Ga0105249_110805582 | 100 |
| 378 | 3300010375 | Ga0105239_10606956 | Ga0105239_106069562 | 100 |
| 379 | 3300013307 | Ga0157372_11588848 | Ga0157372_115888481 | 100 |
| 380 | 3300019182 | Ga0184598_142313 | Ga0184598_1423131 | 100 |
| 381 | 3300019183 | Ga0184601_123318 | Ga0184601_1233181 | 100 |
| 382 | 3300022730 | Ga0224570_103130 | Ga0224570_1031302 | 100 |
| 383 | 3300024225 | Ga0224572_1014433 | Ga0224572_10144332 | 100 |
| 384 | 3300024227 | Ga0228598_1001630 | Ga0228598_10016306 | 100 |
| 385 | 3300028017 | Ga0265356_1007140 | Ga0265356_10071402 | 100 |
| 386 | 3300028800 | Ga0265338_10075035 | Ga0265338_100750355 | 100 |
| 387 | 3300030878 | Ga0265770_1143361 | Ga0265770_11433611 | 100 |
| 388 | 3300031090 | Ga0265760_10002361 | Ga0265760_100023615 | 100 |
| 389 | 3300031090 | Ga0265760_10383501 | Ga0265760_103835011 | 100 |
| 390 | 3300035118 | Ga0373954_0464084 | Ga0373954_0464084_141_449 | 100 |
| 391 | 3300035410 | Ga0373924_0233246 | Ga0373924_0233246_402_719 | 100 |
| 392 | 3300035724 | Ga0373933_0805128 | Ga0373933_0805128_74_382 | 100 |
| 393 | 3300036401 | Ga0373937_0212836 | Ga0373937_0212836_882_1190 | 100 |
| 394 | 3300036401 | Ga0373937_0225840 | Ga0373937_0225840_375_692 | 100 |
| 395 | 3300037068 | Ga0373925_0842374 | Ga0373925_0842374_409_726 | 100 |
| 396 | 3300046517 | Ga0495630_1148600 | Ga0495630_1148600_232_540 | 100 |
| 397 | 3300050507 | nmdc:mga05p37_1126961_c1 | nmdc:mga05p37_1126961_c1_68_388 | 100 |
| 398 | 3300050512 | nmdc:mga0n895_27483_c1 | nmdc:mga0n895_27483_c1_4838_5158 | 100 |
| 399 | 3300050513 | nmdc:mga0rr50_1205434_c1 | nmdc:mga0rr50_1205434_c1_173_493 | 100 |
| 400 | 3300050515 | nmdc:mga0a205_152273_c1 | nmdc:mga0a205_152273_c1_109_429 | 100 |
| 401 | 3300053085 | Ga0495619_0833629 | Ga0495619_0833629_155_472 | 100 |
| 402 | 3300060353 | Ga0501082_0000185 | Ga0501082_0000185_26703_27020 | 100 |
| 403 | 3300004800 | Ga0058861_11845831 | Ga0058861_118458311 | 101 |
| 404 | 3300004803 | Ga0058862_12741009 | Ga0058862_127410093 | 101 |
| 405 | 3300005329 | Ga0070683_100039816 | Ga0070683_1000398165 | 101 |
| 406 | 3300005338 | Ga0068868_100589331 | Ga0068868_1005893311 | 101 |
| 407 | 3300005434 | Ga0070709_10105097 | Ga0070709_101050972 | 101 |
| 408 | 3300005436 | Ga0070713_101798182 | Ga0070713_1017981821 | 101 |
| 409 | 3300005437 | Ga0070710_10011181 | Ga0070710_100111815 | 101 |
| 410 | 3300005439 | Ga0070711_100000520 | Ga0070711_10000052012 | 101 |
| 411 | 3300005535 | Ga0070684_100074273 | Ga0070684_1000742733 | 101 |
| 412 | 3300005535 | Ga0070684_100678742 | Ga0070684_1006787421 | 101 |
| 413 | 3300005536 | Ga0070697_100907664 | Ga0070697_1009076641 | 101 |
| 414 | 3300005548 | Ga0070665_100735307 | Ga0070665_1007353072 | 101 |
| 415 | 3300005617 | Ga0068859_100672367 | Ga0068859_1006723672 | 101 |
| 416 | 3300005618 | Ga0068864_100367480 | Ga0068864_1003674802 | 101 |
| 417 | 3300005841 | Ga0068863_100087919 | Ga0068863_1000879196 | 101 |
| 418 | 3300005841 | Ga0068863_100635780 | Ga0068863_1006357802 | 101 |
