F471271

General Info

Members Datasets Scaffolds Average Seq Length
635 271 635 258

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100172302|Ga0307409_1001723022
Length 283
Sequence VLRLPAVRIRQLVHSPRIRRDAWLYVRIITLNVNGIRAAERKGLASWLTRGAPWDVVCLQEIKANTDDVPRTLLSPRRAHAFFNAADKKGYAGVAMFARRAPTIVSGFGCAEFDCEGRYLEADFGELVVISVYLPSGSSGPHRQASKFRFLEAFLPHLVALRKREHKEIVLCGDWNIAHQPIDLKNWRANQKNSGFLPEERTWLTRVLDELGFVDVFRKVDPRPDQYTWWSNRGAAWAKNVGWRIDYQIATPGIAARARAVTIYKSKRFSDHAPLIIDYDYAL

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 3.94
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1017488 3300001976 Bacteria 935
2 JGI24746J21847_1008802 3300001977 Bacteria 1519
3 JGI24743J22301_10001559 3300001991 Bacteria 3214
4 JGI24749J21850_1001835 3300002076 Bacteria 3007
5 JGI24744J21845_10003872 3300002077 Bacteria 3092
6 JGI24033J26618_1003279 3300002155 Bacteria 1700
7 JGI24034J26672_10005905 3300002239 Bacteria 1762
8 JGI24742J22300_10005690 3300002244 Bacteria 2050
9 JGI24751J29686_10008600 3300002459 Bacteria 2090
10 Ga0065715_10120554 3300005293 Bacteria 2245
11 Ga0070676_10000582 3300005328 Bacteria 17650
12 Ga0070676_10033110 3300005328 Bacteria 2964
13 Ga0070676_10078061 3300005328 Bacteria 2002
14 Ga0070683_100006211 3300005329 Bacteria 10017
15 Ga0070690_100033909 3300005330 Bacteria 3197
16 Ga0070690_100177377 3300005330 Bacteria 1471
17 Ga0070670_100007133 3300005331 Bacteria 9464
18 Ga0070670_100015616 3300005331 Bacteria 6521
19 Ga0070670_100017778 3300005331 Bacteria 6100
20 Ga0070670_100180362 3300005331 Bacteria 1833
21 Ga0070670_100223678 3300005331 Bacteria 1638
22 Ga0070677_10011301 3300005333 Bacteria 3075
23 Ga0070677_10016659 3300005333 Bacteria 2619
24 Ga0068869_100000101 3300005334 Bacteria 40237
25 Ga0068869_100003229 3300005334 Bacteria 9959
26 Ga0068869_100072344 3300005334 Bacteria 2554
27 Ga0070666_10011252 3300005335 Bacteria 5613
28 Ga0070666_10035182 3300005335 Bacteria 3321
29 Ga0068868_100068334 3300005338 Bacteria 2829
30 Ga0068868_100145146 3300005338 Bacteria 1951
31 Ga0068868_100615534 3300005338 Bacteria 964
32 Ga0070660_100105755 3300005339 Bacteria 2234
33 Ga0070660_100122637 3300005339 Bacteria 2075
34 Ga0070689_100043545 3300005340 Bacteria 3451
35 Ga0070689_100094253 3300005340 Bacteria 2364
36 Ga0070691_10092649 3300005341 Bacteria 1492
37 Ga0070687_100003146 3300005343 Bacteria 6363
38 Ga0070661_100034266 3300005344 Bacteria 3682
39 Ga0070661_100036029 3300005344 Bacteria 3596
40 Ga0070661_100116728 3300005344 Bacteria 1996
41 Ga0070692_10053141 3300005345 Bacteria 2111
42 Ga0070668_100011598 3300005347 Bacteria 6560
43 Ga0070668_100140433 3300005347 Bacteria 1946
44 Ga0070668_100170997 3300005347 Bacteria 1769
45 Ga0070668_100251617 3300005347 Bacteria 1467
46 Ga0070669_100011448 3300005353 Bacteria 6297
47 Ga0070669_100073161 3300005353 Bacteria 2538
48 Ga0070669_100094605 3300005353 Bacteria 2245
49 Ga0070669_100101744 3300005353 Bacteria 2169
50 Ga0070669_100315775 3300005353 Bacteria 1261
51 Ga0070675_100033229 3300005354 Bacteria 4181
52 Ga0070675_100046707 3300005354 Bacteria 3547
53 Ga0070675_100058996 3300005354 Bacteria 3165
54 Ga0070675_100073086 3300005354 Bacteria 2847
55 Ga0070675_100447942 3300005354 Bacteria 1157
56 Ga0070671_100003185 3300005355 Bacteria 12790
57 Ga0070671_100007201 3300005355 Bacteria 8895
58 Ga0070671_100009591 3300005355 Bacteria 7778
59 Ga0070671_100137369 3300005355 Bacteria 2061
60 Ga0070671_100236154 3300005355 Bacteria 1552
61 Ga0070674_100004667 3300005356 Bacteria 7831
62 Ga0070674_100014156 3300005356 Bacteria 4953
63 Ga0070674_100018547 3300005356 Bacteria 4402
64 Ga0070674_100054324 3300005356 Bacteria 2770
65 Ga0070674_100241821 3300005356 Bacteria 1414
66 Ga0070673_100008340 3300005364 Bacteria 6884
67 Ga0070673_100014413 3300005364 Bacteria 5505
68 Ga0070673_100086864 3300005364 Bacteria 2549
69 Ga0070673_100177503 3300005364 Bacteria 1821
70 Ga0070673_100372030 3300005364 Bacteria 1272
71 Ga0070673_100807138 3300005364 Bacteria 867
72 Ga0070688_100018552 3300005365 Bacteria 4017
73 Ga0070688_100019921 3300005365 Bacteria 3892
74 Ga0070659_100028845 3300005366 Bacteria 4287
75 Ga0070659_100150973 3300005366 Bacteria 1895
76 Ga0070667_100003822 3300005367 Bacteria 12797
77 Ga0070667_100017178 3300005367 Bacteria 5993
78 Ga0070667_100048938 3300005367 Bacteria 3560
79 Ga0070667_100075952 3300005367 Bacteria 2868
80 Ga0070667_100098304 3300005367 Bacteria 2526
81 Ga0070667_100363530 3300005367 Bacteria 1312
82 Ga0070714_100057060 3300005435 Bacteria 3341
83 Ga0070713_100064169 3300005436 Bacteria 3081
84 Ga0070701_10009413 3300005438 Bacteria 4279
85 Ga0070701_10152927 3300005438 Bacteria 1330
86 Ga0070701_10258761 3300005438 Bacteria 1054
87 Ga0070711_100036125 3300005439 Bacteria 3309
88 Ga0070705_100014680 3300005440 Bacteria 4035
89 Ga0070705_100017785 3300005440 Bacteria 3716
90 Ga0070700_100123583 3300005441 Bacteria 1737
91 Ga0070700_100228906 3300005441 Bacteria 1322
92 Ga0070708_100000765 3300005445 Bacteria 24224
93 Ga0070708_100056589 3300005445 Bacteria 3489
94 Ga0070663_100045585 3300005455 Bacteria 3098
95 Ga0070663_100163290 3300005455 Bacteria 1716
96 Ga0070678_100005241 3300005456 Bacteria 7463
97 Ga0070678_100019333 3300005456 Bacteria 4437
98 Ga0070678_100027756 3300005456 Bacteria 3848
99 Ga0070678_100050066 3300005456 Bacteria 3019
100 Ga0070678_100074777 3300005456 Bacteria 2547
101 Ga0070662_100042000 3300005457 Bacteria 3265
102 Ga0070662_100058187 3300005457 Bacteria 2812
103 Ga0070662_100159677 3300005457 Bacteria 1762
104 Ga0070662_100162626 3300005457 Bacteria 1747
105 Ga0070662_100213485 3300005457 Bacteria 1537
106 Ga0070681_10087147 3300005458 Bacteria 3075
107 Ga0068867_100001715 3300005459 Bacteria 15268
108 Ga0068867_100013860 3300005459 Bacteria 5707
109 Ga0068867_100020492 3300005459 Bacteria 4712
110 Ga0068867_100027565 3300005459 Bacteria 4084
111 Ga0068867_100034834 3300005459 Bacteria 3650
112 Ga0070685_10079196 3300005466 Bacteria 1966
113 Ga0070685_10180722 3300005466 Bacteria 1358
114 Ga0070706_100050343 3300005467 Bacteria 3844
115 Ga0070706_100066252 3300005467 Bacteria 3341
116 Ga0070706_100087344 3300005467 Bacteria 2890
117 Ga0070707_100048377 3300005468 Bacteria 4074
118 Ga0070698_100015525 3300005471 Bacteria 8044
119 Ga0070698_100131847 3300005471 Bacteria 2454
120 Ga0070699_100018088 3300005518 Bacteria 6054
121 Ga0070679_100023723 3300005530 Bacteria 6011
122 Ga0070684_100035002 3300005535 Bacteria 4296
123 Ga0070684_100236770 3300005535 Bacteria 1667
124 Ga0070697_100040737 3300005536 Bacteria 3759
125 Ga0070697_100101576 3300005536 Bacteria 2389
126 Ga0068853_100120663 3300005539 Bacteria 2338
127 Ga0068853_100231584 3300005539 Bacteria 1690
128 Ga0068853_100453230 3300005539 Bacteria 1207
129 Ga0070672_100000610 3300005543 Bacteria 21037
130 Ga0070672_100010649 3300005543 Bacteria 6386
131 Ga0070672_100054497 3300005543 Bacteria 3130
132 Ga0070672_100070376 3300005543 Bacteria 2780
133 Ga0070672_100071851 3300005543 Bacteria 2754
134 Ga0070672_100076386 3300005543 Bacteria 2676
135 Ga0070672_100152287 3300005543 Bacteria 1913
136 Ga0070686_100028352 3300005544 Bacteria 3395
137 Ga0070696_100165509 3300005546 Bacteria 1632
138 Ga0070696_100220065 3300005546 Bacteria 1424
139 Ga0070693_100188205 3300005547 Bacteria 1333
140 Ga0070665_100012129 3300005548 Bacteria 8694
141 Ga0070665_100035120 3300005548 Bacteria 5040
142 Ga0070665_100121597 3300005548 Bacteria 2612
143 Ga0070665_100166281 3300005548 Bacteria 2208
144 Ga0070665_100355843 3300005548 Bacteria 1470
145 Ga0070704_100164594 3300005549 Bacteria 1757
146 Ga0070704_100253222 3300005549 Bacteria 1447
147 Ga0068855_100317867 3300005563 Bacteria 1722
148 Ga0070664_100119680 3300005564 Bacteria 2304
149 Ga0070664_100127283 3300005564 Bacteria 2235
150 Ga0070664_100204497 3300005564 Bacteria 1763
151 Ga0070664_100247401 3300005564 Bacteria 1602
152 Ga0070664_100438713 3300005564 Bacteria 1198
153 Ga0068857_100013086 3300005577 Bacteria 7230
154 Ga0068857_100190114 3300005577 Bacteria 1870
155 Ga0068854_100171310 3300005578 Bacteria 1689
156 Ga0068854_100264047 3300005578 Bacteria 1379
157 Ga0068856_100406311 3300005614 Bacteria 1381
158 Ga0070702_100020618 3300005615 Bacteria 3455
159 Ga0070702_100060464 3300005615 Bacteria 2203
160 Ga0068852_100030318 3300005616 Bacteria 4451
161 Ga0068852_100034401 3300005616 Bacteria 4215
162 Ga0068852_100073533 3300005616 Bacteria 3007
163 Ga0068852_100778487 3300005616 Bacteria 970
164 Ga0068859_100001953 3300005617 Bacteria 21020
165 Ga0068859_100024150 3300005617 Bacteria 6100
166 Ga0068859_100147080 3300005617 Bacteria 2431
167 Ga0068859_100150376 3300005617 Bacteria 2404
168 Ga0068859_100178996 3300005617 Bacteria 2203
169 Ga0068859_100497237 3300005617 Bacteria 1315
170 Ga0068864_100001243 3300005618 Bacteria 21215