| 419 | 3300005844 | Ga0068862_101996394 | Ga0068862_1019963941 | 101 |
| 420 | 3300006163 | Ga0070715_10005313 | Ga0070715_100053135 | 101 |
| 421 | 3300006173 | Ga0070716_100030778 | Ga0070716_1000307785 | 101 |
| 422 | 3300006175 | Ga0070712_100002059 | Ga0070712_1000020596 | 101 |
| 423 | 3300006237 | Ga0097621_100142660 | Ga0097621_1001426601 | 101 |
| 424 | 3300006237 | Ga0097621_100229646 | Ga0097621_1002296462 | 101 |
| 425 | 3300006931 | Ga0097620_100672420 | Ga0097620_1006724202 | 101 |
| 426 | 3300009174 | Ga0105241_11171848 | Ga0105241_111718482 | 101 |
| 427 | 3300009176 | Ga0105242_11644258 | Ga0105242_116442582 | 101 |
| 428 | 3300009177 | Ga0105248_10138076 | Ga0105248_101380763 | 101 |
| 429 | 3300009177 | Ga0105248_10989905 | Ga0105248_109899051 | 101 |
| 430 | 3300009177 | Ga0105248_11821069 | Ga0105248_118210692 | 101 |
| 431 | 3300010375 | Ga0105239_13335393 | Ga0105239_133353931 | 101 |
| 432 | 3300013296 | Ga0157374_10083489 | Ga0157374_100834893 | 101 |
| 433 | 3300013297 | Ga0157378_10995308 | Ga0157378_109953082 | 101 |
| 434 | 3300013297 | Ga0157378_11186195 | Ga0157378_111861952 | 101 |
| 435 | 3300013306 | Ga0163162_10571355 | Ga0163162_105713552 | 101 |
| 436 | 3300013306 | Ga0163162_10915240 | Ga0163162_109152401 | 101 |
| 437 | 3300013307 | Ga0157372_11586517 | Ga0157372_115865171 | 101 |
| 438 | 3300013308 | Ga0157375_10371864 | Ga0157375_103718642 | 101 |
| 439 | 3300013308 | Ga0157375_10720361 | Ga0157375_107203612 | 101 |
| 440 | 3300014325 | Ga0163163_10028533 | Ga0163163_100285333 | 101 |
| 441 | 3300014325 | Ga0163163_10062121 | Ga0163163_100621214 | 101 |
| 442 | 3300014745 | Ga0157377_10226594 | Ga0157377_102265943 | 101 |
| 443 | 3300014968 | Ga0157379_10752213 | Ga0157379_107522132 | 101 |
| 444 | 3300014969 | Ga0157376_10800372 | Ga0157376_108003722 | 101 |
| 445 | 3300017792 | Ga0163161_11029243 | Ga0163161_110292431 | 101 |
| 446 | 3300025898 | Ga0207692_10017532 | Ga0207692_100175325 | 101 |
| 447 | 3300025905 | Ga0207685_10080404 | Ga0207685_100804041 | 101 |
| 448 | 3300025906 | Ga0207699_10060684 | Ga0207699_100606842 | 101 |
| 449 | 3300025911 | Ga0207654_10937484 | Ga0207654_109374841 | 101 |
| 450 | 3300025915 | Ga0207693_10000152 | Ga0207693_1000015213 | 101 |
| 451 | 3300025916 | Ga0207663_10005842 | Ga0207663_100058422 | 101 |
| 452 | 3300025921 | Ga0207652_11616632 | Ga0207652_116166322 | 101 |
| 453 | 3300025927 | Ga0207687_11749153 | Ga0207687_117491531 | 101 |
| 454 | 3300025933 | Ga0207706_10985158 | Ga0207706_109851581 | 101 |
| 455 | 3300025939 | Ga0207665_10045369 | Ga0207665_100453695 | 101 |
| 456 | 3300025939 | Ga0207665_10235664 | Ga0207665_102356642 | 101 |
| 457 | 3300025941 | Ga0207711_10118781 | Ga0207711_101187813 | 101 |
| 458 | 3300025960 | Ga0207651_11251163 | Ga0207651_112511632 | 101 |
| 459 | 3300026023 | Ga0207677_10506658 | Ga0207677_105066582 | 101 |
| 460 | 3300026035 | Ga0207703_10238923 | Ga0207703_102389232 | 101 |
| 461 | 3300026088 | Ga0207641_10010793 | Ga0207641_100107933 | 101 |
| 462 | 3300026088 | Ga0207641_10555523 | Ga0207641_105555232 | 101 |
| 463 | 3300026089 | Ga0207648_10736276 | Ga0207648_107362762 | 101 |
| 464 | 3300026095 | Ga0207676_10313197 | Ga0207676_103131971 | 101 |
| 465 | 3300026095 | Ga0207676_10684184 | Ga0207676_106841842 | 101 |
| 466 | 3300026116 | Ga0207674_11092189 | Ga0207674_110921892 | 101 |
| 467 | 3300028016 | Ga0265354_1013991 | Ga0265354_10139911 | 101 |
| 468 | 3300028380 | Ga0268265_11748079 | Ga0268265_117480791 | 101 |
| 469 | 3300030878 | Ga0265770_1003487 | Ga0265770_10034872 | 101 |
| 470 | 3300030878 | Ga0265770_1111501 | Ga0265770_11115011 | 101 |
| 471 | 3300030879 | Ga0265765_1024717 | Ga0265765_10247171 | 101 |
| 472 | 3300031010 | Ga0265771_1007422 | Ga0265771_10074222 | 101 |
| 473 | 3300031090 | Ga0265760_10003029 | Ga0265760_100030292 | 101 |
| 474 | 3300035111 | Ga0373923_0134470 | Ga0373923_0134470_246_560 | 101 |
| 475 | 3300035118 | Ga0373954_0329331 | Ga0373954_0329331_204_518 | 101 |
| 476 | 3300035691 | Ga0373931_0162746 | Ga0373931_0162746_473_787 | 101 |
| 477 | 3300035695 | Ga0373927_0273285 | Ga0373927_0273285_336_650 | 101 |
| 478 | 3300035725 | Ga0373947_0239250 | Ga0373947_0239250_391_705 | 101 |
| 479 | 3300036401 | Ga0373937_0186600 | Ga0373937_0186600_1532_1846 | 101 |
| 480 | 3300036401 | Ga0373937_0540504 | Ga0373937_0540504_489_800 | 101 |
| 481 | 3300037068 | Ga0373925_0131424 | Ga0373925_0131424_787_1101 | 101 |
| 482 | 3300039438 | Ga0436360_0068673 | Ga0436360_0068673_729_1037 | 101 |
| 483 | 3300046472 | Ga0495580_0935509 | Ga0495580_0935509_174_488 | 101 |
| 484 | 3300046473 | Ga0495582_0437659 | Ga0495582_0437659_219_539 | 101 |
| 485 | 3300046476 | Ga0495662_0195247 | Ga0495662_0195247_65_379 | 101 |
| 486 | 3300046499 | Ga0495594_0416483 | Ga0495594_0416483_351_665 | 101 |
| 487 | 3300046517 | Ga0495630_0587556 | Ga0495630_0587556_459_785 | 101 |
| 488 | 3300046517 | Ga0495630_0740166 | Ga0495630_0740166_16_330 | 101 |
| 489 | 3300046526 | Ga0495666_0111128 | Ga0495666_0111128_724_1038 | 101 |
| 490 | 3300046529 | Ga0495652_0280711 | Ga0495652_0280711_817_1131 | 101 |
| 491 | 3300046536 | Ga0495587_0118332 | Ga0495587_0118332_121_435 | 101 |
| 492 | 3300046536 | Ga0495587_0825700 | Ga0495587_0825700_29_340 | 101 |
| 493 | 3300046559 | Ga0495667_0716036 | Ga0495667_0716036_72_386 | 101 |
| 494 | 3300046642 | Ga0495634_0603534 | Ga0495634_0603534_126_440 | 101 |
| 495 | 3300046663 | Ga0495635_0963482 | Ga0495635_0963482_151_465 | 101 |
| 496 | 3300046679 | Ga0495623_0303097 | Ga0495623_0303097_37_351 | 101 |
| 497 | 3300047315 | Ga0495581_0140081 | Ga0495581_0140081_946_1260 | 101 |
| 498 | 3300047317 | Ga0495604_0510088 | Ga0495604_0510088_424_738 | 101 |
| 499 | 3300047319 | Ga0495674_0381587 | Ga0495674_0381587_634_948 | 101 |
| 500 | 3300047319 | Ga0495674_0920529 | Ga0495674_0920529_132_446 | 101 |
| 501 | 3300047321 | Ga0495676_0211708 | Ga0495676_0211708_567_881 | 101 |