171 Ga0068864_100006641 3300005618 Bacteria 9472
172 Ga0068864_100007075 3300005618 Bacteria 9212
173 Ga0068864_100114618 3300005618 Bacteria 2403
174 Ga0068864_100303355 3300005618 Bacteria 1496
175 Ga0068864_100311938 3300005618 Bacteria 1475
176 Ga0068866_10327655 3300005718 Bacteria 965
177 Ga0068861_100021720 3300005719 Bacteria 4615
178 Ga0068861_100023969 3300005719 Bacteria 4408
179 Ga0068861_100035609 3300005719 Bacteria 3688
180 Ga0068861_100149932 3300005719 Bacteria 1912
181 Ga0068851_10003338 3300005834 Bacteria 7136
182 Ga0068851_10260142 3300005834 Bacteria 987
183 Ga0068870_10008346 3300005840 Bacteria 4656
184 Ga0068870_10032403 3300005840 Bacteria 2656
185 Ga0068870_10130520 3300005840 Bacteria 1459
186 Ga0068870_10314546 3300005840 Bacteria 993
187 Ga0068863_100009691 3300005841 Bacteria 9398
188 Ga0068863_100025111 3300005841 Bacteria 5683
189 Ga0068863_100030500 3300005841 Bacteria 5148
190 Ga0068863_100043325 3300005841 Bacteria 4273
191 Ga0068863_100152248 3300005841 Bacteria 2213
192 Ga0068863_100167734 3300005841 Bacteria 2105
193 Ga0068858_100002486 3300005842 Bacteria 18604
194 Ga0068858_100005048 3300005842 Bacteria 12939
195 Ga0068858_100099691 3300005842 Bacteria 2709
196 Ga0068858_100260493 3300005842 Bacteria 1648
197 Ga0068860_100037605 3300005843 Bacteria 4633
198 Ga0068860_100098960 3300005843 Bacteria 2781
199 Ga0068860_100100660 3300005843 Bacteria 2757
200 Ga0068860_100102015 3300005843 Bacteria 2737
201 Ga0068860_100120285 3300005843 Bacteria 2514
202 Ga0068860_100327472 3300005843 Bacteria 1504
203 Ga0068862_100005449 3300005844 Bacteria 10632
204 Ga0068862_100009283 3300005844 Bacteria 8141
205 Ga0068862_100031488 3300005844 Bacteria 4478
206 Ga0068862_100034666 3300005844 Bacteria 4272
207 Ga0068862_100117988 3300005844 Bacteria 2336
208 Ga0068862_100381659 3300005844 Bacteria 1314
209 Ga0081539_10000686 3300005985 Bacteria 67858
210 Ga0070717_10562461 3300006028 Bacteria 1033
211 Ga0070712_100052047 3300006175 Bacteria 2854
212 Ga0075366_10026852 3300006195 Bacteria 3375
213 Ga0097621_100026300 3300006237 Bacteria 4563
214 Ga0097621_100086906 3300006237 Bacteria 2610
215 Ga0097621_100148560 3300006237 Bacteria 2008
216 Ga0097621_100172640 3300006237 Bacteria 1864
217 Ga0097621_100198195 3300006237 Bacteria 1742
218 Ga0097621_100237372 3300006237 Bacteria 1593
219 Ga0068871_100030183 3300006358 Bacteria 4266
220 Ga0068871_100030331 3300006358 Bacteria 4257
221 Ga0068871_100080829 3300006358 Bacteria 2692
222 Ga0068871_100101420 3300006358 Bacteria 2412
223 Ga0068871_100151169 3300006358 Bacteria 1980
224 Ga0075433_10240413 3300006852 Bacteria 1607
225 Ga0075433_10275937 3300006852 Bacteria 1490
226 Ga0075434_100251710 3300006871 Bacteria 1786
227 Ga0075429_100672666 3300006880 Bacteria 907
228 Ga0068865_100010655 3300006881 Bacteria 5731
229 Ga0068865_100053153 3300006881 Bacteria 2810
230 Ga0068865_100060405 3300006881 Bacteria 2654
231 Ga0068865_100145724 3300006881 Bacteria 1791
232 Ga0068865_100172785 3300006881 Bacteria 1658
233 Ga0068865_100335436 3300006881 Bacteria 1220
234 Ga0075436_100009781 3300006914 Bacteria 6556
235 Ga0075436_100136287 3300006914 Bacteria 1724
236 Ga0097620_100001953 3300006931 Bacteria 21020
237 Ga0097620_100024149 3300006931 Bacteria 6100
238 Ga0097620_100147089 3300006931 Bacteria 2431
239 Ga0097620_100150376 3300006931 Bacteria 2404
240 Ga0097620_100178995 3300006931 Bacteria 2203
241 Ga0097620_100450787 3300006931 Bacteria 1383
242 Ga0097620_100497243 3300006931 Bacteria 1315
243 Ga0075435_100049857 3300007076 Bacteria 3368
244 Ga0075435_100504303 3300007076 Bacteria 1046
245 Ga0105240_10197050 3300009093 Bacteria 2363
246 Ga0111539_10039807 3300009094 Bacteria 5663
247 Ga0105245_10272491 3300009098 Bacteria 1651
248 Ga0105245_10486823 3300009098 Bacteria 1248
249 Ga0105247_10024074 3300009101 Bacteria 3667
250 Ga0105247_10166176 3300009101 Bacteria 1464
251 Ga0114129_10108012 3300009147 Bacteria 3842
252 Ga0105243_10054456 3300009148 Bacteria 3176
253 Ga0105242_10010222 3300009176 Bacteria 7194
254 Ga0105242_10020561 3300009176 Bacteria 5178
255 Ga0105242_10131357 3300009176 Bacteria 2162
256 Ga0105242_10168470 3300009176 Bacteria 1923
257 Ga0105248_10022860 3300009177 Bacteria 6942
258 Ga0105248_10070681 3300009177 Bacteria 3920
259 Ga0105248_10143586 3300009177 Bacteria 2693
260 Ga0105248_10224819 3300009177 Bacteria 2113
261 Ga0105248_10370123 3300009177 Bacteria 1613
262 Ga0105248_10839196 3300009177 Bacteria 1037
263 Ga0105237_10045809 3300009545 Bacteria 4400
264 Ga0105238_10479946 3300009551 Bacteria 1242
265 Ga0105249_10037658 3300009553 Bacteria 4389
266 Ga0105249_10126058 3300009553 Bacteria 2438
267 Ga0105249_10166060 3300009553 Bacteria 2137
268 Ga0105249_10321432 3300009553 Bacteria 1559
269 Ga0105239_10372883 3300010375 Bacteria 1613
270 Ga0105246_10056006 3300011119 Bacteria 2723
271 Ga0157373_10020479 3300013100 Bacteria 4807
272 Ga0157370_10027147 3300013104 Bacteria 5646
273 Ga0157369_10127324 3300013105 Bacteria 2699
274 Ga0157374_10005174 3300013296 Bacteria 10939
275 Ga0157374_10007394 3300013296 Bacteria 9368
276 Ga0157374_10270641 3300013296 Bacteria 1675
277 Ga0157378_10053841 3300013297 Bacteria 3583
278 Ga0157378_10070851 3300013297 Bacteria 3130
279 Ga0157378_10073140 3300013297 Bacteria 3081
280 Ga0157378_10254217 3300013297 Bacteria 1683
281 Ga0163162_10071050 3300013306 Bacteria 3533
282 Ga0163162_10093040 3300013306 Bacteria 3099
283 Ga0163162_10102097 3300013306 Bacteria 2961
284 Ga0163162_10191711 3300013306 Bacteria 2172
285 Ga0163162_10210271 3300013306 Bacteria 2075
286 Ga0163162_10212782 3300013306 Bacteria 2063
287 Ga0163162_10509803 3300013306 Bacteria 1333
288 Ga0157372_10001809 3300013307 Bacteria 23215
289 Ga0157372_10624699 3300013307 Bacteria 1255
290 Ga0157375_10004231 3300013308 Bacteria 12447
291 Ga0157375_10112246 3300013308 Bacteria 2826
292 Ga0157375_10116543 3300013308 Bacteria 2776
293 Ga0157375_10187180 3300013308 Bacteria 2224
294 Ga0157375_10290625 3300013308 Bacteria 1798
295 Ga0157375_10555305 3300013308 Bacteria 1310
296 Ga0163163_10007273 3300014325 Bacteria 9764
297 Ga0163163_10042499 3300014325 Bacteria 4452
298 Ga0163163_10143462 3300014325 Bacteria 2431
299 Ga0163163_10292951 3300014325 Bacteria 1680
300 Ga0163163_10504262 3300014325 Bacteria 1272
301 Ga0157380_10017406 3300014326 Bacteria 5319
302 Ga0157380_10072892 3300014326 Bacteria 2783
303 Ga0157380_10304515 3300014326 Bacteria 1470
304 Ga0157377_10012385 3300014745 Bacteria 4289
305 Ga0157379_10000533 3300014968 Bacteria 30715
306 Ga0157379_10015050 3300014968 Bacteria 6785
307 Ga0157379_10037128 3300014968 Bacteria 4344
308 Ga0157379_10060468 3300014968 Bacteria 3387
309 Ga0157376_10004106 3300014969 Bacteria 10081
310 Ga0157376_10112040 3300014969 Bacteria 2403
311 Ga0157376_10391430 3300014969 Bacteria 1341
312 Ga0163161_10023120 3300017792 Bacteria 4381
313 Ga0163161_10029370 3300017792 Bacteria 3909
314 Ga0163161_10066102 3300017792 Bacteria 2640
315 Ga0163161_10096323 3300017792 Bacteria 2196
316 Ga0207666_1001994 3300025271 Bacteria 2438
317 Ga0207673_1000981 3300025290 Bacteria 3069
318 Ga0207697_10005168 3300025315 Bacteria 6092
319 Ga0207697_10009965 3300025315 Bacteria 4082
320 Ga0207697_10018739 3300025315 Bacteria 2837
321 Ga0207697_10057085 3300025315 Bacteria 1620
322 Ga0207656_10022098 3300025321 Bacteria 2549
323 Ga0207682_10011455 3300025893 Bacteria 3462
324 Ga0207642_10066769 3300025899 Bacteria 1695
325 Ga0207642_10187453 3300025899 Bacteria 1132
326 Ga0207710_10046061 3300025900 Bacteria 1946
327 Ga0207688_10004759 3300025901 Bacteria 7391
328 Ga0207688_10030642 3300025901 Bacteria 2967
329 Ga0207688_10265275 3300025901 Bacteria 1043
330 Ga0207680_10009285 3300025903 Bacteria 4872
331 Ga0207680_10277024 3300025903 Bacteria 1165
332 Ga0207645_10000795 3300025907 Bacteria 26434
333 Ga0207645_10003945 3300025907 Bacteria 11078
334 Ga0207645_10021354 3300025907 Bacteria 4222
335 Ga0207645_10242979 3300025907 Bacteria 1190
336 Ga0207645_10244361 3300025907 Bacteria 1186
337 Ga0207643_10002580 3300025908 Bacteria 9808
338 Ga0207643_10003232 3300025908 Bacteria 8789
339 Ga0207643_10169379 3300025908 Bacteria 1317
340 Ga0207684_10007136 3300025910 Bacteria 10096
341 Ga0207707_10016602 3300025912 Bacteria 6419
342 Ga0207663_10192414 3300025916 Bacteria 1465
343 Ga0207660_10231795 3300025917 Bacteria 1452
344 Ga0207662_10007972 3300025918 Bacteria 5772
345 Ga0207662_10146086 3300025918 Bacteria 1501
346 Ga0207657_10015204 3300025919 Bacteria 7468
347 Ga0207657_10037377 3300025919 Bacteria 4336
348 Ga0207649_10009544 3300025920 Bacteria 5313
349 Ga0207649_10066902 3300025920 Bacteria 2279
350 Ga0207652_10018026 3300025921 Bacteria 5786
351 Ga0207652_10255545 3300025921 Bacteria 1580
352 Ga0207646_10552235 3300025922 Bacteria 1035
353 Ga0207681_10015812 3300025923 Bacteria 4711