| 502 | 3300047444 | Ga0495675_0143762 | Ga0495675_0143762_161_475 | 101 |
| 503 | 3300047471 | Ga0495684_0009288 | Ga0495684_0009288_3894_4208 | 101 |
| 504 | 3300048088 | Ga0495602_0847665 | Ga0495602_0847665_278_592 | 101 |
| 505 | 3300048915 | Ga0496112_0512913 | Ga0496112_0512913_519_833 | 101 |
| 506 | 3300048916 | Ga0496113_1356065 | Ga0496113_1356065_14_328 | 101 |
| 507 | 3300048917 | Ga0496114_0914126 | Ga0496114_0914126_209_523 | 101 |
| 508 | 3300048918 | Ga0496115_0183146 | Ga0496115_0183146_732_1046 | 101 |
| 509 | 3300048918 | Ga0496115_1422423 | Ga0496115_1422423_36_350 | 101 |
| 510 | 3300005330 | Ga0070690_100117501 | Ga0070690_1001175011 | 102 |
| 511 | 3300005335 | Ga0070666_10089856 | Ga0070666_100898565 | 102 |
| 512 | 3300005338 | Ga0068868_100786322 | Ga0068868_1007863221 | 102 |
| 513 | 3300005343 | Ga0070687_101380521 | Ga0070687_1013805211 | 102 |
| 514 | 3300005354 | Ga0070675_101708980 | Ga0070675_1017089802 | 102 |
| 515 | 3300005355 | Ga0070671_100093748 | Ga0070671_1000937481 | 102 |
| 516 | 3300005364 | Ga0070673_100109751 | Ga0070673_1001097511 | 102 |
| 517 | 3300005364 | Ga0070673_100333700 | Ga0070673_1003337003 | 102 |
| 518 | 3300005367 | Ga0070667_100013365 | Ga0070667_1000133657 | 102 |
| 519 | 3300005459 | Ga0068867_101339265 | Ga0068867_1013392652 | 102 |
| 520 | 3300005543 | Ga0070672_100056579 | Ga0070672_1000565791 | 102 |
| 521 | 3300005548 | Ga0070665_101713167 | Ga0070665_1017131672 | 102 |
| 522 | 3300005564 | Ga0070664_100028307 | Ga0070664_1000283074 | 102 |
| 523 | 3300005617 | Ga0068859_100082419 | Ga0068859_1000824195 | 102 |
| 524 | 3300005617 | Ga0068859_100464785 | Ga0068859_1004647852 | 102 |
| 525 | 3300005618 | Ga0068864_100104402 | Ga0068864_1001044022 | 102 |
| 526 | 3300005841 | Ga0068863_100049894 | Ga0068863_1000498943 | 102 |
| 527 | 3300005841 | Ga0068863_100251686 | Ga0068863_1002516862 | 102 |
| 528 | 3300005842 | Ga0068858_100046861 | Ga0068858_1000468612 | 102 |
| 529 | 3300005842 | Ga0068858_100224572 | Ga0068858_1002245722 | 102 |
| 530 | 3300005842 | Ga0068858_102000777 | Ga0068858_1020007771 | 102 |
| 531 | 3300006237 | Ga0097621_100027492 | Ga0097621_1000274925 | 102 |
| 532 | 3300006237 | Ga0097621_100136306 | Ga0097621_1001363063 | 102 |
| 533 | 3300006358 | Ga0068871_100173527 | Ga0068871_1001735272 | 102 |
| 534 | 3300006358 | Ga0068871_100529832 | Ga0068871_1005298322 | 102 |
| 535 | 3300006844 | Ga0075428_100027054 | Ga0075428_1000270543 | 102 |
| 536 | 3300006847 | Ga0075431_100077674 | Ga0075431_1000776743 | 102 |
| 537 | 3300006871 | Ga0075434_100242336 | Ga0075434_1002423361 | 102 |
| 538 | 3300006871 | Ga0075434_100664540 | Ga0075434_1006645401 | 102 |
| 539 | 3300006931 | Ga0097620_100082412 | Ga0097620_1000824122 | 102 |
| 540 | 3300006931 | Ga0097620_100464717 | Ga0097620_1004647172 | 102 |
| 541 | 3300009094 | Ga0111539_10635405 | Ga0111539_106354052 | 102 |
| 542 | 3300009148 | Ga0105243_10846275 | Ga0105243_108462752 | 102 |
| 543 | 3300009177 | Ga0105248_10046855 | Ga0105248_100468557 | 102 |
| 544 | 3300011119 | Ga0105246_10435614 | Ga0105246_104356141 | 102 |
| 545 | 3300013297 | Ga0157378_12657595 | Ga0157378_126575951 | 102 |
| 546 | 3300013306 | Ga0163162_10013797 | Ga0163162_100137978 | 102 |
| 547 | 3300013306 | Ga0163162_10481455 | Ga0163162_104814553 | 102 |
| 548 | 3300013308 | Ga0157375_10013753 | Ga0157375_100137537 | 102 |
| 549 | 3300013308 | Ga0157375_13754339 | Ga0157375_137543391 | 102 |
| 550 | 3300014325 | Ga0163163_10096938 | Ga0163163_100969382 | 102 |
| 551 | 3300014968 | Ga0157379_11136771 | Ga0157379_111367711 | 102 |
| 552 | 3300017792 | Ga0163161_10161597 | Ga0163161_101615973 | 102 |
| 553 | 3300025315 | Ga0207697_10199031 | Ga0207697_101990312 | 102 |
| 554 | 3300025903 | Ga0207680_10038192 | Ga0207680_100381921 | 102 |
| 555 | 3300025918 | Ga0207662_11315465 | Ga0207662_113154651 | 102 |
| 556 | 3300025925 | Ga0207650_10231915 | Ga0207650_102319153 | 102 |
| 557 | 3300025926 | Ga0207659_10516474 | Ga0207659_105164741 | 102 |
| 558 | 3300025931 | Ga0207644_10248625 | Ga0207644_102486251 | 102 |
| 559 | 3300025935 | Ga0207709_10825044 | Ga0207709_108250442 | 102 |
| 560 | 3300025936 | Ga0207670_11212429 | Ga0207670_112124292 | 102 |
| 561 | 3300025940 | Ga0207691_10039241 | Ga0207691_100392412 | 102 |
| 562 | 3300025941 | Ga0207711_10490985 | Ga0207711_104909852 | 102 |
| 563 | 3300025945 | Ga0207679_10259964 | Ga0207679_102599641 | 102 |
| 564 | 3300025960 | Ga0207651_10230206 | Ga0207651_102302062 | 102 |
| 565 | 3300025960 | Ga0207651_10233078 | Ga0207651_102330782 | 102 |
| 566 | 3300025986 | Ga0207658_10084841 | Ga0207658_100848411 | 102 |
| 567 | 3300026023 | Ga0207677_10569022 | Ga0207677_105690222 | 102 |
| 568 | 3300026035 | Ga0207703_10066023 | Ga0207703_100660231 | 102 |
| 569 | 3300026088 | Ga0207641_10473408 | Ga0207641_104734082 | 102 |
| 570 | 3300026089 | Ga0207648_10225146 | Ga0207648_102251462 | 102 |
| 571 | 3300026095 | Ga0207676_10165367 | Ga0207676_101653672 | 102 |
| 572 | 3300027907 | Ga0207428_10420456 | Ga0207428_104204562 | 102 |
| 573 | 3300035120 | Ga0373957_0133947 | Ga0373957_0133947_409_726 | 102 |
| 574 | 3300035172 | Ga0373955_0516756 | Ga0373955_0516756_271_585 | 102 |
| 575 | 3300046454 | Ga0495592_0012532 | Ga0495592_0012532_4587_4904 | 102 |
| 576 | 3300046455 | Ga0495603_0538491 | Ga0495603_0538491_40_351 | 102 |
| 577 | 3300046462 | Ga0495651_0165039 | Ga0495651_0165039_840_1157 | 102 |
| 578 | 3300046472 | Ga0495580_0653061 | Ga0495580_0653061_352_663 | 102 |
| 579 | 3300046473 | Ga0495582_0841351 | Ga0495582_0841351_21_332 | 102 |
| 580 | 3300046516 | Ga0495628_0273852 | Ga0495628_0273852_586_903 | 102 |
| 581 | 3300046517 | Ga0495630_0608303 | Ga0495630_0608303_69_380 | 102 |
| 582 | 3300046526 | Ga0495666_0234317 | Ga0495666_0234317_226_537 | 102 |
| 583 | 3300046642 | Ga0495634_0296348 | Ga0495634_0296348_310_621 | 102 |
| 584 | 3300046683 | Ga0495658_0064355 | Ga0495658_0064355_1648_1959 | 102 |
| 585 | 3300047471 | Ga0495684_0289653 | Ga0495684_0289653_176_487 | 102 |