354 Ga0207681_10022327 3300025923 Bacteria 4036
355 Ga0207681_10030766 3300025923 Bacteria 3502
356 Ga0207681_10076808 3300025923 Bacteria 2346
357 Ga0207681_10078305 3300025923 Bacteria 2326
358 Ga0207681_10097230 3300025923 Bacteria 2115
359 Ga0207650_10002834 3300025925 Bacteria 11978
360 Ga0207650_10006285 3300025925 Bacteria 8094
361 Ga0207650_10013793 3300025925 Bacteria 5604
362 Ga0207650_10054190 3300025925 Bacteria 2974
363 Ga0207659_10009348 3300025926 Bacteria 6121
364 Ga0207659_10023048 3300025926 Bacteria 4151
365 Ga0207659_10036238 3300025926 Bacteria 3415
366 Ga0207659_10082194 3300025926 Bacteria 2384
367 Ga0207659_10145610 3300025926 Bacteria 1844
368 Ga0207659_10406298 3300025926 Bacteria 1140
369 Ga0207687_10006409 3300025927 Bacteria 7773
370 Ga0207700_10207056 3300025928 Bacteria 1656
371 Ga0207700_10573402 3300025928 Bacteria 1003
372 Ga0207664_10100262 3300025929 Bacteria 2391
373 Ga0207644_10049672 3300025931 Bacteria 3004
374 Ga0207644_10097547 3300025931 Bacteria 2201
375 Ga0207644_10130172 3300025931 Bacteria 1925
376 Ga0207644_10132004 3300025931 Bacteria 1913
377 Ga0207690_10064928 3300025932 Bacteria 2494
378 Ga0207690_10125586 3300025932 Bacteria 1870
379 Ga0207706_10014824 3300025933 Bacteria 7057
380 Ga0207706_10068085 3300025933 Bacteria 3133
381 Ga0207706_10122911 3300025933 Bacteria 2283
382 Ga0207706_10193319 3300025933 Bacteria 1785
383 Ga0207706_10324877 3300025933 Bacteria 1339
384 Ga0207686_10009410 3300025934 Bacteria 5300
385 Ga0207686_10178942 3300025934 Bacteria 1502
386 Ga0207709_10030941 3300025935 Bacteria 3119
387 Ga0207670_10027085 3300025936 Bacteria 3620
388 Ga0207670_10090654 3300025936 Bacteria 2160
389 Ga0207669_10037443 3300025937 Bacteria 2783
390 Ga0207669_10061421 3300025937 Bacteria 2309
391 Ga0207704_10023927 3300025938 Bacteria 3301
392 Ga0207665_10026042 3300025939 Bacteria 3859
393 Ga0207665_10041570 3300025939 Bacteria 3071
394 Ga0207691_10000528 3300025940 Bacteria 38155
395 Ga0207691_10001035 3300025940 Bacteria 27578
396 Ga0207691_10005561 3300025940 Bacteria 12175
397 Ga0207691_10017366 3300025940 Bacteria 6825
398 Ga0207691_10044014 3300025940 Bacteria 4111
399 Ga0207691_10063344 3300025940 Bacteria 3353
400 Ga0207691_10088604 3300025940 Bacteria 2775
401 Ga0207691_10350795 3300025940 Bacteria 1262
402 Ga0207711_10018949 3300025941 Bacteria 5725
403 Ga0207711_10033113 3300025941 Bacteria 4371
404 Ga0207711_10059772 3300025941 Bacteria 3282
405 Ga0207711_10144914 3300025941 Bacteria 2139
406 Ga0207711_10150215 3300025941 Bacteria 2101
407 Ga0207711_10366051 3300025941 Bacteria 1336
408 Ga0207689_10001875 3300025942 Bacteria 19898
409 Ga0207689_10004867 3300025942 Bacteria 12104
410 Ga0207689_10010620 3300025942 Bacteria 7926
411 Ga0207689_10014572 3300025942 Bacteria 6685
412 Ga0207661_10064872 3300025944 Bacteria 2962
413 Ga0207661_10448272 3300025944 Bacteria 1175
414 Ga0207679_10105592 3300025945 Bacteria 2212
415 Ga0207679_10201182 3300025945 Bacteria 1664
416 Ga0207667_10193992 3300025949 Bacteria 2084
417 Ga0207651_10014296 3300025960 Bacteria 4577
418 Ga0207651_10014314 3300025960 Bacteria 4574
419 Ga0207651_10154922 3300025960 Bacteria 1788
420 Ga0207651_10613302 3300025960 Bacteria 952
421 Ga0207651_10626530 3300025960 Bacteria 942
422 Ga0207712_10247991 3300025961 Bacteria 1438
423 Ga0207712_10331447 3300025961 Bacteria 1259
424 Ga0207712_10547001 3300025961 Bacteria 995
425 Ga0207668_10055777 3300025972 Bacteria 2748
426 Ga0207668_10533245 3300025972 Bacteria 1014
427 Ga0207668_10610507 3300025972 Bacteria 951
428 Ga0207640_10047069 3300025981 Bacteria 2779
429 Ga0207640_10080815 3300025981 Bacteria 2220
430 Ga0207658_10005684 3300025986 Bacteria 8527
431 Ga0207658_10007838 3300025986 Bacteria 7272
432 Ga0207658_10018723 3300025986 Bacteria 4787
433 Ga0207658_10033076 3300025986 Bacteria 3686
434 Ga0207658_10053826 3300025986 Bacteria 2975
435 Ga0207658_10084704 3300025986 Bacteria 2440
436 Ga0207658_10126391 3300025986 Bacteria 2047
437 Ga0207658_10135637 3300025986 Bacteria 1984
438 Ga0207658_10164949 3300025986 Bacteria 1819
439 Ga0207658_10581983 3300025986 Bacteria 1004
440 Ga0207677_10011392 3300026023 Bacteria 5069
441 Ga0207677_10032492 3300026023 Bacteria 3356
442 Ga0207677_10040993 3300026023 Bacteria 3058
443 Ga0207677_10045930 3300026023 Bacteria 2920
444 Ga0207677_10126976 3300026023 Bacteria 1929
445 Ga0207703_10001325 3300026035 Bacteria 22715
446 Ga0207703_10045837 3300026035 Bacteria 3518
447 Ga0207703_10049562 3300026035 Bacteria 3395
448 Ga0207703_10240027 3300026035 Bacteria 1629
449 Ga0207703_10435042 3300026035 Bacteria 1223
450 Ga0207639_10050913 3300026041 Bacteria 3147
451 Ga0207639_10108700 3300026041 Bacteria 2255
452 Ga0207639_10108937 3300026041 Bacteria 2253
453 Ga0207639_10327039 3300026041 Bacteria 1363
454 Ga0207678_10032073 3300026067 Bacteria 4580
455 Ga0207678_10074420 3300026067 Bacteria 2910
456 Ga0207678_10143570 3300026067 Bacteria 2037
457 Ga0207708_10003466 3300026075 Bacteria 11626
458 Ga0207708_10040895 3300026075 Bacteria 3535
459 Ga0207702_10050515 3300026078 Bacteria 3511
460 Ga0207702_10301918 3300026078 Bacteria 1520
461 Ga0207641_10019612 3300026088 Bacteria 5552
462 Ga0207641_10083944 3300026088 Bacteria 2771
463 Ga0207641_10269377 3300026088 Bacteria 1597
464 Ga0207641_10278802 3300026088 Bacteria 1571
465 Ga0207641_10318458 3300026088 Bacteria 1474
466 Ga0207648_10000236 3300026089 Bacteria 59280
467 Ga0207648_10002943 3300026089 Bacteria 18026
468 Ga0207648_10006732 3300026089 Bacteria 11399
469 Ga0207648_10009546 3300026089 Bacteria 9280
470 Ga0207648_10018037 3300026089 Bacteria 6396
471 Ga0207648_10058080 3300026089 Bacteria 3375
472 Ga0207648_10142639 3300026089 Bacteria 2112
473 Ga0207648_10278384 3300026089 Bacteria 1496
474 Ga0207676_10010490 3300026095 Bacteria 6600
475 Ga0207676_10020109 3300026095 Bacteria 4880
476 Ga0207676_10205149 3300026095 Bacteria 1744
477 Ga0207674_10009121 3300026116 Bacteria 11383
478 Ga0207674_10022439 3300026116 Bacteria 6777
479 Ga0207675_100002772 3300026118 Bacteria 17207
480 Ga0207675_100024342 3300026118 Bacteria 5631
481 Ga0207675_100025833 3300026118 Bacteria 5463
482 Ga0207675_100026629 3300026118 Bacteria 5383
483 Ga0207675_100031486 3300026118 Bacteria 4940
484 Ga0207675_100066156 3300026118 Bacteria 3378
485 Ga0207683_10003305 3300026121 Bacteria 14055
486 Ga0207683_10004270 3300026121 Bacteria 12335
487 Ga0207683_10006099 3300026121 Bacteria 10320
488 Ga0207683_10009565 3300026121 Bacteria 8265
489 Ga0207683_10126375 3300026121 Bacteria 2298
490 Ga0207698_10017782 3300026142 Bacteria 4832
491 Ga0207698_10198772 3300026142 Bacteria 1793
492 Ga0207428_10135599 3300027907 Bacteria 1882
493 Ga0265356_1000064 3300028017 Bacteria 17470
494 Ga0268266_10013977 3300028379 Bacteria 6912
495 Ga0268266_10197536 3300028379 Bacteria 1839
496 Ga0268265_10022503 3300028380 Bacteria 4430
497 Ga0268265_10095655 3300028380 Bacteria 2385
498 Ga0268265_10150241 3300028380 Bacteria 1963
499 Ga0268265_10152755 3300028380 Bacteria 1949
500 Ga0268265_10725456 3300028380 Bacteria 962
501 Ga0268264_10012464 3300028381 Bacteria 6999
502 Ga0268264_10063233 3300028381 Bacteria 3110
503 Ga0268264_10082891 3300028381 Bacteria 2745
504 Ga0268264_10122148 3300028381 Bacteria 2297
505 Ga0265324_10026029 3300029957 Bacteria 2071
506 Ga0265762_1006057 3300030760 Bacteria 2168
507 Ga0265770_1004405 3300030878 Bacteria 1921
508 Ga0265330_10002735 3300031235 Bacteria 9490
509 Ga0265332_10000088 3300031238 Bacteria 79927
510 Ga0265325_10005155 3300031241 Bacteria 8127
511 Ga0265329_10001308 3300031242 Bacteria 12097
512 Ga0265331_10000214 3300031250 Bacteria 69697
513 Ga0265327_10011172 3300031251 Bacteria 6222
514 Ga0265327_10106763 3300031251 Bacteria 1343
515 Ga0265316_10397131 3300031344 Bacteria 993
516 Ga0307408_100105023 3300031548 Bacteria 2159
517 Ga0265313_10138190 3300031595 Bacteria 1050
518 Ga0316575_10000614 3300031665 Bacteria 10499
519 Ga0316575_10002111 3300031665 Bacteria 6649
520 Ga0265342_10005461 3300031712 Bacteria 9680
521 Ga0307405_10176841 3300031731 Bacteria 1528
522 Ga0307405_10210286 3300031731 Bacteria 1420
523 Ga0307410_10023593 3300031852 Bacteria 3828
524 Ga0307410_10045837 3300031852 Bacteria 2914
525 Ga0307410_10062133 3300031852 Bacteria 2558
526 Ga0307412_10062421 3300031911 Bacteria 2509
527 Ga0307409_100045489 3300031995 Bacteria 3314
528 Ga0307409_100081481 3300031995 Bacteria 2616
529 Ga0307409_100172302 3300031995 Bacteria 1906
530 Ga0307416_100097088 3300032002 Bacteria 2550
531 Ga0373934_0143314 3300035086 Bacteria 977
532 Ga0373957_0091054 3300035120 Bacteria 1212
533 Ga0373943_0026928 3300035170 Bacteria 2697
534 Ga0373946_0116217 3300035171 Bacteria 1216
535 Ga0373924_0184162 3300035410 Bacteria 919
536 Ga0373935_0013887 3300035692 Bacteria 4862
537 Ga0373935_0051717 3300035692 Bacteria 2610
538 Ga0373927_0022459 3300035695 Bacteria 4133
539 Ga0373927_0152243 3300035695 Bacteria 1514
540 Ga0373927_0313985 3300035695 Bacteria 1032
541 Ga0373933_0146638 3300035724 Bacteria 1493
542 Ga0373947_0006200 3300035725 Bacteria 6955
543 Ga0373937_0011967 3300036401 Bacteria 7617
544 Ga0373937_0050361 3300036401 Bacteria 3815
545 Ga0373937_0198973 3300036401 Bacteria 1883
546 Ga0373937_0298543 3300036401 Bacteria 1522
547 Ga0373925_0010555 3300037068 Bacteria 6697
548 Ga0373925_0026225 3300037068 Bacteria 4263
549 Ga0373925_0084296 3300037068 Bacteria 2422
550 Ga0373925_0137585 3300037068 Bacteria 1909
551 Ga0436363_0399790 3300039450 Bacteria 1145
552 Ga0436362_1153937 3300039453 Bacteria 16105
553 Ga0451577_0000002 3300042876 Bacteria 1731375
554 Ga0451577_0016080 3300042876 Bacteria 6939
555 Ga0453683_0000013 3300044673 Bacteria 371932
556 Ga0453683_0002705 3300044673 Bacteria 13530
557 Ga0466965_0042807 3300044683 Bacteria 2235
558 Ga0453684_0000002 3300044712 Bacteria 1731375
559 Ga0453684_0000040 3300044712 Bacteria 690210
560 Ga0453684_0421583 3300044712 Bacteria 1491
561 Ga0451576_0000006 3300045051 Bacteria 949698
562 Ga0451576_0000037 3300045051 Bacteria 372173
563 Ga0451576_0000320 3300045051 Bacteria 116612
564 Ga0451576_0002559 3300045051 Bacteria 26842
565 Ga0451576_0003253 3300045051 Bacteria 22534
566 Ga0451576_0073619 3300045051 Bacteria 3555
567 Ga0495603_0139697 3300046455 Bacteria 1409
568 Ga0495603_0172187 3300046455 Bacteria 1254
569 Ga0495653_0224146 3300046463 Bacteria 1262
570 Ga0495582_0058501 3300046473 Bacteria 2125
571 Ga0495662_0115144 3300046476 Bacteria 1318
572 Ga0495664_0058652 3300046477 Bacteria 2290
573 Ga0495630_0102655 3300046517 Bacteria 2164
574 Ga0495598_0055407 3300046537 Bacteria 1207
575 Ga0495645_0123305 3300046543 Bacteria 1822
576 Ga0495667_0087074 3300046559 Bacteria 2026
577 Ga0495659_0007601 3300046664 Bacteria 3437
578 Ga0495588_0056254 3300046674 Bacteria 2031
579 Ga0495647_0002741 3300046681 Bacteria 5589
580 Ga0495658_0075749 3300046683 Bacteria 1964
581 Ga0495669_0076533 3300046684 Bacteria 1532
582 Ga0495581_0004119 3300047315 Bacteria 8370
583 Ga0495676_0060813 3300047321 Unclassified 2958
584 Ga0495680_0063813 3300047322 Bacteria 2827
585 Ga0495614_0117741 3300048089 Bacteria 1170
586 Ga0496100_0109270 3300048903 Bacteria 1918
587 Ga0496101_0013616 3300048904 Bacteria 5455
588 Ga0496101_0051540 3300048904 Bacteria 2966
589 Ga0496102_0125679 3300048905 Bacteria 2397
590 Ga0496103_0025748 3300048906 Bacteria 3558
591 Ga0496103_0111637 3300048906 Bacteria 1737
592 Ga0496104_0044377 3300048907 Bacteria 4177
593 Ga0496104_0078678 3300048907 Bacteria 3142
594 Ga0496105_0028062 3300048908 Bacteria 4603
595 Ga0496106_0009734 3300048909 Bacteria 7098
596 Ga0496107_0098338 3300048910 Bacteria 2143
597 Ga0496107_0241287 3300048910 Bacteria 1345
598 Ga0496108_0003218 3300048911 Bacteria 13133
599 Ga0496108_0251957 3300048911 Bacteria 1536
600 Ga0496109_0012278 3300048912 Bacteria 7394
601 Ga0496109_0031434 3300048912 Bacteria 4764
602 Ga0496109_0218433 3300048912 Bacteria 1793
603 Ga0496109_0254720 3300048912 Bacteria 1653
604 Ga0496110_0012953 3300048913 Bacteria 6877
605 Ga0496110_0294668 3300048913 Bacteria 1478
606 Ga0496110_0410281 3300048913 Bacteria 1235
607 Ga0496111_0216996 3300048914 Bacteria 1421
608 Ga0496112_0319801 3300048915 Bacteria 1496
609 Ga0496113_0098363 3300048916 Bacteria 2265
610 Ga0496114_0093701 3300048917 Bacteria 2554
611 Ga0501034_0096059 3300049571 Bacteria 2960
612 Ga0501047_0115364 3300049581 Bacteria 2568
613 Ga0501070_0076227 3300049586 Bacteria 2776
614 Ga0501072_0183039 3300049588 Bacteria 1671
615 Ga0501073_0052677 3300049589 Bacteria 2849
616 Ga0501074_0043412 3300049590 Bacteria 3254
617 Ga0501080_0022481 3300049742 Bacteria 5842
618 Ga0501080_0023269 3300049742 Bacteria 5744
619 Ga0501081_0014556 3300049743 Bacteria 5190
620 Ga0501081_0151171 3300049743 Bacteria 1668
621 Ga0501081_0458472 3300049743 Bacteria 947
622 Ga0501083_0066521 3300049744 Bacteria 2399
623 nmdc:mga0k408_72067_c1 3300050493 Bacteria 2017
624 nmdc:mga05p37_171678_c1 3300050507 Bacteria 2644
625 nmdc:mga05p37_500897_c1 3300050507 Bacteria 1394
626 nmdc:mga08y16_65012_c1 3300050511 Bacteria 3808
627 nmdc:mga0n895_148919_c1 3300050512 Bacteria 2370
628 nmdc:mga0rr50_106597_c1 3300050513 Bacteria 2211
629 nmdc:mga0rr50_395847_c1 3300050513 Bacteria 1166
630 nmdc:mga0a205_8372_c1 3300050515 Bacteria 9409
631 Ga0495595_0059299 3300053084 Bacteria 1789
632 Ga0495619_0225738 3300053085 Bacteria 1297
633 Ga0501084_0130083 3300054114 Bacteria 2119
634 Ga0501082_0434721 3300060353 Bacteria 1146
635 Ga0530510_0214669 3300061734 Bacteria 1429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0184162 Ga0373924_0184162_191_907 238
2 3300005365 Ga0070688_100018552 Ga0070688_1000185523 253
3 3300005618 Ga0068864_100311938 Ga0068864_1003119382 253
4 3300005842 Ga0068858_100260493 Ga0068858_1002604932 253
5 3300009098 Ga0105245_10486823 Ga0105245_104868232 253
6 3300026035 Ga0207703_10240027 Ga0207703_102400272 253
7 3300026035 Ga0207703_10435042 Ga0207703_104350422 253
8 3300047321 Ga0495676_0060813 Ga0495676_0060813_2027_2812 253
9 3300031344 Ga0265316_10397131 Ga0265316_103971312 254
10 3300039450 Ga0436363_0399790 Ga0436363_0399790_202_969 254
11 3300039453 Ga0436362_1153937 Ga0436362_1153937_8713_9480 254
12 3300042876 Ga0451577_0016080 Ga0451577_0016080_5148_5915 254
13 3300044673 Ga0453683_0002705 Ga0453683_0002705_10301_11068 254
14 3300044712 Ga0453684_0000040 Ga0453684_0000040_578732_579499 254
15 3300044712 Ga0453684_0421583 Ga0453684_0421583_423_1190 254
16 3300045051 Ga0451576_0000006 Ga0451576_0000006_543168_543935 254
17 3300045051 Ga0451576_0002559 Ga0451576_0002559_12109_12876 254
18 3300045051 Ga0451576_0003253 Ga0451576_0003253_2826_3593 254
19 3300045051 Ga0451576_0073619 Ga0451576_0073619_2363_3130 254
20 3300049743 Ga0501081_0014556 Ga0501081_0014556_3953_4720 254
21 3300049743 Ga0501081_0458472 Ga0501081_0458472_87_854 254
22 3300061734 Ga0530510_0214669 Ga0530510_0214669_45_812 254
23 3300045051 Ga0451576_0000320 Ga0451576_0000320_52210_52980 255
24 3300005440 Ga0070705_100017785 Ga0070705_1000177854 256
25 3300005985 Ga0081539_10000686 Ga0081539_1000068612 256
26 3300006195 Ga0075366_10026852 Ga0075366_100268522 256
27 3300006852 Ga0075433_10275937 Ga0075433_102759372 256
28 3300006914 Ga0075436_100009781 Ga0075436_1000097817 256
29 3300025939 Ga0207665_10026042 Ga0207665_100260425 256
30 3300028017 Ga0265356_1000064 Ga0265356_100006413 256
31 3300029957 Ga0265324_10026029 Ga0265324_100260292 256
32 3300030760 Ga0265762_1006057 Ga0265762_10060574 256
33 3300030878 Ga0265770_1004405 Ga0265770_10044053 256
34 3300031251 Ga0265327_10106763 Ga0265327_101067631 256
35 3300042876 Ga0451577_0000002 Ga0451577_0000002_1621139_1621912 256
36 3300044673 Ga0453683_0000013 Ga0453683_0000013_261696_262469 256
37 3300044683 Ga0466965_0042807 Ga0466965_0042807_576_1391 256
38 3300044712 Ga0453684_0000002 Ga0453684_0000002_109464_110237 256
39 3300045051 Ga0451576_0000037 Ga0451576_0000037_261937_262710 256
40 3300050493 nmdc:mga0k408_72067_c1 nmdc:mga0k408_72067_c1_645_1418 256
41 3300005331 Ga0070670_100180362 Ga0070670_1001803623 257
42 3300005335 Ga0070666_10011252 Ga0070666_100112524 257
43 3300005338 Ga0068868_100068334 Ga0068868_1000683342 257
44 3300005339 Ga0070660_100105755 Ga0070660_1001057553 257
45 3300005340 Ga0070689_100094253 Ga0070689_1000942533 257
46 3300005341 Ga0070691_10092649 Ga0070691_100926492 257
47 3300005344 Ga0070661_100116728 Ga0070661_1001167281 257
48 3300005345 Ga0070692_10053141 Ga0070692_100531413 257
49 3300005355 Ga0070671_100007201 Ga0070671_1000072015 257
50 3300005356 Ga0070674_100014156 Ga0070674_1000141565 257
51 3300005356 Ga0070674_100018547 Ga0070674_1000185474 257
52 3300005364 Ga0070673_100807138 Ga0070673_1008071381 257
53 3300005366 Ga0070659_100150973 Ga0070659_1001509732 257
54 3300005367 Ga0070667_100098304 Ga0070667_1000983043 257
55 3300005435 Ga0070714_100057060 Ga0070714_1000570603 257
56 3300005436 Ga0070713_100064169 Ga0070713_1000641692 257
57 3300005439 Ga0070711_100036125 Ga0070711_1000361252 257
58 3300005440 Ga0070705_100014680 Ga0070705_1000146804 257
59 3300005455 Ga0070663_100163290 Ga0070663_1001632902 257
60 3300005456 Ga0070678_100019333 Ga0070678_1000193333 257
61 3300005456 Ga0070678_100050066 Ga0070678_1000500662 257
62 3300005457 Ga0070662_100159677 Ga0070662_1001596772 257
63 3300005457 Ga0070662_100213485 Ga0070662_1002134852 257
64 3300005467 Ga0070706_100087344 Ga0070706_1000873443 257
65 3300005518 Ga0070699_100018088 Ga0070699_1000180883 257
66 3300005535 Ga0070684_100236770 Ga0070684_1002367701 257
67 3300005543 Ga0070672_100076386 Ga0070672_1000763862 257
68 3300005546 Ga0070696_100220065 Ga0070696_1002200651 257
69 3300005547 Ga0070693_100188205 Ga0070693_1001882051 257
70 3300005549 Ga0070704_100164594 Ga0070704_1001645942 257
71 3300005564 Ga0070664_100127283 Ga0070664_1001272832 257
72 3300005578 Ga0068854_100171310 Ga0068854_1001713102 257
73 3300005578 Ga0068854_100264047 Ga0068854_1002640471 257
74 3300005615 Ga0070702_100060464 Ga0070702_1000604642 257
75 3300005616 Ga0068852_100034401 Ga0068852_1000344011 257
76 3300005616 Ga0068852_100073533 Ga0068852_1000735333 257
77 3300005718 Ga0068866_10327655 Ga0068866_103276551 257
78 3300005841 Ga0068863_100167734 Ga0068863_1001677343 257
79 3300005843 Ga0068860_100098960 Ga0068860_1000989602 257
80 3300006028 Ga0070717_10562461 Ga0070717_105624611 257
81 3300006175 Ga0070712_100052047 Ga0070712_1000520472 257
82 3300006237 Ga0097621_100086906 Ga0097621_1000869063 257
83 3300006237 Ga0097621_100198195 Ga0097621_1001981952 257
84 3300006358 Ga0068871_100080829 Ga0068871_1000808293 257
85 3300006358 Ga0068871_100101420 Ga0068871_1001014203 257
86 3300006871 Ga0075434_100251710 Ga0075434_1002517102 257
87 3300006881 Ga0068865_100145724 Ga0068865_1001457243 257
88 3300006914 Ga0075436_100136287 Ga0075436_1001362873 257
89 3300009093 Ga0105240_10197050 Ga0105240_101970503 257
90 3300009098 Ga0105245_10272491 Ga0105245_102724912 257
91 3300009101 Ga0105247_10024074 Ga0105247_100240741 257
92 3300009176 Ga0105242_10131357 Ga0105242_101313573 257
93 3300009177 Ga0105248_10224819 Ga0105248_102248193 257
94 3300009545 Ga0105237_10045809 Ga0105237_100458092 257
95 3300009551 Ga0105238_10479946 Ga0105238_104799461 257
96 3300013105 Ga0157369_10127324 Ga0157369_101273243 257
97 3300013297 Ga0157378_10053841 Ga0157378_100538412 257
98 3300013306 Ga0163162_10509803 Ga0163162_105098031 257
99 3300013307 Ga0157372_10624699 Ga0157372_106246991 257
100 3300013308 Ga0157375_10290625 Ga0157375_102906252 257
101 3300014325 Ga0163163_10292951 Ga0163163_102929512 257
102 3300014968 Ga0157379_10060468 Ga0157379_100604682 257
103 3300014969 Ga0157376_10112040 Ga0157376_101120401 257
104 3300017792 Ga0163161_10066102 Ga0163161_100661024 257
105 3300025899 Ga0207642_10066769 Ga0207642_100667692 257
106 3300025916 Ga0207663_10192414 Ga0207663_101924142 257
107 3300025918 Ga0207662_10146086 Ga0207662_101460862 257
108 3300025919 Ga0207657_10015204 Ga0207657_100152042 257
109 3300025921 Ga0207652_10255545 Ga0207652_102555452 257
110 3300025927 Ga0207687_10006409 Ga0207687_100064096 257
111 3300025928 Ga0207700_10207056 Ga0207700_102070561 257
112 3300025928 Ga0207700_10573402 Ga0207700_105734021 257
113 3300025929 Ga0207664_10100262 Ga0207664_101002621 257
114 3300025932 Ga0207690_10125586 Ga0207690_101255862 257
115 3300025933 Ga0207706_10193319 Ga0207706_101933192 257
116 3300025933 Ga0207706_10324877 Ga0207706_103248772 257
117 3300025934 Ga0207686_10009410 Ga0207686_100094103 257
118 3300025937 Ga0207669_10061421 Ga0207669_100614213 257
119 3300025938 Ga0207704_10023927 Ga0207704_100239272 257
120 3300025939 Ga0207665_10041570 Ga0207665_100415704 257
121 3300025940 Ga0207691_10044014 Ga0207691_100440143 257
122 3300025940 Ga0207691_10350795 Ga0207691_103507951 257
123 3300025941 Ga0207711_10018949 Ga0207711_100189494 257
124 3300025941 Ga0207711_10150215 Ga0207711_101502152 257
125 3300025944 Ga0207661_10448272 Ga0207661_104482721 257
126 3300025960 Ga0207651_10613302 Ga0207651_106133021 257
127 3300025981 Ga0207640_10047069 Ga0207640_100470693 257
128 3300025981 Ga0207640_10080815 Ga0207640_100808152 257
129 3300025986 Ga0207658_10126391 Ga0207658_101263912 257
130 3300026041 Ga0207639_10327039 Ga0207639_103270392 257
131 3300026067 Ga0207678_10074420 Ga0207678_100744202 257
132 3300026078 Ga0207702_10050515 Ga0207702_100505152 257
133 3300026089 Ga0207648_10009546 Ga0207648_100095467 257
134 3300026089 Ga0207648_10142639 Ga0207648_101426392 257
135 3300026121 Ga0207683_10006099 Ga0207683_100060998 257
136 3300026121 Ga0207683_10126375 Ga0207683_101263753 257
137 3300028381 Ga0268264_10063233 Ga0268264_100632332 257
138 3300031548 Ga0307408_100105023 Ga0307408_1001050232 257
139 3300031665 Ga0316575_10000614 Ga0316575_1000061411 257
140 3300031665 Ga0316575_10002111 Ga0316575_100021113 257
141 3300031731 Ga0307405_10176841 Ga0307405_101768412 257
142 3300031731 Ga0307405_10210286 Ga0307405_102102861 257
143 3300031852 Ga0307410_10023593 Ga0307410_100235933 257
144 3300031852 Ga0307410_10045837 Ga0307410_100458372 257
145 3300031852 Ga0307410_10062133 Ga0307410_100621332 257
146 3300031911 Ga0307412_10062421 Ga0307412_100624212 257
147 3300031995 Ga0307409_100045489 Ga0307409_1000454892 257
148 3300031995 Ga0307409_100081481 Ga0307409_1000814812 257
149 3300031995 Ga0307409_100172302 Ga0307409_1001723022 257
150 3300032002 Ga0307416_100097088 Ga0307416_1000970883 257
151 3300035086 Ga0373934_0143314 Ga0373934_0143314_84_857 257
152 3300035120 Ga0373957_0091054 Ga0373957_0091054_263_1036 257
153 3300035170 Ga0373943_0026928 Ga0373943_0026928_1771_2544 257
154 3300035171 Ga0373946_0116217 Ga0373946_0116217_261_1034 257
155 3300035692 Ga0373935_0013887 Ga0373935_0013887_3543_4316 257
156 3300035695 Ga0373927_0152243 Ga0373927_0152243_339_1112 257
157 3300035725 Ga0373947_0006200 Ga0373947_0006200_3945_4718 257
158 3300036401 Ga0373937_0011967 Ga0373937_0011967_1486_2259 257
159 3300036401 Ga0373937_0198973 Ga0373937_0198973_690_1463 257
160 3300037068 Ga0373925_0010555 Ga0373925_0010555_1773_2546 257
161 3300037068 Ga0373925_0026225 Ga0373925_0026225_3107_3880 257
162 3300037068 Ga0373925_0137585 Ga0373925_0137585_537_1310 257
163 3300046455 Ga0495603_0139697 Ga0495603_0139697_234_1007 257
164 3300046463 Ga0495653_0224146 Ga0495653_0224146_226_999 257
165 3300046473 Ga0495582_0058501 Ga0495582_0058501_1136_1909 257
166 3300046476 Ga0495662_0115144 Ga0495662_0115144_136_909 257
167 3300046477 Ga0495664_0058652 Ga0495664_0058652_894_1667 257
168 3300046517 Ga0495630_0102655 Ga0495630_0102655_297_1070 257
169 3300046543 Ga0495645_0123305 Ga0495645_0123305_851_1624 257
170 3300046559 Ga0495667_0087074 Ga0495667_0087074_592_1365 257
171 3300046664 Ga0495659_0007601 Ga0495659_0007601_1714_2487 257
172 3300046674 Ga0495588_0056254 Ga0495588_0056254_1123_1896 257
173 3300046681 Ga0495647_0002741 Ga0495647_0002741_743_1516 257
174 3300046683 Ga0495658_0075749 Ga0495658_0075749_105_878 257
175 3300046684 Ga0495669_0076533 Ga0495669_0076533_485_1258 257
176 3300047315 Ga0495581_0004119 Ga0495581_0004119_6349_7122 257
177 3300047322 Ga0495680_0063813 Ga0495680_0063813_736_1509 257
178 3300048089 Ga0495614_0117741 Ga0495614_0117741_166_939 257
179 3300048904 Ga0496101_0051540 Ga0496101_0051540_2072_2845 257
180 3300048907 Ga0496104_0078678 Ga0496104_0078678_2179_2952 257
181 3300048910 Ga0496107_0241287 Ga0496107_0241287_101_874 257
182 3300049743 Ga0501081_0151171 Ga0501081_0151171_292_1068 257
183 3300050507 nmdc:mga05p37_500897_c1 nmdc:mga05p37_500897_c1_82_861 257
184 3300053084 Ga0495595_0059299 Ga0495595_0059299_724_1497 257
185 3300053085 Ga0495619_0225738 Ga0495619_0225738_452_1225 257
186 3300001976 JGI24752J21851_1017488 JGI24752J21851_10174881 258
187 3300001977 JGI24746J21847_1008802 JGI24746J21847_10088022 258
188 3300001991 JGI24743J22301_10001559 JGI24743J22301_100015592 258
189 3300002076 JGI24749J21850_1001835 JGI24749J21850_10018352 258
190 3300002077 JGI24744J21845_10003872 JGI24744J21845_100038724 258
191 3300002155 JGI24033J26618_1003279 JGI24033J26618_10032792 258
192 3300002239 JGI24034J26672_10005905 JGI24034J26672_100059052 258
193 3300002244 JGI24742J22300_10005690 JGI24742J22300_100056902 258
194 3300002459 JGI24751J29686_10008600 JGI24751J29686_100086002 258
195 3300005293 Ga0065715_10120554 Ga0065715_101205542 258
196 3300005328 Ga0070676_10000582 Ga0070676_100005827 258
197 3300005328 Ga0070676_10033110 Ga0070676_100331104 258
198 3300005328 Ga0070676_10078061 Ga0070676_100780613 258
199 3300005329 Ga0070683_100006211 Ga0070683_1000062118 258
200 3300005330 Ga0070690_100033909 Ga0070690_1000339092 258
201 3300005330 Ga0070690_100177377 Ga0070690_1001773772 258
202 3300005331 Ga0070670_100007133 Ga0070670_1000071333 258
203 3300005331 Ga0070670_100015616 Ga0070670_1000156165 258
204 3300005331 Ga0070670_100017778 Ga0070670_1000177784 258
205 3300005331 Ga0070670_100223678 Ga0070670_1002236782 258
206 3300005333 Ga0070677_10011301 Ga0070677_100113012 258
207 3300005333 Ga0070677_10016659 Ga0070677_100166592 258
208 3300005334 Ga0068869_100000101 Ga0068869_1000001017 258
209 3300005334 Ga0068869_100003229 Ga0068869_1000032297 258
210 3300005334 Ga0068869_100072344 Ga0068869_1000723443 258
211 3300005335 Ga0070666_10035182 Ga0070666_100351823 258
212 3300005338 Ga0068868_100145146 Ga0068868_1001451461 258
213 3300005338 Ga0068868_100615534 Ga0068868_1006155341 258
214 3300005339 Ga0070660_100122637 Ga0070660_1001226372 258
215 3300005340 Ga0070689_100043545 Ga0070689_1000435452 258
216 3300005343 Ga0070687_100003146 Ga0070687_1000031464 258
217 3300005344 Ga0070661_100034266 Ga0070661_1000342663 258
218 3300005344 Ga0070661_100036029 Ga0070661_1000360293 258
219 3300005347 Ga0070668_100011598 Ga0070668_1000115984 258
220 3300005347 Ga0070668_100140433 Ga0070668_1001404333 258
221 3300005347 Ga0070668_100170997 Ga0070668_1001709972 258
222 3300005347 Ga0070668_100251617 Ga0070668_1002516172 258
223 3300005353 Ga0070669_100011448 Ga0070669_1000114485 258
224 3300005353 Ga0070669_100073161 Ga0070669_1000731612 258
225 3300005353 Ga0070669_100094605 Ga0070669_1000946053 258
226 3300005353 Ga0070669_100101744 Ga0070669_1001017442 258
227 3300005353 Ga0070669_100315775 Ga0070669_1003157751 258
228 3300005354 Ga0070675_100033229 Ga0070675_1000332292 258
229 3300005354 Ga0070675_100046707 Ga0070675_1000467072 258
230 3300005354 Ga0070675_100058996 Ga0070675_1000589961 258
231 3300005354 Ga0070675_100073086 Ga0070675_1000730863 258
232 3300005354 Ga0070675_100447942 Ga0070675_1004479422 258
233 3300005355 Ga0070671_100003185 Ga0070671_10000318511 258
234 3300005355 Ga0070671_100009591 Ga0070671_1000095916 258
235 3300005355 Ga0070671_100137369 Ga0070671_1001373692 258
236 3300005355 Ga0070671_100236154 Ga0070671_1002361541 258
237 3300005356 Ga0070674_100004667 Ga0070674_1000046678 258
238 3300005356 Ga0070674_100054324 Ga0070674_1000543243 258
239 3300005356 Ga0070674_100241821 Ga0070674_1002418212 258
240 3300005364 Ga0070673_100008340 Ga0070673_1000083403 258
241 3300005364 Ga0070673_100014413 Ga0070673_1000144133 258
242 3300005364 Ga0070673_100086864 Ga0070673_1000868643 258
243 3300005364 Ga0070673_100177503 Ga0070673_1001775032 258
244 3300005364 Ga0070673_100372030 Ga0070673_1003720301 258
245 3300005365 Ga0070688_100019921 Ga0070688_1000199212 258
246 3300005366 Ga0070659_100028845 Ga0070659_1000288454 258
247 3300005367 Ga0070667_100003822 Ga0070667_1000038227 258
248 3300005367 Ga0070667_100017178 Ga0070667_1000171784 258
249 3300005367 Ga0070667_100048938 Ga0070667_1000489382 258
250 3300005367 Ga0070667_100075952 Ga0070667_1000759522 258
251 3300005367 Ga0070667_100363530 Ga0070667_1003635302 258
252 3300005438 Ga0070701_10009413 Ga0070701_100094133 258
253 3300005438 Ga0070701_10152927 Ga0070701_101529271 258
254 3300005438 Ga0070701_10258761 Ga0070701_102587611 258
255 3300005441 Ga0070700_100123583 Ga0070700_1001235831 258
256 3300005441 Ga0070700_100228906 Ga0070700_1002289062 258
257 3300005445 Ga0070708_100000765 Ga0070708_10000076519 258
258 3300005445 Ga0070708_100056589 Ga0070708_1000565892 258
259 3300005455 Ga0070663_100045585 Ga0070663_1000455852 258
260 3300005456 Ga0070678_100005241 Ga0070678_1000052412 258
261 3300005456 Ga0070678_100027756 Ga0070678_1000277564 258
262 3300005456 Ga0070678_100074777 Ga0070678_1000747773 258
263 3300005457 Ga0070662_100042000 Ga0070662_1000420004 258
264 3300005457 Ga0070662_100058187 Ga0070662_1000581873 258
265 3300005457 Ga0070662_100162626 Ga0070662_1001626262 258
266 3300005458 Ga0070681_10087147 Ga0070681_100871474 258
267 3300005459 Ga0068867_100001715 Ga0068867_1000017153 258
268 3300005459 Ga0068867_100013860 Ga0068867_1000138604 258
269 3300005459 Ga0068867_100020492 Ga0068867_1000204923 258
270 3300005459 Ga0068867_100027565 Ga0068867_1000275653 258
271 3300005459 Ga0068867_100034834 Ga0068867_1000348344 258
272 3300005466 Ga0070685_10079196 Ga0070685_100791962 258
273 3300005466 Ga0070685_10180722 Ga0070685_101807222 258
274 3300005467 Ga0070706_100050343 Ga0070706_1000503433 258
275 3300005467 Ga0070706_100066252 Ga0070706_1000662522 258
276 3300005468 Ga0070707_100048377 Ga0070707_1000483774 258
277 3300005471 Ga0070698_100015525 Ga0070698_1000155253 258
278 3300005471 Ga0070698_100131847 Ga0070698_1001318472 258
279 3300005530 Ga0070679_100023723 Ga0070679_1000237233 258
280 3300005535 Ga0070684_100035002 Ga0070684_1000350022 258
281 3300005536 Ga0070697_100040737 Ga0070697_1000407373 258
282 3300005536 Ga0070697_100101576 Ga0070697_1001015762 258
283 3300005539 Ga0068853_100120663 Ga0068853_1001206631 258
284 3300005539 Ga0068853_100231584 Ga0068853_1002315842 258
285 3300005539 Ga0068853_100453230 Ga0068853_1004532302 258
286 3300005543 Ga0070672_100000610 Ga0070672_10000061016 258
287 3300005543 Ga0070672_100010649 Ga0070672_1000106494 258
288 3300005543 Ga0070672_100054497 Ga0070672_1000544974 258
289 3300005543 Ga0070672_100070376 Ga0070672_1000703762 258
290 3300005543 Ga0070672_100071851 Ga0070672_1000718512 258
291 3300005543 Ga0070672_100152287 Ga0070672_1001522872 258
292 3300005544 Ga0070686_100028352 Ga0070686_1000283522 258
293 3300005546 Ga0070696_100165509 Ga0070696_1001655092 258
294 3300005548 Ga0070665_100012129 Ga0070665_1000121293 258
295 3300005548 Ga0070665_100035120 Ga0070665_1000351206 258
296 3300005548 Ga0070665_100121597 Ga0070665_1001215973 258
297 3300005548 Ga0070665_100166281 Ga0070665_1001662811 258
298 3300005548 Ga0070665_100355843 Ga0070665_1003558432 258
299 3300005549 Ga0070704_100253222 Ga0070704_1002532222 258
300 3300005563 Ga0068855_100317867 Ga0068855_1003178672 258
301 3300005564 Ga0070664_100119680 Ga0070664_1001196802 258
302 3300005564 Ga0070664_100204497 Ga0070664_1002044972 258
303 3300005564 Ga0070664_100247401 Ga0070664_1002474012 258
304 3300005564 Ga0070664_100438713 Ga0070664_1004387132 258
305 3300005577 Ga0068857_100013086 Ga0068857_1000130868 258
306 3300005577 Ga0068857_100190114 Ga0068857_1001901142 258
307 3300005614 Ga0068856_100406311 Ga0068856_1004063111 258
308 3300005615 Ga0070702_100020618 Ga0070702_1000206182 258
309 3300005616 Ga0068852_100030318 Ga0068852_1000303184 258
310 3300005616 Ga0068852_100778487 Ga0068852_1007784871 258
311 3300005617 Ga0068859_100001953 Ga0068859_10000195313 258
312 3300005617 Ga0068859_100024150 Ga0068859_1000241502 258
313 3300005617 Ga0068859_100147080 Ga0068859_1001470802 258
314 3300005617 Ga0068859_100150376 Ga0068859_1001503762 258
315 3300005617 Ga0068859_100178996 Ga0068859_1001789962 258
316 3300005617 Ga0068859_100497237 Ga0068859_1004972372 258
317 3300005618 Ga0068864_100001243 Ga0068864_10000124311 258
318 3300005618 Ga0068864_100006641 Ga0068864_1000066412 258
319 3300005618 Ga0068864_100007075 Ga0068864_1000070754 258
320 3300005618 Ga0068864_100114618 Ga0068864_1001146182 258
321 3300005618 Ga0068864_100303355 Ga0068864_1003033552 258
322 3300005719 Ga0068861_100021720 Ga0068861_1000217204 258
323 3300005719 Ga0068861_100023969 Ga0068861_1000239693 258
324 3300005719 Ga0068861_100035609 Ga0068861_1000356094 258
325 3300005719 Ga0068861_100149932 Ga0068861_1001499322 258
326 3300005834 Ga0068851_10003338 Ga0068851_100033387 258
327 3300005834 Ga0068851_10260142 Ga0068851_102601422 258
328 3300005840 Ga0068870_10008346 Ga0068870_100083463 258
329 3300005840 Ga0068870_10032403 Ga0068870_100324032 258
330 3300005840 Ga0068870_10130520 Ga0068870_101305202 258
331 3300005840 Ga0068870_10314546 Ga0068870_103145461 258
332 3300005841 Ga0068863_100009691 Ga0068863_1000096917 258
333 3300005841 Ga0068863_100025111 Ga0068863_1000251113 258
334 3300005841 Ga0068863_100030500 Ga0068863_1000305004 258
335 3300005841 Ga0068863_100043325 Ga0068863_1000433253 258
336 3300005841 Ga0068863_100152248 Ga0068863_1001522481 258
337 3300005842 Ga0068858_100002486 Ga0068858_10000248613 258
338 3300005842 Ga0068858_100005048 Ga0068858_1000050486 258
339 3300005842 Ga0068858_100099691 Ga0068858_1000996912 258
340 3300005843 Ga0068860_100037605 Ga0068860_1000376055 258
341 3300005843 Ga0068860_100100660 Ga0068860_1001006602 258
342 3300005843 Ga0068860_100102015 Ga0068860_1001020152 258
343 3300005843 Ga0068860_100120285 Ga0068860_1001202852 258
344 3300005843 Ga0068860_100327472 Ga0068860_1003274722 258
345 3300005844 Ga0068862_100005449 Ga0068862_1000054495 258
346 3300005844 Ga0068862_100009283 Ga0068862_1000092833 258
347 3300005844 Ga0068862_100031488 Ga0068862_1000314885 258
348 3300005844 Ga0068862_100034666 Ga0068862_1000346664 258
349 3300005844 Ga0068862_100117988 Ga0068862_1001179882 258
350 3300005844 Ga0068862_100381659 Ga0068862_1003816592 258
351 3300006237 Ga0097621_100026300 Ga0097621_1000263002 258
352 3300006237 Ga0097621_100148560 Ga0097621_1001485602 258
353 3300006237 Ga0097621_100172640 Ga0097621_1001726402 258
354 3300006237 Ga0097621_100237372 Ga0097621_1002373722 258
355 3300006358 Ga0068871_100030183 Ga0068871_1000301833 258
356 3300006358 Ga0068871_100030331 Ga0068871_1000303312 258
357 3300006358 Ga0068871_100151169 Ga0068871_1001511692 258
358 3300006852 Ga0075433_10240413 Ga0075433_102404132 258
359 3300006880 Ga0075429_100672666 Ga0075429_1006726662 258
360 3300006881 Ga0068865_100010655 Ga0068865_1000106554 258
361 3300006881 Ga0068865_100053153 Ga0068865_1000531532 258
362 3300006881 Ga0068865_100060405 Ga0068865_1000604053 258
363 3300006881 Ga0068865_100172785 Ga0068865_1001727852 258
364 3300006881 Ga0068865_100335436 Ga0068865_1003354362 258
365 3300006931 Ga0097620_100001953 Ga0097620_1000019536 258
366 3300006931 Ga0097620_100024149 Ga0097620_1000241492 258
367 3300006931 Ga0097620_100147089 Ga0097620_1001470893 258
368 3300006931 Ga0097620_100150376 Ga0097620_1001503762 258
369 3300006931 Ga0097620_100178995 Ga0097620_1001789952 258
370 3300006931 Ga0097620_100450787 Ga0097620_1004507872 258
371 3300006931 Ga0097620_100497243 Ga0097620_1004972432 258
372 3300007076 Ga0075435_100049857 Ga0075435_1000498572 258
373 3300007076 Ga0075435_100504303 Ga0075435_1005043032 258
374 3300009094 Ga0111539_10039807 Ga0111539_100398073 258
375 3300009101 Ga0105247_10166176 Ga0105247_101661762 258
376 3300009147 Ga0114129_10108012 Ga0114129_101080123 258
377 3300009148 Ga0105243_10054456 Ga0105243_100544564 258
378 3300009176 Ga0105242_10010222 Ga0105242_100102222 258
379 3300009176 Ga0105242_10020561 Ga0105242_100205614 258
380 3300009176 Ga0105242_10168470 Ga0105242_101684701 258
381 3300009177 Ga0105248_10022860 Ga0105248_100228602 258
382 3300009177 Ga0105248_10070681 Ga0105248_100706813 258
383 3300009177 Ga0105248_10143586 Ga0105248_101435862 258
384 3300009177 Ga0105248_10370123 Ga0105248_103701232 258
385 3300009177 Ga0105248_10839196 Ga0105248_108391962 258
386 3300009553 Ga0105249_10037658 Ga0105249_100376584 258
387 3300009553 Ga0105249_10126058 Ga0105249_101260582 258
388 3300009553 Ga0105249_10166060 Ga0105249_101660602 258
389 3300009553 Ga0105249_10321432 Ga0105249_103214322 258
390 3300010375 Ga0105239_10372883 Ga0105239_103728832 258
391 3300011119 Ga0105246_10056006 Ga0105246_100560063 258
392 3300013100 Ga0157373_10020479 Ga0157373_100204792 258
393 3300013104 Ga0157370_10027147 Ga0157370_100271473 258
394 3300013296 Ga0157374_10005174 Ga0157374_100051743 258
395 3300013296 Ga0157374_10007394 Ga0157374_100073947 258
396 3300013296 Ga0157374_10270641 Ga0157374_102706412 258
397 3300013297 Ga0157378_10070851 Ga0157378_100708512 258
398 3300013297 Ga0157378_10073140 Ga0157378_100731402 258
399 3300013297 Ga0157378_10254217 Ga0157378_102542172 258
400 3300013306 Ga0163162_10071050 Ga0163162_100710503 258
401 3300013306 Ga0163162_10093040 Ga0163162_100930404 258
402 3300013306 Ga0163162_10102097 Ga0163162_101020972 258
403 3300013306 Ga0163162_10191711 Ga0163162_101917112 258
404 3300013306 Ga0163162_10210271 Ga0163162_102102712 258
405 3300013306 Ga0163162_10212782 Ga0163162_102127821 258
406 3300013307 Ga0157372_10001809 Ga0157372_1000180921 258
407 3300013308 Ga0157375_10004231 Ga0157375_100042319 258
408 3300013308 Ga0157375_10112246 Ga0157375_101122463 258
409 3300013308 Ga0157375_10116543 Ga0157375_101165432 258
410 3300013308 Ga0157375_10187180 Ga0157375_101871802 258
411 3300013308 Ga0157375_10555305 Ga0157375_105553052 258
412 3300014325 Ga0163163_10007273 Ga0163163_100072739 258
413 3300014325 Ga0163163_10042499 Ga0163163_100424991 258
414 3300014325 Ga0163163_10143462 Ga0163163_101434622 258
415 3300014325 Ga0163163_10504262 Ga0163163_105042621 258
416 3300014326 Ga0157380_10017406 Ga0157380_100174062 258
417 3300014326 Ga0157380_10072892 Ga0157380_100728921 258
418 3300014326 Ga0157380_10304515 Ga0157380_103045152 258
419 3300014745 Ga0157377_10012385 Ga0157377_100123853 258
420 3300014968 Ga0157379_10000533 Ga0157379_1000053311 258
421 3300014968 Ga0157379_10015050 Ga0157379_100150503 258
422 3300014968 Ga0157379_10037128 Ga0157379_100371284 258
423 3300014969 Ga0157376_10004106 Ga0157376_100041061 258
424 3300014969 Ga0157376_10391430 Ga0157376_103914302 258
425 3300017792 Ga0163161_10023120 Ga0163161_100231202 258
426 3300017792 Ga0163161_10029370 Ga0163161_100293704 258
427 3300017792 Ga0163161_10096323 Ga0163161_100963232 258
428 3300025271 Ga0207666_1001994 Ga0207666_10019943 258
429 3300025290 Ga0207673_1000981 Ga0207673_10009813 258
430 3300025315 Ga0207697_10005168 Ga0207697_100051682 258
431 3300025315 Ga0207697_10009965 Ga0207697_100099653 258
432 3300025315 Ga0207697_10018739 Ga0207697_100187392 258
433 3300025315 Ga0207697_10057085 Ga0207697_100570852 258
434 3300025321 Ga0207656_10022098 Ga0207656_100220983 258
435 3300025893 Ga0207682_10011455 Ga0207682_100114555 258
436 3300025899 Ga0207642_10187453 Ga0207642_101874531 258
437 3300025900 Ga0207710_10046061 Ga0207710_100460613 258
438 3300025901 Ga0207688_10004759 Ga0207688_100047594 258
439 3300025901 Ga0207688_10030642 Ga0207688_100306422 258
440 3300025901 Ga0207688_10265275 Ga0207688_102652751 258
441 3300025903 Ga0207680_10009285 Ga0207680_100092855 258
442 3300025903 Ga0207680_10277024 Ga0207680_102770242 258
443 3300025907 Ga0207645_10000795 Ga0207645_1000079521 258
444 3300025907 Ga0207645_10003945 Ga0207645_100039459 258
445 3300025907 Ga0207645_10021354 Ga0207645_100213542 258
446 3300025907 Ga0207645_10242979 Ga0207645_102429792 258
447 3300025907 Ga0207645_10244361 Ga0207645_102443612 258
448 3300025908 Ga0207643_10002580 Ga0207643_100025803 258
449 3300025908 Ga0207643_10003232 Ga0207643_100032328 258
450 3300025908 Ga0207643_10169379 Ga0207643_101693792 258
451 3300025910 Ga0207684_10007136 Ga0207684_100071363 258
452 3300025912 Ga0207707_10016602 Ga0207707_100166024 258
453 3300025917 Ga0207660_10231795 Ga0207660_102317952 258
454 3300025918 Ga0207662_10007972 Ga0207662_100079723 258
455 3300025919 Ga0207657_10037377 Ga0207657_100373774 258
456 3300025920 Ga0207649_10009544 Ga0207649_100095443 258
457 3300025920 Ga0207649_10066902 Ga0207649_100669022 258
458 3300025921 Ga0207652_10018026 Ga0207652_100180263 258
459 3300025922 Ga0207646_10552235 Ga0207646_105522351 258
460 3300025923 Ga0207681_10015812 Ga0207681_100158122 258
461 3300025923 Ga0207681_10022327 Ga0207681_100223273 258
462 3300025923 Ga0207681_10030766 Ga0207681_100307662 258
463 3300025923 Ga0207681_10076808 Ga0207681_100768082 258
464 3300025923 Ga0207681_10078305 Ga0207681_100783052 258
465 3300025923 Ga0207681_10097230 Ga0207681_100972302 258
466 3300025925 Ga0207650_10002834 Ga0207650_100028349 258
467 3300025925 Ga0207650_10006285 Ga0207650_100062853 258
468 3300025925 Ga0207650_10013793 Ga0207650_100137935 258
469 3300025925 Ga0207650_10054190 Ga0207650_100541903 258
470 3300025926 Ga0207659_10009348 Ga0207659_100093485 258
471 3300025926 Ga0207659_10023048 Ga0207659_100230484 258
472 3300025926 Ga0207659_10036238 Ga0207659_100362382 258
473 3300025926 Ga0207659_10082194 Ga0207659_100821943 258
474 3300025926 Ga0207659_10145610 Ga0207659_101456102 258
475 3300025926 Ga0207659_10406298 Ga0207659_104062981 258
476 3300025931 Ga0207644_10049672 Ga0207644_100496722 258
477 3300025931 Ga0207644_10097547 Ga0207644_100975472 258
478 3300025931 Ga0207644_10130172 Ga0207644_101301721 258
479 3300025931 Ga0207644_10132004 Ga0207644_101320041 258
480 3300025932 Ga0207690_10064928 Ga0207690_100649282 258
481 3300025933 Ga0207706_10014824 Ga0207706_100148244 258
482 3300025933 Ga0207706_10068085 Ga0207706_100680852 258
483 3300025933 Ga0207706_10122911 Ga0207706_101229112 258
484 3300025934 Ga0207686_10178942 Ga0207686_101789422 258
485 3300025935 Ga0207709_10030941 Ga0207709_100309412 258
486 3300025936 Ga0207670_10027085 Ga0207670_100270854 258
487 3300025936 Ga0207670_10090654 Ga0207670_100906542 258
488 3300025937 Ga0207669_10037443 Ga0207669_100374432 258
489 3300025940 Ga0207691_10000528 Ga0207691_1000052824 258
490 3300025940 Ga0207691_10001035 Ga0207691_100010358 258
491 3300025940 Ga0207691_10005561 Ga0207691_100055617 258
492 3300025940 Ga0207691_10017366 Ga0207691_100173663 258
493 3300025940 Ga0207691_10063344 Ga0207691_100633442 258
494 3300025940 Ga0207691_10088604 Ga0207691_100886042 258
495 3300025941 Ga0207711_10033113 Ga0207711_100331133 258
496 3300025941 Ga0207711_10059772 Ga0207711_100597722 258
497 3300025941 Ga0207711_10144914 Ga0207711_101449141 258
498 3300025941 Ga0207711_10366051 Ga0207711_103660512 258
499 3300025942 Ga0207689_10001875 Ga0207689_100018753 258
500 3300025942 Ga0207689_10004867 Ga0207689_100048674 258
501 3300025942 Ga0207689_10010620 Ga0207689_100106206 258
502 3300025942 Ga0207689_10014572 Ga0207689_100145723 258
503 3300025944 Ga0207661_10064872 Ga0207661_100648722 258
504 3300025945 Ga0207679_10105592 Ga0207679_101055922 258
505 3300025945 Ga0207679_10201182 Ga0207679_102011822 258
506 3300025949 Ga0207667_10193992 Ga0207667_101939922 258
507 3300025960 Ga0207651_10014296 Ga0207651_100142962 258
508 3300025960 Ga0207651_10014314 Ga0207651_100143142 258
509 3300025960 Ga0207651_10154922 Ga0207651_101549222 258
510 3300025960 Ga0207651_10626530 Ga0207651_106265301 258
511 3300025961 Ga0207712_10247991 Ga0207712_102479911 258
512 3300025961 Ga0207712_10331447 Ga0207712_103314472 258
513 3300025961 Ga0207712_10547001 Ga0207712_105470011 258
514 3300025972 Ga0207668_10055777 Ga0207668_100557773 258
515 3300025972 Ga0207668_10533245 Ga0207668_105332452 258
516 3300025972 Ga0207668_10610507 Ga0207668_106105071 258
517 3300025986 Ga0207658_10005684 Ga0207658_100056845 258
518 3300025986 Ga0207658_10007838 Ga0207658_100078384 258
519 3300025986 Ga0207658_10018723 Ga0207658_100187234 258
520 3300025986 Ga0207658_10033076 Ga0207658_100330762 258
521 3300025986 Ga0207658_10053826 Ga0207658_100538264 258
522 3300025986 Ga0207658_10084704 Ga0207658_100847041 258
523 3300025986 Ga0207658_10135637 Ga0207658_101356372 258
524 3300025986 Ga0207658_10164949 Ga0207658_101649492 258
525 3300025986 Ga0207658_10581983 Ga0207658_105819832 258
526 3300026023 Ga0207677_10011392 Ga0207677_100113923 258
527 3300026023 Ga0207677_10032492 Ga0207677_100324922 258
528 3300026023 Ga0207677_10040993 Ga0207677_100409933 258
529 3300026023 Ga0207677_10045930 Ga0207677_100459304 258
530 3300026023 Ga0207677_10126976 Ga0207677_101269762 258
531 3300026035 Ga0207703_10001325 Ga0207703_1000132511 258
532 3300026035 Ga0207703_10045837 Ga0207703_100458372 258
533 3300026035 Ga0207703_10049562 Ga0207703_100495623 258
534 3300026041 Ga0207639_10050913 Ga0207639_100509134 258
535 3300026041 Ga0207639_10108700 Ga0207639_101087003 258
536 3300026041 Ga0207639_10108937 Ga0207639_101089372 258
537 3300026067 Ga0207678_10032073 Ga0207678_100320733 258
538 3300026067 Ga0207678_10143570 Ga0207678_101435702 258
539 3300026075 Ga0207708_10003466 Ga0207708_100034669 258
540 3300026075 Ga0207708_10040895 Ga0207708_100408952 258
541 3300026078 Ga0207702_10301918 Ga0207702_103019181 258
542 3300026088 Ga0207641_10019612 Ga0207641_100196123 258
543 3300026088 Ga0207641_10083944 Ga0207641_100839442 258
544 3300026088 Ga0207641_10269377 Ga0207641_102693772 258
545 3300026088 Ga0207641_10278802 Ga0207641_102788021 258
546 3300026088 Ga0207641_10318458 Ga0207641_103184582 258
547 3300026089 Ga0207648_10000236 Ga0207648_1000023641 258
548 3300026089 Ga0207648_10002943 Ga0207648_1000294316 258
549 3300026089 Ga0207648_10006732 Ga0207648_100067325 258
550 3300026089 Ga0207648_10018037 Ga0207648_100180372 258
551 3300026089 Ga0207648_10058080 Ga0207648_100580802 258
552 3300026089 Ga0207648_10278384 Ga0207648_102783842 258
553 3300026095 Ga0207676_10010490 Ga0207676_100104902 258
554 3300026095 Ga0207676_10020109 Ga0207676_100201092 258
555 3300026095 Ga0207676_10205149 Ga0207676_102051492 258
556 3300026116 Ga0207674_10009121 Ga0207674_100091212 258
557 3300026116 Ga0207674_10022439 Ga0207674_100224394 258
558 3300026118 Ga0207675_100002772 Ga0207675_1000027721 258
559 3300026118 Ga0207675_100024342 Ga0207675_1000243424 258
560 3300026118 Ga0207675_100025833 Ga0207675_1000258334 258
561 3300026118 Ga0207675_100026629 Ga0207675_1000266292 258
562 3300026118 Ga0207675_100031486 Ga0207675_1000314863 258
563 3300026118 Ga0207675_100066156 Ga0207675_1000661562 258
564 3300026121 Ga0207683_10003305 Ga0207683_100033055 258
565 3300026121 Ga0207683_10004270 Ga0207683_100042704 258
566 3300026121 Ga0207683_10009565 Ga0207683_100095652 258
567 3300026142 Ga0207698_10017782 Ga0207698_100177824 258
568 3300026142 Ga0207698_10198772 Ga0207698_101987722 258
569 3300027907 Ga0207428_10135599 Ga0207428_101355992 258
570 3300028379 Ga0268266_10013977 Ga0268266_100139776 258
571 3300028379 Ga0268266_10197536 Ga0268266_101975362 258
572 3300028380 Ga0268265_10022503 Ga0268265_100225032 258
573 3300028380 Ga0268265_10095655 Ga0268265_100956551 258
574 3300028380 Ga0268265_10150241 Ga0268265_101502412 258
575 3300028380 Ga0268265_10152755 Ga0268265_101527552 258
576 3300028380 Ga0268265_10725456 Ga0268265_107254562 258
577 3300028381 Ga0268264_10012464 Ga0268264_100124644 258
578 3300028381 Ga0268264_10082891 Ga0268264_100828913 258
579 3300028381 Ga0268264_10122148 Ga0268264_101221482 258
580 3300031235 Ga0265330_10002735 Ga0265330_100027352 258
581 3300031238 Ga0265332_10000088 Ga0265332_1000008839 258
582 3300031241 Ga0265325_10005155 Ga0265325_100051556 258
583 3300031242 Ga0265329_10001308 Ga0265329_100013086 258
584 3300031250 Ga0265331_10000214 Ga0265331_1000021417 258
585 3300031251 Ga0265327_10011172 Ga0265327_100111725 258
586 3300031595 Ga0265313_10138190 Ga0265313_101381901 258
587 3300031712 Ga0265342_10005461 Ga0265342_100054612 258
588 3300035692 Ga0373935_0051717 Ga0373935_0051717_1807_2583 258
589 3300035695 Ga0373927_0022459 Ga0373927_0022459_1599_2375 258
590 3300035695 Ga0373927_0313985 Ga0373927_0313985_172_951 258
591 3300035724 Ga0373933_0146638 Ga0373933_0146638_687_1463 258
592 3300036401 Ga0373937_0050361 Ga0373937_0050361_2394_3173 258
593 3300036401 Ga0373937_0298543 Ga0373937_0298543_220_1026 258
594 3300037068 Ga0373925_0084296 Ga0373925_0084296_1088_1867 258
595 3300046455 Ga0495603_0172187 Ga0495603_0172187_459_1235 258
596 3300046537 Ga0495598_0055407 Ga0495598_0055407_126_902 258
597 3300048903 Ga0496100_0109270 Ga0496100_0109270_520_1296 258
598 3300048904 Ga0496101_0013616 Ga0496101_0013616_977_1753 258
599 3300048905 Ga0496102_0125679 Ga0496102_0125679_348_1124 258
600 3300048906 Ga0496103_0025748 Ga0496103_0025748_1868_2644 258
601 3300048906 Ga0496103_0111637 Ga0496103_0111637_38_814 258
602 3300048907 Ga0496104_0044377 Ga0496104_0044377_3093_3869 258
603 3300048908 Ga0496105_0028062 Ga0496105_0028062_1909_2685 258
604 3300048909 Ga0496106_0009734 Ga0496106_0009734_3047_3823 258
605 3300048910 Ga0496107_0098338 Ga0496107_0098338_763_1539 258
606 3300048911 Ga0496108_0003218 Ga0496108_0003218_9982_10758 258
607 3300048911 Ga0496108_0251957 Ga0496108_0251957_482_1258 258
608 3300048912 Ga0496109_0012278 Ga0496109_0012278_4036_4812 258
609 3300048912 Ga0496109_0031434 Ga0496109_0031434_2819_3595 258
610 3300048912 Ga0496109_0218433 Ga0496109_0218433_840_1685 258
611 3300048912 Ga0496109_0254720 Ga0496109_0254720_735_1511 258
612 3300048913 Ga0496110_0012953 Ga0496110_0012953_2084_2860 258
613 3300048913 Ga0496110_0294668 Ga0496110_0294668_429_1205 258
614 3300048913 Ga0496110_0410281 Ga0496110_0410281_83_859 258
615 3300048914 Ga0496111_0216996 Ga0496111_0216996_476_1252 258
616 3300048915 Ga0496112_0319801 Ga0496112_0319801_123_899 258
617 3300048916 Ga0496113_0098363 Ga0496113_0098363_662_1438 258
618 3300048917 Ga0496114_0093701 Ga0496114_0093701_1013_1789 258
619 3300049571 Ga0501034_0096059 Ga0501034_0096059_844_1623 258
620 3300049581 Ga0501047_0115364 Ga0501047_0115364_1501_2280 258
621 3300049586 Ga0501070_0076227 Ga0501070_0076227_1456_2235 258
622 3300049588 Ga0501072_0183039 Ga0501072_0183039_642_1421 258
623 3300049589 Ga0501073_0052677 Ga0501073_0052677_60_839 258
624 3300049590 Ga0501074_0043412 Ga0501074_0043412_1712_2491 258
625 3300049742 Ga0501080_0022481 Ga0501080_0022481_3654_4433 258
626 3300049742 Ga0501080_0023269 Ga0501080_0023269_1661_2440 258
627 3300049744 Ga0501083_0066521 Ga0501083_0066521_269_1048 258
628 3300050507 nmdc:mga05p37_171678_c1 nmdc:mga05p37_171678_c1_423_1199 258
629 3300050511 nmdc:mga08y16_65012_c1 nmdc:mga08y16_65012_c1_1902_2678 258
630 3300050512 nmdc:mga0n895_148919_c1 nmdc:mga0n895_148919_c1_17_793 258
631 3300050513 nmdc:mga0rr50_106597_c1 nmdc:mga0rr50_106597_c1_488_1264 258
632 3300050513 nmdc:mga0rr50_395847_c1 nmdc:mga0rr50_395847_c1_183_959 258
633 3300050515 nmdc:mga0a205_8372_c1 nmdc:mga0a205_8372_c1_2314_3090 258
634 3300054114 Ga0501084_0130083 Ga0501084_0130083_384_1163 258
635 3300060353 Ga0501082_0434721 Ga0501082_0434721_204_983 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

29

272

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.9568 1 258
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.9566 1 258
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.9532 1 258
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.953 1 258
4f1r-assembly1.cif.gz_A structure analysis of the global metabolic regulator crc from pseudomonas aeruginos 0.9494 1 257
ID Description Score Start End Superfamily
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9558 1 258 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9522 1 258 3.60.10.10
4f1rA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9494 1 257 3.60.10.10
4f1rA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9423 1 257 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9383 1 256 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A496KI47-F1-model_v4 deleted 0.9684 3 172
AF-A0A497X7J2-F1-model_v4 deleted 0.9655 1 256
AF-A0A7V8K5Y8-F1-model_v4 DNA-(Apurinic or apyrimidinic site) lyase 0.9643 1 154 GO:0003677
GO:0003906
GO:0004519
GO:0006284
GO:0008081
GO:0008311
GO:0016829
GO:0046872
AF-A0A378Z4L5-F1-model_v4 deleted 0.9638 1 254
AF-A0A2C6XWG1-F1-model_v4 Exodeoxyribonuclease III 0.9618 1 178 GO:0003906
GO:0006284
GO:0008081
GO:0008311
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map