| 586 | 3300050509 | nmdc:mga0qj67_303938_c1 | nmdc:mga0qj67_303938_c1_154_465 | 102 |
| 587 | 3300050510 | nmdc:mga06r32_31724_c1 | nmdc:mga06r32_31724_c1_255_566 | 102 |
| 588 | 3300050511 | nmdc:mga08y16_609627_c1 | nmdc:mga08y16_609627_c1_669_977 | 102 |
| 589 | 3300050512 | nmdc:mga0n895_1730480_c1 | nmdc:mga0n895_1730480_c1_45_362 | 102 |
| 590 | 3300050512 | nmdc:mga0n895_655469_c1 | nmdc:mga0n895_655469_c1_574_882 | 102 |
| 591 | 3300050513 | nmdc:mga0rr50_1193914_c1 | nmdc:mga0rr50_1193914_c1_316_624 | 102 |
| 592 | 3300004798 | Ga0058859_11154281 | Ga0058859_111542811 | 103 |
| 593 | 3300005353 | Ga0070669_100663989 | Ga0070669_1006639891 | 103 |
| 594 | 3300005459 | Ga0068867_101390973 | Ga0068867_1013909731 | 103 |
| 595 | 3300005545 | Ga0070695_101404666 | Ga0070695_1014046662 | 103 |
| 596 | 3300005615 | Ga0070702_101349862 | Ga0070702_1013498622 | 103 |
| 597 | 3300005843 | Ga0068860_100337821 | Ga0068860_1003378212 | 103 |
| 598 | 3300006237 | Ga0097621_101185674 | Ga0097621_1011856741 | 103 |
| 599 | 3300006237 | Ga0097621_101513890 | Ga0097621_1015138902 | 103 |
| 600 | 3300006846 | Ga0075430_100540772 | Ga0075430_1005407722 | 103 |
| 601 | 3300006852 | Ga0075433_10092782 | Ga0075433_100927824 | 103 |
| 602 | 3300006852 | Ga0075433_11172613 | Ga0075433_111726132 | 103 |
| 603 | 3300006871 | Ga0075434_100037481 | Ga0075434_1000374811 | 103 |
| 604 | 3300006880 | Ga0075429_100964169 | Ga0075429_1009641691 | 103 |
| 605 | 3300006914 | Ga0075436_101369398 | Ga0075436_1013693982 | 103 |
| 606 | 3300007076 | Ga0075435_100039393 | Ga0075435_1000393935 | 103 |
| 607 | 3300009011 | Ga0105251_10282618 | Ga0105251_102826182 | 103 |
| 608 | 3300009147 | Ga0114129_10248011 | Ga0114129_102480113 | 103 |
| 609 | 3300009176 | Ga0105242_10245100 | Ga0105242_102451002 | 103 |
| 610 | 3300011119 | Ga0105246_11083483 | Ga0105246_110834832 | 103 |
| 611 | 3300013297 | Ga0157378_10041431 | Ga0157378_100414314 | 103 |
| 612 | 3300014325 | Ga0163163_10382025 | Ga0163163_103820252 | 103 |
| 613 | 3300014969 | Ga0157376_11814175 | Ga0157376_118141752 | 103 |
| 614 | 3300025923 | Ga0207681_10655939 | Ga0207681_106559391 | 103 |
| 615 | 3300025934 | Ga0207686_10236131 | Ga0207686_102361312 | 103 |
| 616 | 3300025961 | Ga0207712_10270553 | Ga0207712_102705532 | 103 |
| 617 | 3300026023 | Ga0207677_12213137 | Ga0207677_122131371 | 103 |
| 618 | 3300026089 | Ga0207648_11308193 | Ga0207648_113081932 | 103 |
| 619 | 3300026118 | Ga0207675_100254083 | Ga0207675_1002540833 | 103 |
| 620 | 3300027907 | Ga0207428_10074611 | Ga0207428_100746111 | 103 |
| 621 | 3300028380 | Ga0268265_10371960 | Ga0268265_103719602 | 103 |
| 622 | 3300028381 | Ga0268264_10436768 | Ga0268264_104367681 | 103 |
| 623 | 3300035172 | Ga0373955_0130463 | Ga0373955_0130463_448_762 | 103 |
| 624 | 3300035410 | Ga0373924_0085914 | Ga0373924_0085914_687_1001 | 103 |
| 625 | 3300035724 | Ga0373933_0843388 | Ga0373933_0843388_157_471 | 103 |
| 626 | 3300036401 | Ga0373937_0018615 | Ga0373937_0018615_1529_1843 | 103 |
| 627 | 3300045051 | Ga0451576_1570593 | Ga0451576_1570593_249_560 | 103 |
| 628 | 3300046463 | Ga0495653_0591807 | Ga0495653_0591807_111_425 | 103 |
| 629 | 3300046511 | Ga0495608_0036099 | Ga0495608_0036099_2272_2586 | 103 |
| 630 | 3300046559 | Ga0495667_0001451 | Ga0495667_0001451_3430_3744 | 103 |
| 631 | 3300046675 | Ga0495657_0000672 | Ga0495657_0000672_27207_27521 | 103 |
| 632 | 3300047444 | Ga0495675_0243587 | Ga0495675_0243587_666_980 | 103 |
| 633 | 3300047471 | Ga0495684_0444994 | Ga0495684_0444994_427_741 | 103 |
| 634 | 3300050507 | nmdc:mga05p37_375291_c1 | nmdc:mga05p37_375291_c1_1201_1518 | 103 |
| 635 | 3300050509 | nmdc:mga0qj67_802001_c1 | nmdc:mga0qj67_802001_c1_217_528 | 103 |
| 636 | 3300050511 | nmdc:mga08y16_64957_c1 | nmdc:mga08y16_64957_c1_406_717 | 103 |
| 637 | 3300050513 | nmdc:mga0rr50_26365_c1 | nmdc:mga0rr50_26365_c1_1201_1518 | 103 |
| 638 | 3300050513 | nmdc:mga0rr50_570046_c1 | nmdc:mga0rr50_570046_c1_449_760 | 103 |
| 639 | 3300050514 | nmdc:mga08x19_1130200_c1 | nmdc:mga08x19_1130200_c1_224_541 | 103 |
| 640 | 3300050515 | nmdc:mga0a205_14400_c1 | nmdc:mga0a205_14400_c1_1949_2266 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tpt-assembly1.cif.gz_A | the crystal structure of amyloid precursor-like protein 2 (aplp2) e2 domain | 0.8259 | 42 | 102 |
| 6tmk-assembly1.cif.gz_H1 | cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, composite model | 0.8159 | 38 | 99 |
| 4mjn-assembly1.cif.gz_H | structure of the c ring of the cf1fo atp synthases. | 0.8067 | 37 | 100 |
| 6vmb-assembly1.cif.gz_Z | chloroplast atp synthase (c1, cf1fo) | 0.8061 | 38 | 100 |
| 6von-assembly1.cif.gz_M | chloroplast atp synthase (r1, cf1fo) | 0.8004 | 38 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5tptA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Amyloid precursor protein, E2 domain | 0.8259 | 42 | 102 | 1.20.120.770 |
| af_Q9XV49_1_95_1.20.5.170 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.8227 | 37 | 99 | 1.20.5.170 |
| af_P42166_494_672_1.10.287.3160 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8135 | 36 | 99 | 1.10.287.3160 |
| af_Q4DRF1_344_623_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.7844 | 36 | 98 | 1.20.1270.60 |
| 4q25A02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.7811 | 42 | 101 | 1.20.58.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N0IEE0-F1-model_v4 | PhoU domain-containing protein | 0.9373 | 38 | 98 |
|
| AF-A0A4Q8ULM4-F1-model_v4 | Uncharacterized protein | 0.9087 | 37 | 99 |
GO:0016020
|
| AF-A0A7H0H1I7-F1-model_v4 | DUF4935 domain-containing protein | 0.8948 | 38 | 100 |
|
| AF-A0A838QB01-F1-model_v4 | Phosphate uptake regulator PhoU | 0.8523 | 24 | 98 |
GO:0030643
GO:0045936 |
| AF-A0A5C0UGT9-F1-model_v4 | ATP synthase F(0) sector subunit c (F-type ATPase subunit c) | 0.8299 | 38 | 101 |
GO:0008289
GO:0015078 GO:0015986 GO:0045263 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar