F471271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 635 | 271 | 635 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100172302|Ga0307409_1001723022 |
| Length | 283 |
| Sequence | VLRLPAVRIRQLVHSPRIRRDAWLYVRIITLNVNGIRAAERKGLASWLTRGAPWDVVCLQEIKANTDDVPRTLLSPRRAHAFFNAADKKGYAGVAMFARRAPTIVSGFGCAEFDCEGRYLEADFGELVVISVYLPSGSSGPHRQASKFRFLEAFLPHLVALRKREHKEIVLCGDWNIAHQPIDLKNWRANQKNSGFLPEERTWLTRVLDELGFVDVFRKVDPRPDQYTWWSNRGAAWAKNVGWRIDYQIATPGIAARARAVTIYKSKRFSDHAPLIIDYDYAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 3.94 |
| Rhizosphere | 95.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1017488 | 3300001976 | Bacteria | 935 |
| 2 | JGI24746J21847_1008802 | 3300001977 | Bacteria | 1519 |
| 3 | JGI24743J22301_10001559 | 3300001991 | Bacteria | 3214 |
| 4 | JGI24749J21850_1001835 | 3300002076 | Bacteria | 3007 |
| 5 | JGI24744J21845_10003872 | 3300002077 | Bacteria | 3092 |
| 6 | JGI24033J26618_1003279 | 3300002155 | Bacteria | 1700 |
| 7 | JGI24034J26672_10005905 | 3300002239 | Bacteria | 1762 |
| 8 | JGI24742J22300_10005690 | 3300002244 | Bacteria | 2050 |
| 9 | JGI24751J29686_10008600 | 3300002459 | Bacteria | 2090 |
| 10 | Ga0065715_10120554 | 3300005293 | Bacteria | 2245 |
| 11 | Ga0070676_10000582 | 3300005328 | Bacteria | 17650 |
| 12 | Ga0070676_10033110 | 3300005328 | Bacteria | 2964 |
| 13 | Ga0070676_10078061 | 3300005328 | Bacteria | 2002 |
| 14 | Ga0070683_100006211 | 3300005329 | Bacteria | 10017 |
| 15 | Ga0070690_100033909 | 3300005330 | Bacteria | 3197 |
| 16 | Ga0070690_100177377 | 3300005330 | Bacteria | 1471 |
| 17 | Ga0070670_100007133 | 3300005331 | Bacteria | 9464 |
| 18 | Ga0070670_100015616 | 3300005331 | Bacteria | 6521 |
| 19 | Ga0070670_100017778 | 3300005331 | Bacteria | 6100 |
| 20 | Ga0070670_100180362 | 3300005331 | Bacteria | 1833 |
| 21 | Ga0070670_100223678 | 3300005331 | Bacteria | 1638 |
| 22 | Ga0070677_10011301 | 3300005333 | Bacteria | 3075 |
| 23 | Ga0070677_10016659 | 3300005333 | Bacteria | 2619 |
| 24 | Ga0068869_100000101 | 3300005334 | Bacteria | 40237 |
| 25 | Ga0068869_100003229 | 3300005334 | Bacteria | 9959 |
| 26 | Ga0068869_100072344 | 3300005334 | Bacteria | 2554 |
| 27 | Ga0070666_10011252 | 3300005335 | Bacteria | 5613 |
| 28 | Ga0070666_10035182 | 3300005335 | Bacteria | 3321 |
| 29 | Ga0068868_100068334 | 3300005338 | Bacteria | 2829 |
| 30 | Ga0068868_100145146 | 3300005338 | Bacteria | 1951 |
| 31 | Ga0068868_100615534 | 3300005338 | Bacteria | 964 |
| 32 | Ga0070660_100105755 | 3300005339 | Bacteria | 2234 |
| 33 | Ga0070660_100122637 | 3300005339 | Bacteria | 2075 |
| 34 | Ga0070689_100043545 | 3300005340 | Bacteria | 3451 |
| 35 | Ga0070689_100094253 | 3300005340 | Bacteria | 2364 |
| 36 | Ga0070691_10092649 | 3300005341 | Bacteria | 1492 |
| 37 | Ga0070687_100003146 | 3300005343 | Bacteria | 6363 |
| 38 | Ga0070661_100034266 | 3300005344 | Bacteria | 3682 |
| 39 | Ga0070661_100036029 | 3300005344 | Bacteria | 3596 |
| 40 | Ga0070661_100116728 | 3300005344 | Bacteria | 1996 |
| 41 | Ga0070692_10053141 | 3300005345 | Bacteria | 2111 |
| 42 | Ga0070668_100011598 | 3300005347 | Bacteria | 6560 |
| 43 | Ga0070668_100140433 | 3300005347 | Bacteria | 1946 |
| 44 | Ga0070668_100170997 | 3300005347 | Bacteria | 1769 |
| 45 | Ga0070668_100251617 | 3300005347 | Bacteria | 1467 |
| 46 | Ga0070669_100011448 | 3300005353 | Bacteria | 6297 |
| 47 | Ga0070669_100073161 | 3300005353 | Bacteria | 2538 |
| 48 | Ga0070669_100094605 | 3300005353 | Bacteria | 2245 |
| 49 | Ga0070669_100101744 | 3300005353 | Bacteria | 2169 |
| 50 | Ga0070669_100315775 | 3300005353 | Bacteria | 1261 |
| 51 | Ga0070675_100033229 | 3300005354 | Bacteria | 4181 |
| 52 | Ga0070675_100046707 | 3300005354 | Bacteria | 3547 |
| 53 | Ga0070675_100058996 | 3300005354 | Bacteria | 3165 |
| 54 | Ga0070675_100073086 | 3300005354 | Bacteria | 2847 |
| 55 | Ga0070675_100447942 | 3300005354 | Bacteria | 1157 |
| 56 | Ga0070671_100003185 | 3300005355 | Bacteria | 12790 |
| 57 | Ga0070671_100007201 | 3300005355 | Bacteria | 8895 |
| 58 | Ga0070671_100009591 | 3300005355 | Bacteria | 7778 |
| 59 | Ga0070671_100137369 | 3300005355 | Bacteria | 2061 |
| 60 | Ga0070671_100236154 | 3300005355 | Bacteria | 1552 |
| 61 | Ga0070674_100004667 | 3300005356 | Bacteria | 7831 |
| 62 | Ga0070674_100014156 | 3300005356 | Bacteria | 4953 |
| 63 | Ga0070674_100018547 | 3300005356 | Bacteria | 4402 |
| 64 | Ga0070674_100054324 | 3300005356 | Bacteria | 2770 |
| 65 | Ga0070674_100241821 | 3300005356 | Bacteria | 1414 |
| 66 | Ga0070673_100008340 | 3300005364 | Bacteria | 6884 |
| 67 | Ga0070673_100014413 | 3300005364 | Bacteria | 5505 |
| 68 | Ga0070673_100086864 | 3300005364 | Bacteria | 2549 |
| 69 | Ga0070673_100177503 | 3300005364 | Bacteria | 1821 |
| 70 | Ga0070673_100372030 | 3300005364 | Bacteria | 1272 |
| 71 | Ga0070673_100807138 | 3300005364 | Bacteria | 867 |
| 72 | Ga0070688_100018552 | 3300005365 | Bacteria | 4017 |
| 73 | Ga0070688_100019921 | 3300005365 | Bacteria | 3892 |
| 74 | Ga0070659_100028845 | 3300005366 | Bacteria | 4287 |
| 75 | Ga0070659_100150973 | 3300005366 | Bacteria | 1895 |
| 76 | Ga0070667_100003822 | 3300005367 | Bacteria | 12797 |
| 77 | Ga0070667_100017178 | 3300005367 | Bacteria | 5993 |
| 78 | Ga0070667_100048938 | 3300005367 | Bacteria | 3560 |
| 79 | Ga0070667_100075952 | 3300005367 | Bacteria | 2868 |
| 80 | Ga0070667_100098304 | 3300005367 | Bacteria | 2526 |
| 81 | Ga0070667_100363530 | 3300005367 | Bacteria | 1312 |
| 82 | Ga0070714_100057060 | 3300005435 | Bacteria | 3341 |
| 83 | Ga0070713_100064169 | 3300005436 | Bacteria | 3081 |
| 84 | Ga0070701_10009413 | 3300005438 | Bacteria | 4279 |
| 85 | Ga0070701_10152927 | 3300005438 | Bacteria | 1330 |
| 86 | Ga0070701_10258761 | 3300005438 | Bacteria | 1054 |
| 87 | Ga0070711_100036125 | 3300005439 | Bacteria | 3309 |
| 88 | Ga0070705_100014680 | 3300005440 | Bacteria | 4035 |
| 89 | Ga0070705_100017785 | 3300005440 | Bacteria | 3716 |
| 90 | Ga0070700_100123583 | 3300005441 | Bacteria | 1737 |
| 91 | Ga0070700_100228906 | 3300005441 | Bacteria | 1322 |
| 92 | Ga0070708_100000765 | 3300005445 | Bacteria | 24224 |
| 93 | Ga0070708_100056589 | 3300005445 | Bacteria | 3489 |
| 94 | Ga0070663_100045585 | 3300005455 | Bacteria | 3098 |
| 95 | Ga0070663_100163290 | 3300005455 | Bacteria | 1716 |
| 96 | Ga0070678_100005241 | 3300005456 | Bacteria | 7463 |
| 97 | Ga0070678_100019333 | 3300005456 | Bacteria | 4437 |
| 98 | Ga0070678_100027756 | 3300005456 | Bacteria | 3848 |
| 99 | Ga0070678_100050066 | 3300005456 | Bacteria | 3019 |
| 100 | Ga0070678_100074777 | 3300005456 | Bacteria | 2547 |
| 101 | Ga0070662_100042000 | 3300005457 | Bacteria | 3265 |
| 102 | Ga0070662_100058187 | 3300005457 | Bacteria | 2812 |
| 103 | Ga0070662_100159677 | 3300005457 | Bacteria | 1762 |
| 104 | Ga0070662_100162626 | 3300005457 | Bacteria | 1747 |
| 105 | Ga0070662_100213485 | 3300005457 | Bacteria | 1537 |
| 106 | Ga0070681_10087147 | 3300005458 | Bacteria | 3075 |
| 107 | Ga0068867_100001715 | 3300005459 | Bacteria | 15268 |
| 108 | Ga0068867_100013860 | 3300005459 | Bacteria | 5707 |
| 109 | Ga0068867_100020492 | 3300005459 | Bacteria | 4712 |
| 110 | Ga0068867_100027565 | 3300005459 | Bacteria | 4084 |
| 111 | Ga0068867_100034834 | 3300005459 | Bacteria | 3650 |
| 112 | Ga0070685_10079196 | 3300005466 | Bacteria | 1966 |
| 113 | Ga0070685_10180722 | 3300005466 | Bacteria | 1358 |
| 114 | Ga0070706_100050343 | 3300005467 | Bacteria | 3844 |
| 115 | Ga0070706_100066252 | 3300005467 | Bacteria | 3341 |
| 116 | Ga0070706_100087344 | 3300005467 | Bacteria | 2890 |
| 117 | Ga0070707_100048377 | 3300005468 | Bacteria | 4074 |
| 118 | Ga0070698_100015525 | 3300005471 | Bacteria | 8044 |
| 119 | Ga0070698_100131847 | 3300005471 | Bacteria | 2454 |
| 120 | Ga0070699_100018088 | 3300005518 | Bacteria | 6054 |
| 121 | Ga0070679_100023723 | 3300005530 | Bacteria | 6011 |
| 122 | Ga0070684_100035002 | 3300005535 | Bacteria | 4296 |
| 123 | Ga0070684_100236770 | 3300005535 | Bacteria | 1667 |
| 124 | Ga0070697_100040737 | 3300005536 | Bacteria | 3759 |
| 125 | Ga0070697_100101576 | 3300005536 | Bacteria | 2389 |
| 126 | Ga0068853_100120663 | 3300005539 | Bacteria | 2338 |
| 127 | Ga0068853_100231584 | 3300005539 | Bacteria | 1690 |
| 128 | Ga0068853_100453230 | 3300005539 | Bacteria | 1207 |
| 129 | Ga0070672_100000610 | 3300005543 | Bacteria | 21037 |
| 130 | Ga0070672_100010649 | 3300005543 | Bacteria | 6386 |
| 131 | Ga0070672_100054497 | 3300005543 | Bacteria | 3130 |
| 132 | Ga0070672_100070376 | 3300005543 | Bacteria | 2780 |
| 133 | Ga0070672_100071851 | 3300005543 | Bacteria | 2754 |
| 134 | Ga0070672_100076386 | 3300005543 | Bacteria | 2676 |
| 135 | Ga0070672_100152287 | 3300005543 | Bacteria | 1913 |
| 136 | Ga0070686_100028352 | 3300005544 | Bacteria | 3395 |
| 137 | Ga0070696_100165509 | 3300005546 | Bacteria | 1632 |
| 138 | Ga0070696_100220065 | 3300005546 | Bacteria | 1424 |
| 139 | Ga0070693_100188205 | 3300005547 | Bacteria | 1333 |
| 140 | Ga0070665_100012129 | 3300005548 | Bacteria | 8694 |
| 141 | Ga0070665_100035120 | 3300005548 | Bacteria | 5040 |
| 142 | Ga0070665_100121597 | 3300005548 | Bacteria | 2612 |
| 143 | Ga0070665_100166281 | 3300005548 | Bacteria | 2208 |
| 144 | Ga0070665_100355843 | 3300005548 | Bacteria | 1470 |
| 145 | Ga0070704_100164594 | 3300005549 | Bacteria | 1757 |
| 146 | Ga0070704_100253222 | 3300005549 | Bacteria | 1447 |
| 147 | Ga0068855_100317867 | 3300005563 | Bacteria | 1722 |
| 148 | Ga0070664_100119680 | 3300005564 | Bacteria | 2304 |
| 149 | Ga0070664_100127283 | 3300005564 | Bacteria | 2235 |
| 150 | Ga0070664_100204497 | 3300005564 | Bacteria | 1763 |
| 151 | Ga0070664_100247401 | 3300005564 | Bacteria | 1602 |
| 152 | Ga0070664_100438713 | 3300005564 | Bacteria | 1198 |
| 153 | Ga0068857_100013086 | 3300005577 | Bacteria | 7230 |
| 154 | Ga0068857_100190114 | 3300005577 | Bacteria | 1870 |
| 155 | Ga0068854_100171310 | 3300005578 | Bacteria | 1689 |
| 156 | Ga0068854_100264047 | 3300005578 | Bacteria | 1379 |
| 157 | Ga0068856_100406311 | 3300005614 | Bacteria | 1381 |
| 158 | Ga0070702_100020618 | 3300005615 | Bacteria | 3455 |
| 159 | Ga0070702_100060464 | 3300005615 | Bacteria | 2203 |
| 160 | Ga0068852_100030318 | 3300005616 | Bacteria | 4451 |
| 161 | Ga0068852_100034401 | 3300005616 | Bacteria | 4215 |
| 162 | Ga0068852_100073533 | 3300005616 | Bacteria | 3007 |
| 163 | Ga0068852_100778487 | 3300005616 | Bacteria | 970 |
| 164 | Ga0068859_100001953 | 3300005617 | Bacteria | 21020 |
| 165 | Ga0068859_100024150 | 3300005617 | Bacteria | 6100 |
| 166 | Ga0068859_100147080 | 3300005617 | Bacteria | 2431 |
| 167 | Ga0068859_100150376 | 3300005617 | Bacteria | 2404 |
| 168 | Ga0068859_100178996 | 3300005617 | Bacteria | 2203 |
| 169 | Ga0068859_100497237 | 3300005617 | Bacteria | 1315 |
| 170 | Ga0068864_100001243 | 3300005618 | Bacteria | 21215 |
| 171 | Ga0068864_100006641 | 3300005618 | Bacteria | 9472 |
| 172 | Ga0068864_100007075 | 3300005618 | Bacteria | 9212 |
| 173 | Ga0068864_100114618 | 3300005618 | Bacteria | 2403 |
| 174 | Ga0068864_100303355 | 3300005618 | Bacteria | 1496 |
| 175 | Ga0068864_100311938 | 3300005618 | Bacteria | 1475 |
| 176 | Ga0068866_10327655 | 3300005718 | Bacteria | 965 |
| 177 | Ga0068861_100021720 | 3300005719 | Bacteria | 4615 |
| 178 | Ga0068861_100023969 | 3300005719 | Bacteria | 4408 |
| 179 | Ga0068861_100035609 | 3300005719 | Bacteria | 3688 |
| 180 | Ga0068861_100149932 | 3300005719 | Bacteria | 1912 |
| 181 | Ga0068851_10003338 | 3300005834 | Bacteria | 7136 |
| 182 | Ga0068851_10260142 | 3300005834 | Bacteria | 987 |
| 183 | Ga0068870_10008346 | 3300005840 | Bacteria | 4656 |
| 184 | Ga0068870_10032403 | 3300005840 | Bacteria | 2656 |
| 185 | Ga0068870_10130520 | 3300005840 | Bacteria | 1459 |
| 186 | Ga0068870_10314546 | 3300005840 | Bacteria | 993 |
| 187 | Ga0068863_100009691 | 3300005841 | Bacteria | 9398 |
| 188 | Ga0068863_100025111 | 3300005841 | Bacteria | 5683 |
| 189 | Ga0068863_100030500 | 3300005841 | Bacteria | 5148 |
| 190 | Ga0068863_100043325 | 3300005841 | Bacteria | 4273 |
| 191 | Ga0068863_100152248 | 3300005841 | Bacteria | 2213 |
| 192 | Ga0068863_100167734 | 3300005841 | Bacteria | 2105 |
| 193 | Ga0068858_100002486 | 3300005842 | Bacteria | 18604 |
| 194 | Ga0068858_100005048 | 3300005842 | Bacteria | 12939 |
| 195 | Ga0068858_100099691 | 3300005842 | Bacteria | 2709 |
| 196 | Ga0068858_100260493 | 3300005842 | Bacteria | 1648 |
| 197 | Ga0068860_100037605 | 3300005843 | Bacteria | 4633 |
| 198 | Ga0068860_100098960 | 3300005843 | Bacteria | 2781 |
| 199 | Ga0068860_100100660 | 3300005843 | Bacteria | 2757 |
| 200 | Ga0068860_100102015 | 3300005843 | Bacteria | 2737 |
| 201 | Ga0068860_100120285 | 3300005843 | Bacteria | 2514 |
| 202 | Ga0068860_100327472 | 3300005843 | Bacteria | 1504 |
| 203 | Ga0068862_100005449 | 3300005844 | Bacteria | 10632 |
| 204 | Ga0068862_100009283 | 3300005844 | Bacteria | 8141 |
| 205 | Ga0068862_100031488 | 3300005844 | Bacteria | 4478 |
| 206 | Ga0068862_100034666 | 3300005844 | Bacteria | 4272 |
| 207 | Ga0068862_100117988 | 3300005844 | Bacteria | 2336 |
| 208 | Ga0068862_100381659 | 3300005844 | Bacteria | 1314 |
| 209 | Ga0081539_10000686 | 3300005985 | Bacteria | 67858 |
| 210 | Ga0070717_10562461 | 3300006028 | Bacteria | 1033 |
| 211 | Ga0070712_100052047 | 3300006175 | Bacteria | 2854 |
| 212 | Ga0075366_10026852 | 3300006195 | Bacteria | 3375 |
| 213 | Ga0097621_100026300 | 3300006237 | Bacteria | 4563 |
| 214 | Ga0097621_100086906 | 3300006237 | Bacteria | 2610 |
| 215 | Ga0097621_100148560 | 3300006237 | Bacteria | 2008 |
| 216 | Ga0097621_100172640 | 3300006237 | Bacteria | 1864 |
| 217 | Ga0097621_100198195 | 3300006237 | Bacteria | 1742 |
| 218 | Ga0097621_100237372 | 3300006237 | Bacteria | 1593 |
| 219 | Ga0068871_100030183 | 3300006358 | Bacteria | 4266 |
| 220 | Ga0068871_100030331 | 3300006358 | Bacteria | 4257 |
| 221 | Ga0068871_100080829 | 3300006358 | Bacteria | 2692 |
| 222 | Ga0068871_100101420 | 3300006358 | Bacteria | 2412 |
| 223 | Ga0068871_100151169 | 3300006358 | Bacteria | 1980 |
| 224 | Ga0075433_10240413 | 3300006852 | Bacteria | 1607 |
| 225 | Ga0075433_10275937 | 3300006852 | Bacteria | 1490 |
| 226 | Ga0075434_100251710 | 3300006871 | Bacteria | 1786 |
| 227 | Ga0075429_100672666 | 3300006880 | Bacteria | 907 |
| 228 | Ga0068865_100010655 | 3300006881 | Bacteria | 5731 |
| 229 | Ga0068865_100053153 | 3300006881 | Bacteria | 2810 |
| 230 | Ga0068865_100060405 | 3300006881 | Bacteria | 2654 |
| 231 | Ga0068865_100145724 | 3300006881 | Bacteria | 1791 |
| 232 | Ga0068865_100172785 | 3300006881 | Bacteria | 1658 |
| 233 | Ga0068865_100335436 | 3300006881 | Bacteria | 1220 |
| 234 | Ga0075436_100009781 | 3300006914 | Bacteria | 6556 |
| 235 | Ga0075436_100136287 | 3300006914 | Bacteria | 1724 |
| 236 | Ga0097620_100001953 | 3300006931 | Bacteria | 21020 |
| 237 | Ga0097620_100024149 | 3300006931 | Bacteria | 6100 |
| 238 | Ga0097620_100147089 | 3300006931 | Bacteria | 2431 |
| 239 | Ga0097620_100150376 | 3300006931 | Bacteria | 2404 |
| 240 | Ga0097620_100178995 | 3300006931 | Bacteria | 2203 |
| 241 | Ga0097620_100450787 | 3300006931 | Bacteria | 1383 |
| 242 | Ga0097620_100497243 | 3300006931 | Bacteria | 1315 |
| 243 | Ga0075435_100049857 | 3300007076 | Bacteria | 3368 |
| 244 | Ga0075435_100504303 | 3300007076 | Bacteria | 1046 |
| 245 | Ga0105240_10197050 | 3300009093 | Bacteria | 2363 |
| 246 | Ga0111539_10039807 | 3300009094 | Bacteria | 5663 |
| 247 | Ga0105245_10272491 | 3300009098 | Bacteria | 1651 |
| 248 | Ga0105245_10486823 | 3300009098 | Bacteria | 1248 |
| 249 | Ga0105247_10024074 | 3300009101 | Bacteria | 3667 |
| 250 | Ga0105247_10166176 | 3300009101 | Bacteria | 1464 |
| 251 | Ga0114129_10108012 | 3300009147 | Bacteria | 3842 |
| 252 | Ga0105243_10054456 | 3300009148 | Bacteria | 3176 |
| 253 | Ga0105242_10010222 | 3300009176 | Bacteria | 7194 |
| 254 | Ga0105242_10020561 | 3300009176 | Bacteria | 5178 |
| 255 | Ga0105242_10131357 | 3300009176 | Bacteria | 2162 |
| 256 | Ga0105242_10168470 | 3300009176 | Bacteria | 1923 |
| 257 | Ga0105248_10022860 | 3300009177 | Bacteria | 6942 |
| 258 | Ga0105248_10070681 | 3300009177 | Bacteria | 3920 |
| 259 | Ga0105248_10143586 | 3300009177 | Bacteria | 2693 |
| 260 | Ga0105248_10224819 | 3300009177 | Bacteria | 2113 |
| 261 | Ga0105248_10370123 | 3300009177 | Bacteria | 1613 |
| 262 | Ga0105248_10839196 | 3300009177 | Bacteria | 1037 |
| 263 | Ga0105237_10045809 | 3300009545 | Bacteria | 4400 |
| 264 | Ga0105238_10479946 | 3300009551 | Bacteria | 1242 |
| 265 | Ga0105249_10037658 | 3300009553 | Bacteria | 4389 |
| 266 | Ga0105249_10126058 | 3300009553 | Bacteria | 2438 |
| 267 | Ga0105249_10166060 | 3300009553 | Bacteria | 2137 |
| 268 | Ga0105249_10321432 | 3300009553 | Bacteria | 1559 |
| 269 | Ga0105239_10372883 | 3300010375 | Bacteria | 1613 |
| 270 | Ga0105246_10056006 | 3300011119 | Bacteria | 2723 |
| 271 | Ga0157373_10020479 | 3300013100 | Bacteria | 4807 |
| 272 | Ga0157370_10027147 | 3300013104 | Bacteria | 5646 |
| 273 | Ga0157369_10127324 | 3300013105 | Bacteria | 2699 |
| 274 | Ga0157374_10005174 | 3300013296 | Bacteria | 10939 |
| 275 | Ga0157374_10007394 | 3300013296 | Bacteria | 9368 |
| 276 | Ga0157374_10270641 | 3300013296 | Bacteria | 1675 |
| 277 | Ga0157378_10053841 | 3300013297 | Bacteria | 3583 |
| 278 | Ga0157378_10070851 | 3300013297 | Bacteria | 3130 |
| 279 | Ga0157378_10073140 | 3300013297 | Bacteria | 3081 |
| 280 | Ga0157378_10254217 | 3300013297 | Bacteria | 1683 |
| 281 | Ga0163162_10071050 | 3300013306 | Bacteria | 3533 |
| 282 | Ga0163162_10093040 | 3300013306 | Bacteria | 3099 |
| 283 | Ga0163162_10102097 | 3300013306 | Bacteria | 2961 |
| 284 | Ga0163162_10191711 | 3300013306 | Bacteria | 2172 |
| 285 | Ga0163162_10210271 | 3300013306 | Bacteria | 2075 |
| 286 | Ga0163162_10212782 | 3300013306 | Bacteria | 2063 |
| 287 | Ga0163162_10509803 | 3300013306 | Bacteria | 1333 |
| 288 | Ga0157372_10001809 | 3300013307 | Bacteria | 23215 |
| 289 | Ga0157372_10624699 | 3300013307 | Bacteria | 1255 |
| 290 | Ga0157375_10004231 | 3300013308 | Bacteria | 12447 |
| 291 | Ga0157375_10112246 | 3300013308 | Bacteria | 2826 |
| 292 | Ga0157375_10116543 | 3300013308 | Bacteria | 2776 |
| 293 | Ga0157375_10187180 | 3300013308 | Bacteria | 2224 |
| 294 | Ga0157375_10290625 | 3300013308 | Bacteria | 1798 |
| 295 | Ga0157375_10555305 | 3300013308 | Bacteria | 1310 |
| 296 | Ga0163163_10007273 | 3300014325 | Bacteria | 9764 |
| 297 | Ga0163163_10042499 | 3300014325 | Bacteria | 4452 |
| 298 | Ga0163163_10143462 | 3300014325 | Bacteria | 2431 |
| 299 | Ga0163163_10292951 | 3300014325 | Bacteria | 1680 |
| 300 | Ga0163163_10504262 | 3300014325 | Bacteria | 1272 |
| 301 | Ga0157380_10017406 | 3300014326 | Bacteria | 5319 |
| 302 | Ga0157380_10072892 | 3300014326 | Bacteria | 2783 |
| 303 | Ga0157380_10304515 | 3300014326 | Bacteria | 1470 |
| 304 | Ga0157377_10012385 | 3300014745 | Bacteria | 4289 |
| 305 | Ga0157379_10000533 | 3300014968 | Bacteria | 30715 |
| 306 | Ga0157379_10015050 | 3300014968 | Bacteria | 6785 |
| 307 | Ga0157379_10037128 | 3300014968 | Bacteria | 4344 |
| 308 | Ga0157379_10060468 | 3300014968 | Bacteria | 3387 |
| 309 | Ga0157376_10004106 | 3300014969 | Bacteria | 10081 |
| 310 | Ga0157376_10112040 | 3300014969 | Bacteria | 2403 |
| 311 | Ga0157376_10391430 | 3300014969 | Bacteria | 1341 |
| 312 | Ga0163161_10023120 | 3300017792 | Bacteria | 4381 |
| 313 | Ga0163161_10029370 | 3300017792 | Bacteria | 3909 |
| 314 | Ga0163161_10066102 | 3300017792 | Bacteria | 2640 |
| 315 | Ga0163161_10096323 | 3300017792 | Bacteria | 2196 |
| 316 | Ga0207666_1001994 | 3300025271 | Bacteria | 2438 |
| 317 | Ga0207673_1000981 | 3300025290 | Bacteria | 3069 |
| 318 | Ga0207697_10005168 | 3300025315 | Bacteria | 6092 |
| 319 | Ga0207697_10009965 | 3300025315 | Bacteria | 4082 |
| 320 | Ga0207697_10018739 | 3300025315 | Bacteria | 2837 |
| 321 | Ga0207697_10057085 | 3300025315 | Bacteria | 1620 |
| 322 | Ga0207656_10022098 | 3300025321 | Bacteria | 2549 |
| 323 | Ga0207682_10011455 | 3300025893 | Bacteria | 3462 |
| 324 | Ga0207642_10066769 | 3300025899 | Bacteria | 1695 |
| 325 | Ga0207642_10187453 | 3300025899 | Bacteria | 1132 |
| 326 | Ga0207710_10046061 | 3300025900 | Bacteria | 1946 |
| 327 | Ga0207688_10004759 | 3300025901 | Bacteria | 7391 |
| 328 | Ga0207688_10030642 | 3300025901 | Bacteria | 2967 |
| 329 | Ga0207688_10265275 | 3300025901 | Bacteria | 1043 |
| 330 | Ga0207680_10009285 | 3300025903 | Bacteria | 4872 |
| 331 | Ga0207680_10277024 | 3300025903 | Bacteria | 1165 |
| 332 | Ga0207645_10000795 | 3300025907 | Bacteria | 26434 |
| 333 | Ga0207645_10003945 | 3300025907 | Bacteria | 11078 |
| 334 | Ga0207645_10021354 | 3300025907 | Bacteria | 4222 |
| 335 | Ga0207645_10242979 | 3300025907 | Bacteria | 1190 |
| 336 | Ga0207645_10244361 | 3300025907 | Bacteria | 1186 |
| 337 | Ga0207643_10002580 | 3300025908 | Bacteria | 9808 |
| 338 | Ga0207643_10003232 | 3300025908 | Bacteria | 8789 |
| 339 | Ga0207643_10169379 | 3300025908 | Bacteria | 1317 |
| 340 | Ga0207684_10007136 | 3300025910 | Bacteria | 10096 |
| 341 | Ga0207707_10016602 | 3300025912 | Bacteria | 6419 |
| 342 | Ga0207663_10192414 | 3300025916 | Bacteria | 1465 |
| 343 | Ga0207660_10231795 | 3300025917 | Bacteria | 1452 |
| 344 | Ga0207662_10007972 | 3300025918 | Bacteria | 5772 |
| 345 | Ga0207662_10146086 | 3300025918 | Bacteria | 1501 |
| 346 | Ga0207657_10015204 | 3300025919 | Bacteria | 7468 |
| 347 | Ga0207657_10037377 | 3300025919 | Bacteria | 4336 |
| 348 | Ga0207649_10009544 | 3300025920 | Bacteria | 5313 |
| 349 | Ga0207649_10066902 | 3300025920 | Bacteria | 2279 |
| 350 | Ga0207652_10018026 | 3300025921 | Bacteria | 5786 |
| 351 | Ga0207652_10255545 | 3300025921 | Bacteria | 1580 |
| 352 | Ga0207646_10552235 | 3300025922 | Bacteria | 1035 |
| 353 | Ga0207681_10015812 | 3300025923 | Bacteria | 4711 |
| 354 | Ga0207681_10022327 | 3300025923 | Bacteria | 4036 |
| 355 | Ga0207681_10030766 | 3300025923 | Bacteria | 3502 |
| 356 | Ga0207681_10076808 | 3300025923 | Bacteria | 2346 |
| 357 | Ga0207681_10078305 | 3300025923 | Bacteria | 2326 |
| 358 | Ga0207681_10097230 | 3300025923 | Bacteria | 2115 |
| 359 | Ga0207650_10002834 | 3300025925 | Bacteria | 11978 |
| 360 | Ga0207650_10006285 | 3300025925 | Bacteria | 8094 |
| 361 | Ga0207650_10013793 | 3300025925 | Bacteria | 5604 |
| 362 | Ga0207650_10054190 | 3300025925 | Bacteria | 2974 |
| 363 | Ga0207659_10009348 | 3300025926 | Bacteria | 6121 |
| 364 | Ga0207659_10023048 | 3300025926 | Bacteria | 4151 |
| 365 | Ga0207659_10036238 | 3300025926 | Bacteria | 3415 |
| 366 | Ga0207659_10082194 | 3300025926 | Bacteria | 2384 |
| 367 | Ga0207659_10145610 | 3300025926 | Bacteria | 1844 |
| 368 | Ga0207659_10406298 | 3300025926 | Bacteria | 1140 |
| 369 | Ga0207687_10006409 | 3300025927 | Bacteria | 7773 |
| 370 | Ga0207700_10207056 | 3300025928 | Bacteria | 1656 |
| 371 | Ga0207700_10573402 | 3300025928 | Bacteria | 1003 |
| 372 | Ga0207664_10100262 | 3300025929 | Bacteria | 2391 |
| 373 | Ga0207644_10049672 | 3300025931 | Bacteria | 3004 |
| 374 | Ga0207644_10097547 | 3300025931 | Bacteria | 2201 |
| 375 | Ga0207644_10130172 | 3300025931 | Bacteria | 1925 |
| 376 | Ga0207644_10132004 | 3300025931 | Bacteria | 1913 |
| 377 | Ga0207690_10064928 | 3300025932 | Bacteria | 2494 |
| 378 | Ga0207690_10125586 | 3300025932 | Bacteria | 1870 |
| 379 | Ga0207706_10014824 | 3300025933 | Bacteria | 7057 |
| 380 | Ga0207706_10068085 | 3300025933 | Bacteria | 3133 |
| 381 | Ga0207706_10122911 | 3300025933 | Bacteria | 2283 |
| 382 | Ga0207706_10193319 | 3300025933 | Bacteria | 1785 |
| 383 | Ga0207706_10324877 | 3300025933 | Bacteria | 1339 |
| 384 | Ga0207686_10009410 | 3300025934 | Bacteria | 5300 |
| 385 | Ga0207686_10178942 | 3300025934 | Bacteria | 1502 |
| 386 | Ga0207709_10030941 | 3300025935 | Bacteria | 3119 |
| 387 | Ga0207670_10027085 | 3300025936 | Bacteria | 3620 |
| 388 | Ga0207670_10090654 | 3300025936 | Bacteria | 2160 |
| 389 | Ga0207669_10037443 | 3300025937 | Bacteria | 2783 |
| 390 | Ga0207669_10061421 | 3300025937 | Bacteria | 2309 |
| 391 | Ga0207704_10023927 | 3300025938 | Bacteria | 3301 |
| 392 | Ga0207665_10026042 | 3300025939 | Bacteria | 3859 |
| 393 | Ga0207665_10041570 | 3300025939 | Bacteria | 3071 |
| 394 | Ga0207691_10000528 | 3300025940 | Bacteria | 38155 |
| 395 | Ga0207691_10001035 | 3300025940 | Bacteria | 27578 |
| 396 | Ga0207691_10005561 | 3300025940 | Bacteria | 12175 |
| 397 | Ga0207691_10017366 | 3300025940 | Bacteria | 6825 |
| 398 | Ga0207691_10044014 | 3300025940 | Bacteria | 4111 |
| 399 | Ga0207691_10063344 | 3300025940 | Bacteria | 3353 |
| 400 | Ga0207691_10088604 | 3300025940 | Bacteria | 2775 |
| 401 | Ga0207691_10350795 | 3300025940 | Bacteria | 1262 |
| 402 | Ga0207711_10018949 | 3300025941 | Bacteria | 5725 |
| 403 | Ga0207711_10033113 | 3300025941 | Bacteria | 4371 |
| 404 | Ga0207711_10059772 | 3300025941 | Bacteria | 3282 |
| 405 | Ga0207711_10144914 | 3300025941 | Bacteria | 2139 |
| 406 | Ga0207711_10150215 | 3300025941 | Bacteria | 2101 |
| 407 | Ga0207711_10366051 | 3300025941 | Bacteria | 1336 |
| 408 | Ga0207689_10001875 | 3300025942 | Bacteria | 19898 |
| 409 | Ga0207689_10004867 | 3300025942 | Bacteria | 12104 |
| 410 | Ga0207689_10010620 | 3300025942 | Bacteria | 7926 |
| 411 | Ga0207689_10014572 | 3300025942 | Bacteria | 6685 |
| 412 | Ga0207661_10064872 | 3300025944 | Bacteria | 2962 |
| 413 | Ga0207661_10448272 | 3300025944 | Bacteria | 1175 |
| 414 | Ga0207679_10105592 | 3300025945 | Bacteria | 2212 |
| 415 | Ga0207679_10201182 | 3300025945 | Bacteria | 1664 |
| 416 | Ga0207667_10193992 | 3300025949 | Bacteria | 2084 |
| 417 | Ga0207651_10014296 | 3300025960 | Bacteria | 4577 |
| 418 | Ga0207651_10014314 | 3300025960 | Bacteria | 4574 |
| 419 | Ga0207651_10154922 | 3300025960 | Bacteria | 1788 |
| 420 | Ga0207651_10613302 | 3300025960 | Bacteria | 952 |
| 421 | Ga0207651_10626530 | 3300025960 | Bacteria | 942 |
| 422 | Ga0207712_10247991 | 3300025961 | Bacteria | 1438 |
| 423 | Ga0207712_10331447 | 3300025961 | Bacteria | 1259 |
| 424 | Ga0207712_10547001 | 3300025961 | Bacteria | 995 |
| 425 | Ga0207668_10055777 | 3300025972 | Bacteria | 2748 |
| 426 | Ga0207668_10533245 | 3300025972 | Bacteria | 1014 |
| 427 | Ga0207668_10610507 | 3300025972 | Bacteria | 951 |
| 428 | Ga0207640_10047069 | 3300025981 | Bacteria | 2779 |
| 429 | Ga0207640_10080815 | 3300025981 | Bacteria | 2220 |
| 430 | Ga0207658_10005684 | 3300025986 | Bacteria | 8527 |
| 431 | Ga0207658_10007838 | 3300025986 | Bacteria | 7272 |
| 432 | Ga0207658_10018723 | 3300025986 | Bacteria | 4787 |
| 433 | Ga0207658_10033076 | 3300025986 | Bacteria | 3686 |
| 434 | Ga0207658_10053826 | 3300025986 | Bacteria | 2975 |
| 435 | Ga0207658_10084704 | 3300025986 | Bacteria | 2440 |
| 436 | Ga0207658_10126391 | 3300025986 | Bacteria | 2047 |
| 437 | Ga0207658_10135637 | 3300025986 | Bacteria | 1984 |
| 438 | Ga0207658_10164949 | 3300025986 | Bacteria | 1819 |
| 439 | Ga0207658_10581983 | 3300025986 | Bacteria | 1004 |
| 440 | Ga0207677_10011392 | 3300026023 | Bacteria | 5069 |
| 441 | Ga0207677_10032492 | 3300026023 | Bacteria | 3356 |
| 442 | Ga0207677_10040993 | 3300026023 | Bacteria | 3058 |
| 443 | Ga0207677_10045930 | 3300026023 | Bacteria | 2920 |
| 444 | Ga0207677_10126976 | 3300026023 | Bacteria | 1929 |
| 445 | Ga0207703_10001325 | 3300026035 | Bacteria | 22715 |
| 446 | Ga0207703_10045837 | 3300026035 | Bacteria | 3518 |
| 447 | Ga0207703_10049562 | 3300026035 | Bacteria | 3395 |
| 448 | Ga0207703_10240027 | 3300026035 | Bacteria | 1629 |
| 449 | Ga0207703_10435042 | 3300026035 | Bacteria | 1223 |
| 450 | Ga0207639_10050913 | 3300026041 | Bacteria | 3147 |
| 451 | Ga0207639_10108700 | 3300026041 | Bacteria | 2255 |
| 452 | Ga0207639_10108937 | 3300026041 | Bacteria | 2253 |
| 453 | Ga0207639_10327039 | 3300026041 | Bacteria | 1363 |
| 454 | Ga0207678_10032073 | 3300026067 | Bacteria | 4580 |
| 455 | Ga0207678_10074420 | 3300026067 | Bacteria | 2910 |
| 456 | Ga0207678_10143570 | 3300026067 | Bacteria | 2037 |
| 457 | Ga0207708_10003466 | 3300026075 | Bacteria | 11626 |
| 458 | Ga0207708_10040895 | 3300026075 | Bacteria | 3535 |
| 459 | Ga0207702_10050515 | 3300026078 | Bacteria | 3511 |
| 460 | Ga0207702_10301918 | 3300026078 | Bacteria | 1520 |
| 461 | Ga0207641_10019612 | 3300026088 | Bacteria | 5552 |
| 462 | Ga0207641_10083944 | 3300026088 | Bacteria | 2771 |
| 463 | Ga0207641_10269377 | 3300026088 | Bacteria | 1597 |
| 464 | Ga0207641_10278802 | 3300026088 | Bacteria | 1571 |
| 465 | Ga0207641_10318458 | 3300026088 | Bacteria | 1474 |
| 466 | Ga0207648_10000236 | 3300026089 | Bacteria | 59280 |
| 467 | Ga0207648_10002943 | 3300026089 | Bacteria | 18026 |
| 468 | Ga0207648_10006732 | 3300026089 | Bacteria | 11399 |
| 469 | Ga0207648_10009546 | 3300026089 | Bacteria | 9280 |
| 470 | Ga0207648_10018037 | 3300026089 | Bacteria | 6396 |
| 471 | Ga0207648_10058080 | 3300026089 | Bacteria | 3375 |
| 472 | Ga0207648_10142639 | 3300026089 | Bacteria | 2112 |
| 473 | Ga0207648_10278384 | 3300026089 | Bacteria | 1496 |
| 474 | Ga0207676_10010490 | 3300026095 | Bacteria | 6600 |
| 475 | Ga0207676_10020109 | 3300026095 | Bacteria | 4880 |
| 476 | Ga0207676_10205149 | 3300026095 | Bacteria | 1744 |
| 477 | Ga0207674_10009121 | 3300026116 | Bacteria | 11383 |
| 478 | Ga0207674_10022439 | 3300026116 | Bacteria | 6777 |
| 479 | Ga0207675_100002772 | 3300026118 | Bacteria | 17207 |
| 480 | Ga0207675_100024342 | 3300026118 | Bacteria | 5631 |
| 481 | Ga0207675_100025833 | 3300026118 | Bacteria | 5463 |
| 482 | Ga0207675_100026629 | 3300026118 | Bacteria | 5383 |
| 483 | Ga0207675_100031486 | 3300026118 | Bacteria | 4940 |
| 484 | Ga0207675_100066156 | 3300026118 | Bacteria | 3378 |
| 485 | Ga0207683_10003305 | 3300026121 | Bacteria | 14055 |
| 486 | Ga0207683_10004270 | 3300026121 | Bacteria | 12335 |
| 487 | Ga0207683_10006099 | 3300026121 | Bacteria | 10320 |
| 488 | Ga0207683_10009565 | 3300026121 | Bacteria | 8265 |
| 489 | Ga0207683_10126375 | 3300026121 | Bacteria | 2298 |
| 490 | Ga0207698_10017782 | 3300026142 | Bacteria | 4832 |
| 491 | Ga0207698_10198772 | 3300026142 | Bacteria | 1793 |
| 492 | Ga0207428_10135599 | 3300027907 | Bacteria | 1882 |
| 493 | Ga0265356_1000064 | 3300028017 | Bacteria | 17470 |
| 494 | Ga0268266_10013977 | 3300028379 | Bacteria | 6912 |
| 495 | Ga0268266_10197536 | 3300028379 | Bacteria | 1839 |
| 496 | Ga0268265_10022503 | 3300028380 | Bacteria | 4430 |
| 497 | Ga0268265_10095655 | 3300028380 | Bacteria | 2385 |
| 498 | Ga0268265_10150241 | 3300028380 | Bacteria | 1963 |
| 499 | Ga0268265_10152755 | 3300028380 | Bacteria | 1949 |
| 500 | Ga0268265_10725456 | 3300028380 | Bacteria | 962 |
| 501 | Ga0268264_10012464 | 3300028381 | Bacteria | 6999 |
| 502 | Ga0268264_10063233 | 3300028381 | Bacteria | 3110 |
| 503 | Ga0268264_10082891 | 3300028381 | Bacteria | 2745 |
| 504 | Ga0268264_10122148 | 3300028381 | Bacteria | 2297 |
| 505 | Ga0265324_10026029 | 3300029957 | Bacteria | 2071 |
| 506 | Ga0265762_1006057 | 3300030760 | Bacteria | 2168 |
| 507 | Ga0265770_1004405 | 3300030878 | Bacteria | 1921 |
| 508 | Ga0265330_10002735 | 3300031235 | Bacteria | 9490 |
| 509 | Ga0265332_10000088 | 3300031238 | Bacteria | 79927 |
| 510 | Ga0265325_10005155 | 3300031241 | Bacteria | 8127 |
| 511 | Ga0265329_10001308 | 3300031242 | Bacteria | 12097 |
| 512 | Ga0265331_10000214 | 3300031250 | Bacteria | 69697 |
| 513 | Ga0265327_10011172 | 3300031251 | Bacteria | 6222 |
| 514 | Ga0265327_10106763 | 3300031251 | Bacteria | 1343 |
| 515 | Ga0265316_10397131 | 3300031344 | Bacteria | 993 |
| 516 | Ga0307408_100105023 | 3300031548 | Bacteria | 2159 |
| 517 | Ga0265313_10138190 | 3300031595 | Bacteria | 1050 |
| 518 | Ga0316575_10000614 | 3300031665 | Bacteria | 10499 |
| 519 | Ga0316575_10002111 | 3300031665 | Bacteria | 6649 |
| 520 | Ga0265342_10005461 | 3300031712 | Bacteria | 9680 |
| 521 | Ga0307405_10176841 | 3300031731 | Bacteria | 1528 |
| 522 | Ga0307405_10210286 | 3300031731 | Bacteria | 1420 |
| 523 | Ga0307410_10023593 | 3300031852 | Bacteria | 3828 |
| 524 | Ga0307410_10045837 | 3300031852 | Bacteria | 2914 |
| 525 | Ga0307410_10062133 | 3300031852 | Bacteria | 2558 |
| 526 | Ga0307412_10062421 | 3300031911 | Bacteria | 2509 |
| 527 | Ga0307409_100045489 | 3300031995 | Bacteria | 3314 |
| 528 | Ga0307409_100081481 | 3300031995 | Bacteria | 2616 |
| 529 | Ga0307409_100172302 | 3300031995 | Bacteria | 1906 |
| 530 | Ga0307416_100097088 | 3300032002 | Bacteria | 2550 |
| 531 | Ga0373934_0143314 | 3300035086 | Bacteria | 977 |
| 532 | Ga0373957_0091054 | 3300035120 | Bacteria | 1212 |
| 533 | Ga0373943_0026928 | 3300035170 | Bacteria | 2697 |
| 534 | Ga0373946_0116217 | 3300035171 | Bacteria | 1216 |
| 535 | Ga0373924_0184162 | 3300035410 | Bacteria | 919 |
| 536 | Ga0373935_0013887 | 3300035692 | Bacteria | 4862 |
| 537 | Ga0373935_0051717 | 3300035692 | Bacteria | 2610 |
| 538 | Ga0373927_0022459 | 3300035695 | Bacteria | 4133 |
| 539 | Ga0373927_0152243 | 3300035695 | Bacteria | 1514 |
| 540 | Ga0373927_0313985 | 3300035695 | Bacteria | 1032 |
| 541 | Ga0373933_0146638 | 3300035724 | Bacteria | 1493 |
| 542 | Ga0373947_0006200 | 3300035725 | Bacteria | 6955 |
| 543 | Ga0373937_0011967 | 3300036401 | Bacteria | 7617 |
| 544 | Ga0373937_0050361 | 3300036401 | Bacteria | 3815 |
| 545 | Ga0373937_0198973 | 3300036401 | Bacteria | 1883 |
| 546 | Ga0373937_0298543 | 3300036401 | Bacteria | 1522 |
| 547 | Ga0373925_0010555 | 3300037068 | Bacteria | 6697 |
| 548 | Ga0373925_0026225 | 3300037068 | Bacteria | 4263 |
| 549 | Ga0373925_0084296 | 3300037068 | Bacteria | 2422 |
| 550 | Ga0373925_0137585 | 3300037068 | Bacteria | 1909 |
| 551 | Ga0436363_0399790 | 3300039450 | Bacteria | 1145 |
| 552 | Ga0436362_1153937 | 3300039453 | Bacteria | 16105 |
| 553 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 554 | Ga0451577_0016080 | 3300042876 | Bacteria | 6939 |
| 555 | Ga0453683_0000013 | 3300044673 | Bacteria | 371932 |
| 556 | Ga0453683_0002705 | 3300044673 | Bacteria | 13530 |
| 557 | Ga0466965_0042807 | 3300044683 | Bacteria | 2235 |
| 558 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 559 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 560 | Ga0453684_0421583 | 3300044712 | Bacteria | 1491 |
| 561 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 562 | Ga0451576_0000037 | 3300045051 | Bacteria | 372173 |
| 563 | Ga0451576_0000320 | 3300045051 | Bacteria | 116612 |
| 564 | Ga0451576_0002559 | 3300045051 | Bacteria | 26842 |
| 565 | Ga0451576_0003253 | 3300045051 | Bacteria | 22534 |
| 566 | Ga0451576_0073619 | 3300045051 | Bacteria | 3555 |
| 567 | Ga0495603_0139697 | 3300046455 | Bacteria | 1409 |
| 568 | Ga0495603_0172187 | 3300046455 | Bacteria | 1254 |
| 569 | Ga0495653_0224146 | 3300046463 | Bacteria | 1262 |
| 570 | Ga0495582_0058501 | 3300046473 | Bacteria | 2125 |
| 571 | Ga0495662_0115144 | 3300046476 | Bacteria | 1318 |
| 572 | Ga0495664_0058652 | 3300046477 | Bacteria | 2290 |
| 573 | Ga0495630_0102655 | 3300046517 | Bacteria | 2164 |
| 574 | Ga0495598_0055407 | 3300046537 | Bacteria | 1207 |
| 575 | Ga0495645_0123305 | 3300046543 | Bacteria | 1822 |
| 576 | Ga0495667_0087074 | 3300046559 | Bacteria | 2026 |
| 577 | Ga0495659_0007601 | 3300046664 | Bacteria | 3437 |
| 578 | Ga0495588_0056254 | 3300046674 | Bacteria | 2031 |
| 579 | Ga0495647_0002741 | 3300046681 | Bacteria | 5589 |
| 580 | Ga0495658_0075749 | 3300046683 | Bacteria | 1964 |
| 581 | Ga0495669_0076533 | 3300046684 | Bacteria | 1532 |
| 582 | Ga0495581_0004119 | 3300047315 | Bacteria | 8370 |
| 583 | Ga0495676_0060813 | 3300047321 | Unclassified | 2958 |
| 584 | Ga0495680_0063813 | 3300047322 | Bacteria | 2827 |
| 585 | Ga0495614_0117741 | 3300048089 | Bacteria | 1170 |
| 586 | Ga0496100_0109270 | 3300048903 | Bacteria | 1918 |
| 587 | Ga0496101_0013616 | 3300048904 | Bacteria | 5455 |
| 588 | Ga0496101_0051540 | 3300048904 | Bacteria | 2966 |
| 589 | Ga0496102_0125679 | 3300048905 | Bacteria | 2397 |
| 590 | Ga0496103_0025748 | 3300048906 | Bacteria | 3558 |
| 591 | Ga0496103_0111637 | 3300048906 | Bacteria | 1737 |
| 592 | Ga0496104_0044377 | 3300048907 | Bacteria | 4177 |
| 593 | Ga0496104_0078678 | 3300048907 | Bacteria | 3142 |
| 594 | Ga0496105_0028062 | 3300048908 | Bacteria | 4603 |
| 595 | Ga0496106_0009734 | 3300048909 | Bacteria | 7098 |
| 596 | Ga0496107_0098338 | 3300048910 | Bacteria | 2143 |
| 597 | Ga0496107_0241287 | 3300048910 | Bacteria | 1345 |
| 598 | Ga0496108_0003218 | 3300048911 | Bacteria | 13133 |
| 599 | Ga0496108_0251957 | 3300048911 | Bacteria | 1536 |
| 600 | Ga0496109_0012278 | 3300048912 | Bacteria | 7394 |
| 601 | Ga0496109_0031434 | 3300048912 | Bacteria | 4764 |
| 602 | Ga0496109_0218433 | 3300048912 | Bacteria | 1793 |
| 603 | Ga0496109_0254720 | 3300048912 | Bacteria | 1653 |
| 604 | Ga0496110_0012953 | 3300048913 | Bacteria | 6877 |
| 605 | Ga0496110_0294668 | 3300048913 | Bacteria | 1478 |
| 606 | Ga0496110_0410281 | 3300048913 | Bacteria | 1235 |
| 607 | Ga0496111_0216996 | 3300048914 | Bacteria | 1421 |
| 608 | Ga0496112_0319801 | 3300048915 | Bacteria | 1496 |
| 609 | Ga0496113_0098363 | 3300048916 | Bacteria | 2265 |
| 610 | Ga0496114_0093701 | 3300048917 | Bacteria | 2554 |
| 611 | Ga0501034_0096059 | 3300049571 | Bacteria | 2960 |
| 612 | Ga0501047_0115364 | 3300049581 | Bacteria | 2568 |
| 613 | Ga0501070_0076227 | 3300049586 | Bacteria | 2776 |
| 614 | Ga0501072_0183039 | 3300049588 | Bacteria | 1671 |
| 615 | Ga0501073_0052677 | 3300049589 | Bacteria | 2849 |
| 616 | Ga0501074_0043412 | 3300049590 | Bacteria | 3254 |
| 617 | Ga0501080_0022481 | 3300049742 | Bacteria | 5842 |
| 618 | Ga0501080_0023269 | 3300049742 | Bacteria | 5744 |
| 619 | Ga0501081_0014556 | 3300049743 | Bacteria | 5190 |
| 620 | Ga0501081_0151171 | 3300049743 | Bacteria | 1668 |
| 621 | Ga0501081_0458472 | 3300049743 | Bacteria | 947 |
| 622 | Ga0501083_0066521 | 3300049744 | Bacteria | 2399 |
| 623 | nmdc:mga0k408_72067_c1 | 3300050493 | Bacteria | 2017 |
| 624 | nmdc:mga05p37_171678_c1 | 3300050507 | Bacteria | 2644 |
| 625 | nmdc:mga05p37_500897_c1 | 3300050507 | Bacteria | 1394 |
| 626 | nmdc:mga08y16_65012_c1 | 3300050511 | Bacteria | 3808 |
| 627 | nmdc:mga0n895_148919_c1 | 3300050512 | Bacteria | 2370 |
| 628 | nmdc:mga0rr50_106597_c1 | 3300050513 | Bacteria | 2211 |
| 629 | nmdc:mga0rr50_395847_c1 | 3300050513 | Bacteria | 1166 |
| 630 | nmdc:mga0a205_8372_c1 | 3300050515 | Bacteria | 9409 |
| 631 | Ga0495595_0059299 | 3300053084 | Bacteria | 1789 |
| 632 | Ga0495619_0225738 | 3300053085 | Bacteria | 1297 |
| 633 | Ga0501084_0130083 | 3300054114 | Bacteria | 2119 |
| 634 | Ga0501082_0434721 | 3300060353 | Bacteria | 1146 |
| 635 | Ga0530510_0214669 | 3300061734 | Bacteria | 1429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035410 | Ga0373924_0184162 | Ga0373924_0184162_191_907 | 238 |
| 2 | 3300005365 | Ga0070688_100018552 | Ga0070688_1000185523 | 253 |
| 3 | 3300005618 | Ga0068864_100311938 | Ga0068864_1003119382 | 253 |
| 4 | 3300005842 | Ga0068858_100260493 | Ga0068858_1002604932 | 253 |
| 5 | 3300009098 | Ga0105245_10486823 | Ga0105245_104868232 | 253 |
| 6 | 3300026035 | Ga0207703_10240027 | Ga0207703_102400272 | 253 |
| 7 | 3300026035 | Ga0207703_10435042 | Ga0207703_104350422 | 253 |
| 8 | 3300047321 | Ga0495676_0060813 | Ga0495676_0060813_2027_2812 | 253 |
| 9 | 3300031344 | Ga0265316_10397131 | Ga0265316_103971312 | 254 |
| 10 | 3300039450 | Ga0436363_0399790 | Ga0436363_0399790_202_969 | 254 |
| 11 | 3300039453 | Ga0436362_1153937 | Ga0436362_1153937_8713_9480 | 254 |
| 12 | 3300042876 | Ga0451577_0016080 | Ga0451577_0016080_5148_5915 | 254 |
| 13 | 3300044673 | Ga0453683_0002705 | Ga0453683_0002705_10301_11068 | 254 |
| 14 | 3300044712 | Ga0453684_0000040 | Ga0453684_0000040_578732_579499 | 254 |
| 15 | 3300044712 | Ga0453684_0421583 | Ga0453684_0421583_423_1190 | 254 |
| 16 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_543168_543935 | 254 |
| 17 | 3300045051 | Ga0451576_0002559 | Ga0451576_0002559_12109_12876 | 254 |
| 18 | 3300045051 | Ga0451576_0003253 | Ga0451576_0003253_2826_3593 | 254 |
| 19 | 3300045051 | Ga0451576_0073619 | Ga0451576_0073619_2363_3130 | 254 |
| 20 | 3300049743 | Ga0501081_0014556 | Ga0501081_0014556_3953_4720 | 254 |
| 21 | 3300049743 | Ga0501081_0458472 | Ga0501081_0458472_87_854 | 254 |
| 22 | 3300061734 | Ga0530510_0214669 | Ga0530510_0214669_45_812 | 254 |
| 23 | 3300045051 | Ga0451576_0000320 | Ga0451576_0000320_52210_52980 | 255 |
| 24 | 3300005440 | Ga0070705_100017785 | Ga0070705_1000177854 | 256 |
| 25 | 3300005985 | Ga0081539_10000686 | Ga0081539_1000068612 | 256 |
| 26 | 3300006195 | Ga0075366_10026852 | Ga0075366_100268522 | 256 |
| 27 | 3300006852 | Ga0075433_10275937 | Ga0075433_102759372 | 256 |
| 28 | 3300006914 | Ga0075436_100009781 | Ga0075436_1000097817 | 256 |
| 29 | 3300025939 | Ga0207665_10026042 | Ga0207665_100260425 | 256 |
| 30 | 3300028017 | Ga0265356_1000064 | Ga0265356_100006413 | 256 |
| 31 | 3300029957 | Ga0265324_10026029 | Ga0265324_100260292 | 256 |
| 32 | 3300030760 | Ga0265762_1006057 | Ga0265762_10060574 | 256 |
| 33 | 3300030878 | Ga0265770_1004405 | Ga0265770_10044053 | 256 |
| 34 | 3300031251 | Ga0265327_10106763 | Ga0265327_101067631 | 256 |
| 35 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_1621139_1621912 | 256 |
| 36 | 3300044673 | Ga0453683_0000013 | Ga0453683_0000013_261696_262469 | 256 |
| 37 | 3300044683 | Ga0466965_0042807 | Ga0466965_0042807_576_1391 | 256 |
| 38 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_109464_110237 | 256 |
| 39 | 3300045051 | Ga0451576_0000037 | Ga0451576_0000037_261937_262710 | 256 |
| 40 | 3300050493 | nmdc:mga0k408_72067_c1 | nmdc:mga0k408_72067_c1_645_1418 | 256 |
| 41 | 3300005331 | Ga0070670_100180362 | Ga0070670_1001803623 | 257 |
| 42 | 3300005335 | Ga0070666_10011252 | Ga0070666_100112524 | 257 |
| 43 | 3300005338 | Ga0068868_100068334 | Ga0068868_1000683342 | 257 |
| 44 | 3300005339 | Ga0070660_100105755 | Ga0070660_1001057553 | 257 |
| 45 | 3300005340 | Ga0070689_100094253 | Ga0070689_1000942533 | 257 |
| 46 | 3300005341 | Ga0070691_10092649 | Ga0070691_100926492 | 257 |
| 47 | 3300005344 | Ga0070661_100116728 | Ga0070661_1001167281 | 257 |
| 48 | 3300005345 | Ga0070692_10053141 | Ga0070692_100531413 | 257 |
| 49 | 3300005355 | Ga0070671_100007201 | Ga0070671_1000072015 | 257 |
| 50 | 3300005356 | Ga0070674_100014156 | Ga0070674_1000141565 | 257 |
| 51 | 3300005356 | Ga0070674_100018547 | Ga0070674_1000185474 | 257 |
| 52 | 3300005364 | Ga0070673_100807138 | Ga0070673_1008071381 | 257 |
| 53 | 3300005366 | Ga0070659_100150973 | Ga0070659_1001509732 | 257 |
| 54 | 3300005367 | Ga0070667_100098304 | Ga0070667_1000983043 | 257 |
| 55 | 3300005435 | Ga0070714_100057060 | Ga0070714_1000570603 | 257 |
| 56 | 3300005436 | Ga0070713_100064169 | Ga0070713_1000641692 | 257 |
| 57 | 3300005439 | Ga0070711_100036125 | Ga0070711_1000361252 | 257 |
| 58 | 3300005440 | Ga0070705_100014680 | Ga0070705_1000146804 | 257 |
| 59 | 3300005455 | Ga0070663_100163290 | Ga0070663_1001632902 | 257 |
| 60 | 3300005456 | Ga0070678_100019333 | Ga0070678_1000193333 | 257 |
| 61 | 3300005456 | Ga0070678_100050066 | Ga0070678_1000500662 | 257 |
| 62 | 3300005457 | Ga0070662_100159677 | Ga0070662_1001596772 | 257 |
| 63 | 3300005457 | Ga0070662_100213485 | Ga0070662_1002134852 | 257 |
| 64 | 3300005467 | Ga0070706_100087344 | Ga0070706_1000873443 | 257 |
| 65 | 3300005518 | Ga0070699_100018088 | Ga0070699_1000180883 | 257 |
| 66 | 3300005535 | Ga0070684_100236770 | Ga0070684_1002367701 | 257 |
| 67 | 3300005543 | Ga0070672_100076386 | Ga0070672_1000763862 | 257 |
| 68 | 3300005546 | Ga0070696_100220065 | Ga0070696_1002200651 | 257 |
| 69 | 3300005547 | Ga0070693_100188205 | Ga0070693_1001882051 | 257 |
| 70 | 3300005549 | Ga0070704_100164594 | Ga0070704_1001645942 | 257 |
| 71 | 3300005564 | Ga0070664_100127283 | Ga0070664_1001272832 | 257 |
| 72 | 3300005578 | Ga0068854_100171310 | Ga0068854_1001713102 | 257 |
| 73 | 3300005578 | Ga0068854_100264047 | Ga0068854_1002640471 | 257 |
| 74 | 3300005615 | Ga0070702_100060464 | Ga0070702_1000604642 | 257 |
| 75 | 3300005616 | Ga0068852_100034401 | Ga0068852_1000344011 | 257 |
| 76 | 3300005616 | Ga0068852_100073533 | Ga0068852_1000735333 | 257 |
| 77 | 3300005718 | Ga0068866_10327655 | Ga0068866_103276551 | 257 |
| 78 | 3300005841 | Ga0068863_100167734 | Ga0068863_1001677343 | 257 |
| 79 | 3300005843 | Ga0068860_100098960 | Ga0068860_1000989602 | 257 |
| 80 | 3300006028 | Ga0070717_10562461 | Ga0070717_105624611 | 257 |
| 81 | 3300006175 | Ga0070712_100052047 | Ga0070712_1000520472 | 257 |
| 82 | 3300006237 | Ga0097621_100086906 | Ga0097621_1000869063 | 257 |
| 83 | 3300006237 | Ga0097621_100198195 | Ga0097621_1001981952 | 257 |
| 84 | 3300006358 | Ga0068871_100080829 | Ga0068871_1000808293 | 257 |
| 85 | 3300006358 | Ga0068871_100101420 | Ga0068871_1001014203 | 257 |
| 86 | 3300006871 | Ga0075434_100251710 | Ga0075434_1002517102 | 257 |
| 87 | 3300006881 | Ga0068865_100145724 | Ga0068865_1001457243 | 257 |
| 88 | 3300006914 | Ga0075436_100136287 | Ga0075436_1001362873 | 257 |
| 89 | 3300009093 | Ga0105240_10197050 | Ga0105240_101970503 | 257 |
| 90 | 3300009098 | Ga0105245_10272491 | Ga0105245_102724912 | 257 |
| 91 | 3300009101 | Ga0105247_10024074 | Ga0105247_100240741 | 257 |
| 92 | 3300009176 | Ga0105242_10131357 | Ga0105242_101313573 | 257 |
| 93 | 3300009177 | Ga0105248_10224819 | Ga0105248_102248193 | 257 |
| 94 | 3300009545 | Ga0105237_10045809 | Ga0105237_100458092 | 257 |
| 95 | 3300009551 | Ga0105238_10479946 | Ga0105238_104799461 | 257 |
| 96 | 3300013105 | Ga0157369_10127324 | Ga0157369_101273243 | 257 |
| 97 | 3300013297 | Ga0157378_10053841 | Ga0157378_100538412 | 257 |
| 98 | 3300013306 | Ga0163162_10509803 | Ga0163162_105098031 | 257 |
| 99 | 3300013307 | Ga0157372_10624699 | Ga0157372_106246991 | 257 |
| 100 | 3300013308 | Ga0157375_10290625 | Ga0157375_102906252 | 257 |
| 101 | 3300014325 | Ga0163163_10292951 | Ga0163163_102929512 | 257 |
| 102 | 3300014968 | Ga0157379_10060468 | Ga0157379_100604682 | 257 |
| 103 | 3300014969 | Ga0157376_10112040 | Ga0157376_101120401 | 257 |
| 104 | 3300017792 | Ga0163161_10066102 | Ga0163161_100661024 | 257 |
| 105 | 3300025899 | Ga0207642_10066769 | Ga0207642_100667692 | 257 |
| 106 | 3300025916 | Ga0207663_10192414 | Ga0207663_101924142 | 257 |
| 107 | 3300025918 | Ga0207662_10146086 | Ga0207662_101460862 | 257 |
| 108 | 3300025919 | Ga0207657_10015204 | Ga0207657_100152042 | 257 |
| 109 | 3300025921 | Ga0207652_10255545 | Ga0207652_102555452 | 257 |
| 110 | 3300025927 | Ga0207687_10006409 | Ga0207687_100064096 | 257 |
| 111 | 3300025928 | Ga0207700_10207056 | Ga0207700_102070561 | 257 |
| 112 | 3300025928 | Ga0207700_10573402 | Ga0207700_105734021 | 257 |
| 113 | 3300025929 | Ga0207664_10100262 | Ga0207664_101002621 | 257 |
| 114 | 3300025932 | Ga0207690_10125586 | Ga0207690_101255862 | 257 |
| 115 | 3300025933 | Ga0207706_10193319 | Ga0207706_101933192 | 257 |
| 116 | 3300025933 | Ga0207706_10324877 | Ga0207706_103248772 | 257 |
| 117 | 3300025934 | Ga0207686_10009410 | Ga0207686_100094103 | 257 |
| 118 | 3300025937 | Ga0207669_10061421 | Ga0207669_100614213 | 257 |
| 119 | 3300025938 | Ga0207704_10023927 | Ga0207704_100239272 | 257 |
| 120 | 3300025939 | Ga0207665_10041570 | Ga0207665_100415704 | 257 |
| 121 | 3300025940 | Ga0207691_10044014 | Ga0207691_100440143 | 257 |
| 122 | 3300025940 | Ga0207691_10350795 | Ga0207691_103507951 | 257 |
| 123 | 3300025941 | Ga0207711_10018949 | Ga0207711_100189494 | 257 |
| 124 | 3300025941 | Ga0207711_10150215 | Ga0207711_101502152 | 257 |
| 125 | 3300025944 | Ga0207661_10448272 | Ga0207661_104482721 | 257 |
| 126 | 3300025960 | Ga0207651_10613302 | Ga0207651_106133021 | 257 |
| 127 | 3300025981 | Ga0207640_10047069 | Ga0207640_100470693 | 257 |
| 128 | 3300025981 | Ga0207640_10080815 | Ga0207640_100808152 | 257 |
| 129 | 3300025986 | Ga0207658_10126391 | Ga0207658_101263912 | 257 |
| 130 | 3300026041 | Ga0207639_10327039 | Ga0207639_103270392 | 257 |
| 131 | 3300026067 | Ga0207678_10074420 | Ga0207678_100744202 | 257 |
| 132 | 3300026078 | Ga0207702_10050515 | Ga0207702_100505152 | 257 |
| 133 | 3300026089 | Ga0207648_10009546 | Ga0207648_100095467 | 257 |
| 134 | 3300026089 | Ga0207648_10142639 | Ga0207648_101426392 | 257 |
| 135 | 3300026121 | Ga0207683_10006099 | Ga0207683_100060998 | 257 |
| 136 | 3300026121 | Ga0207683_10126375 | Ga0207683_101263753 | 257 |
| 137 | 3300028381 | Ga0268264_10063233 | Ga0268264_100632332 | 257 |
| 138 | 3300031548 | Ga0307408_100105023 | Ga0307408_1001050232 | 257 |
| 139 | 3300031665 | Ga0316575_10000614 | Ga0316575_1000061411 | 257 |
| 140 | 3300031665 | Ga0316575_10002111 | Ga0316575_100021113 | 257 |
| 141 | 3300031731 | Ga0307405_10176841 | Ga0307405_101768412 | 257 |
| 142 | 3300031731 | Ga0307405_10210286 | Ga0307405_102102861 | 257 |
| 143 | 3300031852 | Ga0307410_10023593 | Ga0307410_100235933 | 257 |
| 144 | 3300031852 | Ga0307410_10045837 | Ga0307410_100458372 | 257 |
| 145 | 3300031852 | Ga0307410_10062133 | Ga0307410_100621332 | 257 |
| 146 | 3300031911 | Ga0307412_10062421 | Ga0307412_100624212 | 257 |
| 147 | 3300031995 | Ga0307409_100045489 | Ga0307409_1000454892 | 257 |
| 148 | 3300031995 | Ga0307409_100081481 | Ga0307409_1000814812 | 257 |
| 149 | 3300031995 | Ga0307409_100172302 | Ga0307409_1001723022 | 257 |
| 150 | 3300032002 | Ga0307416_100097088 | Ga0307416_1000970883 | 257 |
| 151 | 3300035086 | Ga0373934_0143314 | Ga0373934_0143314_84_857 | 257 |
| 152 | 3300035120 | Ga0373957_0091054 | Ga0373957_0091054_263_1036 | 257 |
| 153 | 3300035170 | Ga0373943_0026928 | Ga0373943_0026928_1771_2544 | 257 |
| 154 | 3300035171 | Ga0373946_0116217 | Ga0373946_0116217_261_1034 | 257 |
| 155 | 3300035692 | Ga0373935_0013887 | Ga0373935_0013887_3543_4316 | 257 |
| 156 | 3300035695 | Ga0373927_0152243 | Ga0373927_0152243_339_1112 | 257 |
| 157 | 3300035725 | Ga0373947_0006200 | Ga0373947_0006200_3945_4718 | 257 |
| 158 | 3300036401 | Ga0373937_0011967 | Ga0373937_0011967_1486_2259 | 257 |
| 159 | 3300036401 | Ga0373937_0198973 | Ga0373937_0198973_690_1463 | 257 |
| 160 | 3300037068 | Ga0373925_0010555 | Ga0373925_0010555_1773_2546 | 257 |
| 161 | 3300037068 | Ga0373925_0026225 | Ga0373925_0026225_3107_3880 | 257 |
| 162 | 3300037068 | Ga0373925_0137585 | Ga0373925_0137585_537_1310 | 257 |
| 163 | 3300046455 | Ga0495603_0139697 | Ga0495603_0139697_234_1007 | 257 |
| 164 | 3300046463 | Ga0495653_0224146 | Ga0495653_0224146_226_999 | 257 |
| 165 | 3300046473 | Ga0495582_0058501 | Ga0495582_0058501_1136_1909 | 257 |
| 166 | 3300046476 | Ga0495662_0115144 | Ga0495662_0115144_136_909 | 257 |
| 167 | 3300046477 | Ga0495664_0058652 | Ga0495664_0058652_894_1667 | 257 |
| 168 | 3300046517 | Ga0495630_0102655 | Ga0495630_0102655_297_1070 | 257 |
| 169 | 3300046543 | Ga0495645_0123305 | Ga0495645_0123305_851_1624 | 257 |
| 170 | 3300046559 | Ga0495667_0087074 | Ga0495667_0087074_592_1365 | 257 |
| 171 | 3300046664 | Ga0495659_0007601 | Ga0495659_0007601_1714_2487 | 257 |
| 172 | 3300046674 | Ga0495588_0056254 | Ga0495588_0056254_1123_1896 | 257 |
| 173 | 3300046681 | Ga0495647_0002741 | Ga0495647_0002741_743_1516 | 257 |
| 174 | 3300046683 | Ga0495658_0075749 | Ga0495658_0075749_105_878 | 257 |
| 175 | 3300046684 | Ga0495669_0076533 | Ga0495669_0076533_485_1258 | 257 |
| 176 | 3300047315 | Ga0495581_0004119 | Ga0495581_0004119_6349_7122 | 257 |
| 177 | 3300047322 | Ga0495680_0063813 | Ga0495680_0063813_736_1509 | 257 |
| 178 | 3300048089 | Ga0495614_0117741 | Ga0495614_0117741_166_939 | 257 |
| 179 | 3300048904 | Ga0496101_0051540 | Ga0496101_0051540_2072_2845 | 257 |
| 180 | 3300048907 | Ga0496104_0078678 | Ga0496104_0078678_2179_2952 | 257 |
| 181 | 3300048910 | Ga0496107_0241287 | Ga0496107_0241287_101_874 | 257 |
| 182 | 3300049743 | Ga0501081_0151171 | Ga0501081_0151171_292_1068 | 257 |
| 183 | 3300050507 | nmdc:mga05p37_500897_c1 | nmdc:mga05p37_500897_c1_82_861 | 257 |
| 184 | 3300053084 | Ga0495595_0059299 | Ga0495595_0059299_724_1497 | 257 |
| 185 | 3300053085 | Ga0495619_0225738 | Ga0495619_0225738_452_1225 | 257 |
| 186 | 3300001976 | JGI24752J21851_1017488 | JGI24752J21851_10174881 | 258 |
| 187 | 3300001977 | JGI24746J21847_1008802 | JGI24746J21847_10088022 | 258 |
| 188 | 3300001991 | JGI24743J22301_10001559 | JGI24743J22301_100015592 | 258 |
| 189 | 3300002076 | JGI24749J21850_1001835 | JGI24749J21850_10018352 | 258 |
| 190 | 3300002077 | JGI24744J21845_10003872 | JGI24744J21845_100038724 | 258 |
| 191 | 3300002155 | JGI24033J26618_1003279 | JGI24033J26618_10032792 | 258 |
| 192 | 3300002239 | JGI24034J26672_10005905 | JGI24034J26672_100059052 | 258 |
| 193 | 3300002244 | JGI24742J22300_10005690 | JGI24742J22300_100056902 | 258 |
| 194 | 3300002459 | JGI24751J29686_10008600 | JGI24751J29686_100086002 | 258 |
| 195 | 3300005293 | Ga0065715_10120554 | Ga0065715_101205542 | 258 |
| 196 | 3300005328 | Ga0070676_10000582 | Ga0070676_100005827 | 258 |
| 197 | 3300005328 | Ga0070676_10033110 | Ga0070676_100331104 | 258 |
| 198 | 3300005328 | Ga0070676_10078061 | Ga0070676_100780613 | 258 |
| 199 | 3300005329 | Ga0070683_100006211 | Ga0070683_1000062118 | 258 |
| 200 | 3300005330 | Ga0070690_100033909 | Ga0070690_1000339092 | 258 |
| 201 | 3300005330 | Ga0070690_100177377 | Ga0070690_1001773772 | 258 |
| 202 | 3300005331 | Ga0070670_100007133 | Ga0070670_1000071333 | 258 |
| 203 | 3300005331 | Ga0070670_100015616 | Ga0070670_1000156165 | 258 |
| 204 | 3300005331 | Ga0070670_100017778 | Ga0070670_1000177784 | 258 |
| 205 | 3300005331 | Ga0070670_100223678 | Ga0070670_1002236782 | 258 |
| 206 | 3300005333 | Ga0070677_10011301 | Ga0070677_100113012 | 258 |
| 207 | 3300005333 | Ga0070677_10016659 | Ga0070677_100166592 | 258 |
| 208 | 3300005334 | Ga0068869_100000101 | Ga0068869_1000001017 | 258 |
| 209 | 3300005334 | Ga0068869_100003229 | Ga0068869_1000032297 | 258 |
| 210 | 3300005334 | Ga0068869_100072344 | Ga0068869_1000723443 | 258 |
| 211 | 3300005335 | Ga0070666_10035182 | Ga0070666_100351823 | 258 |
| 212 | 3300005338 | Ga0068868_100145146 | Ga0068868_1001451461 | 258 |
| 213 | 3300005338 | Ga0068868_100615534 | Ga0068868_1006155341 | 258 |
| 214 | 3300005339 | Ga0070660_100122637 | Ga0070660_1001226372 | 258 |
| 215 | 3300005340 | Ga0070689_100043545 | Ga0070689_1000435452 | 258 |
| 216 | 3300005343 | Ga0070687_100003146 | Ga0070687_1000031464 | 258 |
| 217 | 3300005344 | Ga0070661_100034266 | Ga0070661_1000342663 | 258 |
| 218 | 3300005344 | Ga0070661_100036029 | Ga0070661_1000360293 | 258 |
| 219 | 3300005347 | Ga0070668_100011598 | Ga0070668_1000115984 | 258 |
| 220 | 3300005347 | Ga0070668_100140433 | Ga0070668_1001404333 | 258 |
| 221 | 3300005347 | Ga0070668_100170997 | Ga0070668_1001709972 | 258 |
| 222 | 3300005347 | Ga0070668_100251617 | Ga0070668_1002516172 | 258 |
| 223 | 3300005353 | Ga0070669_100011448 | Ga0070669_1000114485 | 258 |
| 224 | 3300005353 | Ga0070669_100073161 | Ga0070669_1000731612 | 258 |
| 225 | 3300005353 | Ga0070669_100094605 | Ga0070669_1000946053 | 258 |
| 226 | 3300005353 | Ga0070669_100101744 | Ga0070669_1001017442 | 258 |
| 227 | 3300005353 | Ga0070669_100315775 | Ga0070669_1003157751 | 258 |
| 228 | 3300005354 | Ga0070675_100033229 | Ga0070675_1000332292 | 258 |
| 229 | 3300005354 | Ga0070675_100046707 | Ga0070675_1000467072 | 258 |
| 230 | 3300005354 | Ga0070675_100058996 | Ga0070675_1000589961 | 258 |
| 231 | 3300005354 | Ga0070675_100073086 | Ga0070675_1000730863 | 258 |
| 232 | 3300005354 | Ga0070675_100447942 | Ga0070675_1004479422 | 258 |
| 233 | 3300005355 | Ga0070671_100003185 | Ga0070671_10000318511 | 258 |
| 234 | 3300005355 | Ga0070671_100009591 | Ga0070671_1000095916 | 258 |
| 235 | 3300005355 | Ga0070671_100137369 | Ga0070671_1001373692 | 258 |
| 236 | 3300005355 | Ga0070671_100236154 | Ga0070671_1002361541 | 258 |
| 237 | 3300005356 | Ga0070674_100004667 | Ga0070674_1000046678 | 258 |
| 238 | 3300005356 | Ga0070674_100054324 | Ga0070674_1000543243 | 258 |
| 239 | 3300005356 | Ga0070674_100241821 | Ga0070674_1002418212 | 258 |
| 240 | 3300005364 | Ga0070673_100008340 | Ga0070673_1000083403 | 258 |
| 241 | 3300005364 | Ga0070673_100014413 | Ga0070673_1000144133 | 258 |
| 242 | 3300005364 | Ga0070673_100086864 | Ga0070673_1000868643 | 258 |
| 243 | 3300005364 | Ga0070673_100177503 | Ga0070673_1001775032 | 258 |
| 244 | 3300005364 | Ga0070673_100372030 | Ga0070673_1003720301 | 258 |
| 245 | 3300005365 | Ga0070688_100019921 | Ga0070688_1000199212 | 258 |
| 246 | 3300005366 | Ga0070659_100028845 | Ga0070659_1000288454 | 258 |
| 247 | 3300005367 | Ga0070667_100003822 | Ga0070667_1000038227 | 258 |
| 248 | 3300005367 | Ga0070667_100017178 | Ga0070667_1000171784 | 258 |
| 249 | 3300005367 | Ga0070667_100048938 | Ga0070667_1000489382 | 258 |
| 250 | 3300005367 | Ga0070667_100075952 | Ga0070667_1000759522 | 258 |
| 251 | 3300005367 | Ga0070667_100363530 | Ga0070667_1003635302 | 258 |
| 252 | 3300005438 | Ga0070701_10009413 | Ga0070701_100094133 | 258 |
| 253 | 3300005438 | Ga0070701_10152927 | Ga0070701_101529271 | 258 |
| 254 | 3300005438 | Ga0070701_10258761 | Ga0070701_102587611 | 258 |
| 255 | 3300005441 | Ga0070700_100123583 | Ga0070700_1001235831 | 258 |
| 256 | 3300005441 | Ga0070700_100228906 | Ga0070700_1002289062 | 258 |
| 257 | 3300005445 | Ga0070708_100000765 | Ga0070708_10000076519 | 258 |
| 258 | 3300005445 | Ga0070708_100056589 | Ga0070708_1000565892 | 258 |
| 259 | 3300005455 | Ga0070663_100045585 | Ga0070663_1000455852 | 258 |
| 260 | 3300005456 | Ga0070678_100005241 | Ga0070678_1000052412 | 258 |
| 261 | 3300005456 | Ga0070678_100027756 | Ga0070678_1000277564 | 258 |
| 262 | 3300005456 | Ga0070678_100074777 | Ga0070678_1000747773 | 258 |
| 263 | 3300005457 | Ga0070662_100042000 | Ga0070662_1000420004 | 258 |
| 264 | 3300005457 | Ga0070662_100058187 | Ga0070662_1000581873 | 258 |
| 265 | 3300005457 | Ga0070662_100162626 | Ga0070662_1001626262 | 258 |
| 266 | 3300005458 | Ga0070681_10087147 | Ga0070681_100871474 | 258 |
| 267 | 3300005459 | Ga0068867_100001715 | Ga0068867_1000017153 | 258 |
| 268 | 3300005459 | Ga0068867_100013860 | Ga0068867_1000138604 | 258 |
| 269 | 3300005459 | Ga0068867_100020492 | Ga0068867_1000204923 | 258 |
| 270 | 3300005459 | Ga0068867_100027565 | Ga0068867_1000275653 | 258 |
| 271 | 3300005459 | Ga0068867_100034834 | Ga0068867_1000348344 | 258 |
| 272 | 3300005466 | Ga0070685_10079196 | Ga0070685_100791962 | 258 |
| 273 | 3300005466 | Ga0070685_10180722 | Ga0070685_101807222 | 258 |
| 274 | 3300005467 | Ga0070706_100050343 | Ga0070706_1000503433 | 258 |
| 275 | 3300005467 | Ga0070706_100066252 | Ga0070706_1000662522 | 258 |
| 276 | 3300005468 | Ga0070707_100048377 | Ga0070707_1000483774 | 258 |
| 277 | 3300005471 | Ga0070698_100015525 | Ga0070698_1000155253 | 258 |
| 278 | 3300005471 | Ga0070698_100131847 | Ga0070698_1001318472 | 258 |
| 279 | 3300005530 | Ga0070679_100023723 | Ga0070679_1000237233 | 258 |
| 280 | 3300005535 | Ga0070684_100035002 | Ga0070684_1000350022 | 258 |
| 281 | 3300005536 | Ga0070697_100040737 | Ga0070697_1000407373 | 258 |
| 282 | 3300005536 | Ga0070697_100101576 | Ga0070697_1001015762 | 258 |
| 283 | 3300005539 | Ga0068853_100120663 | Ga0068853_1001206631 | 258 |
| 284 | 3300005539 | Ga0068853_100231584 | Ga0068853_1002315842 | 258 |
| 285 | 3300005539 | Ga0068853_100453230 | Ga0068853_1004532302 | 258 |
| 286 | 3300005543 | Ga0070672_100000610 | Ga0070672_10000061016 | 258 |
| 287 | 3300005543 | Ga0070672_100010649 | Ga0070672_1000106494 | 258 |
| 288 | 3300005543 | Ga0070672_100054497 | Ga0070672_1000544974 | 258 |
| 289 | 3300005543 | Ga0070672_100070376 | Ga0070672_1000703762 | 258 |
| 290 | 3300005543 | Ga0070672_100071851 | Ga0070672_1000718512 | 258 |
| 291 | 3300005543 | Ga0070672_100152287 | Ga0070672_1001522872 | 258 |
| 292 | 3300005544 | Ga0070686_100028352 | Ga0070686_1000283522 | 258 |
| 293 | 3300005546 | Ga0070696_100165509 | Ga0070696_1001655092 | 258 |
| 294 | 3300005548 | Ga0070665_100012129 | Ga0070665_1000121293 | 258 |
| 295 | 3300005548 | Ga0070665_100035120 | Ga0070665_1000351206 | 258 |
| 296 | 3300005548 | Ga0070665_100121597 | Ga0070665_1001215973 | 258 |
| 297 | 3300005548 | Ga0070665_100166281 | Ga0070665_1001662811 | 258 |
| 298 | 3300005548 | Ga0070665_100355843 | Ga0070665_1003558432 | 258 |
| 299 | 3300005549 | Ga0070704_100253222 | Ga0070704_1002532222 | 258 |
| 300 | 3300005563 | Ga0068855_100317867 | Ga0068855_1003178672 | 258 |
| 301 | 3300005564 | Ga0070664_100119680 | Ga0070664_1001196802 | 258 |
| 302 | 3300005564 | Ga0070664_100204497 | Ga0070664_1002044972 | 258 |
| 303 | 3300005564 | Ga0070664_100247401 | Ga0070664_1002474012 | 258 |
| 304 | 3300005564 | Ga0070664_100438713 | Ga0070664_1004387132 | 258 |
| 305 | 3300005577 | Ga0068857_100013086 | Ga0068857_1000130868 | 258 |
| 306 | 3300005577 | Ga0068857_100190114 | Ga0068857_1001901142 | 258 |
| 307 | 3300005614 | Ga0068856_100406311 | Ga0068856_1004063111 | 258 |
| 308 | 3300005615 | Ga0070702_100020618 | Ga0070702_1000206182 | 258 |
| 309 | 3300005616 | Ga0068852_100030318 | Ga0068852_1000303184 | 258 |
| 310 | 3300005616 | Ga0068852_100778487 | Ga0068852_1007784871 | 258 |
| 311 | 3300005617 | Ga0068859_100001953 | Ga0068859_10000195313 | 258 |
| 312 | 3300005617 | Ga0068859_100024150 | Ga0068859_1000241502 | 258 |
| 313 | 3300005617 | Ga0068859_100147080 | Ga0068859_1001470802 | 258 |
| 314 | 3300005617 | Ga0068859_100150376 | Ga0068859_1001503762 | 258 |
| 315 | 3300005617 | Ga0068859_100178996 | Ga0068859_1001789962 | 258 |
| 316 | 3300005617 | Ga0068859_100497237 | Ga0068859_1004972372 | 258 |
| 317 | 3300005618 | Ga0068864_100001243 | Ga0068864_10000124311 | 258 |
| 318 | 3300005618 | Ga0068864_100006641 | Ga0068864_1000066412 | 258 |
| 319 | 3300005618 | Ga0068864_100007075 | Ga0068864_1000070754 | 258 |
| 320 | 3300005618 | Ga0068864_100114618 | Ga0068864_1001146182 | 258 |
| 321 | 3300005618 | Ga0068864_100303355 | Ga0068864_1003033552 | 258 |
| 322 | 3300005719 | Ga0068861_100021720 | Ga0068861_1000217204 | 258 |
| 323 | 3300005719 | Ga0068861_100023969 | Ga0068861_1000239693 | 258 |
| 324 | 3300005719 | Ga0068861_100035609 | Ga0068861_1000356094 | 258 |
| 325 | 3300005719 | Ga0068861_100149932 | Ga0068861_1001499322 | 258 |
| 326 | 3300005834 | Ga0068851_10003338 | Ga0068851_100033387 | 258 |
| 327 | 3300005834 | Ga0068851_10260142 | Ga0068851_102601422 | 258 |
| 328 | 3300005840 | Ga0068870_10008346 | Ga0068870_100083463 | 258 |
| 329 | 3300005840 | Ga0068870_10032403 | Ga0068870_100324032 | 258 |
| 330 | 3300005840 | Ga0068870_10130520 | Ga0068870_101305202 | 258 |
| 331 | 3300005840 | Ga0068870_10314546 | Ga0068870_103145461 | 258 |
| 332 | 3300005841 | Ga0068863_100009691 | Ga0068863_1000096917 | 258 |
| 333 | 3300005841 | Ga0068863_100025111 | Ga0068863_1000251113 | 258 |
| 334 | 3300005841 | Ga0068863_100030500 | Ga0068863_1000305004 | 258 |
| 335 | 3300005841 | Ga0068863_100043325 | Ga0068863_1000433253 | 258 |
| 336 | 3300005841 | Ga0068863_100152248 | Ga0068863_1001522481 | 258 |
| 337 | 3300005842 | Ga0068858_100002486 | Ga0068858_10000248613 | 258 |
| 338 | 3300005842 | Ga0068858_100005048 | Ga0068858_1000050486 | 258 |
| 339 | 3300005842 | Ga0068858_100099691 | Ga0068858_1000996912 | 258 |
| 340 | 3300005843 | Ga0068860_100037605 | Ga0068860_1000376055 | 258 |
| 341 | 3300005843 | Ga0068860_100100660 | Ga0068860_1001006602 | 258 |
| 342 | 3300005843 | Ga0068860_100102015 | Ga0068860_1001020152 | 258 |
| 343 | 3300005843 | Ga0068860_100120285 | Ga0068860_1001202852 | 258 |
| 344 | 3300005843 | Ga0068860_100327472 | Ga0068860_1003274722 | 258 |
| 345 | 3300005844 | Ga0068862_100005449 | Ga0068862_1000054495 | 258 |
| 346 | 3300005844 | Ga0068862_100009283 | Ga0068862_1000092833 | 258 |
| 347 | 3300005844 | Ga0068862_100031488 | Ga0068862_1000314885 | 258 |
| 348 | 3300005844 | Ga0068862_100034666 | Ga0068862_1000346664 | 258 |
| 349 | 3300005844 | Ga0068862_100117988 | Ga0068862_1001179882 | 258 |
| 350 | 3300005844 | Ga0068862_100381659 | Ga0068862_1003816592 | 258 |
| 351 | 3300006237 | Ga0097621_100026300 | Ga0097621_1000263002 | 258 |
| 352 | 3300006237 | Ga0097621_100148560 | Ga0097621_1001485602 | 258 |
| 353 | 3300006237 | Ga0097621_100172640 | Ga0097621_1001726402 | 258 |
| 354 | 3300006237 | Ga0097621_100237372 | Ga0097621_1002373722 | 258 |
| 355 | 3300006358 | Ga0068871_100030183 | Ga0068871_1000301833 | 258 |
| 356 | 3300006358 | Ga0068871_100030331 | Ga0068871_1000303312 | 258 |
| 357 | 3300006358 | Ga0068871_100151169 | Ga0068871_1001511692 | 258 |
| 358 | 3300006852 | Ga0075433_10240413 | Ga0075433_102404132 | 258 |
| 359 | 3300006880 | Ga0075429_100672666 | Ga0075429_1006726662 | 258 |
| 360 | 3300006881 | Ga0068865_100010655 | Ga0068865_1000106554 | 258 |
| 361 | 3300006881 | Ga0068865_100053153 | Ga0068865_1000531532 | 258 |
| 362 | 3300006881 | Ga0068865_100060405 | Ga0068865_1000604053 | 258 |
| 363 | 3300006881 | Ga0068865_100172785 | Ga0068865_1001727852 | 258 |
| 364 | 3300006881 | Ga0068865_100335436 | Ga0068865_1003354362 | 258 |
| 365 | 3300006931 | Ga0097620_100001953 | Ga0097620_1000019536 | 258 |
| 366 | 3300006931 | Ga0097620_100024149 | Ga0097620_1000241492 | 258 |
| 367 | 3300006931 | Ga0097620_100147089 | Ga0097620_1001470893 | 258 |
| 368 | 3300006931 | Ga0097620_100150376 | Ga0097620_1001503762 | 258 |
| 369 | 3300006931 | Ga0097620_100178995 | Ga0097620_1001789952 | 258 |
| 370 | 3300006931 | Ga0097620_100450787 | Ga0097620_1004507872 | 258 |
| 371 | 3300006931 | Ga0097620_100497243 | Ga0097620_1004972432 | 258 |
| 372 | 3300007076 | Ga0075435_100049857 | Ga0075435_1000498572 | 258 |
| 373 | 3300007076 | Ga0075435_100504303 | Ga0075435_1005043032 | 258 |
| 374 | 3300009094 | Ga0111539_10039807 | Ga0111539_100398073 | 258 |
| 375 | 3300009101 | Ga0105247_10166176 | Ga0105247_101661762 | 258 |
| 376 | 3300009147 | Ga0114129_10108012 | Ga0114129_101080123 | 258 |
| 377 | 3300009148 | Ga0105243_10054456 | Ga0105243_100544564 | 258 |
| 378 | 3300009176 | Ga0105242_10010222 | Ga0105242_100102222 | 258 |
| 379 | 3300009176 | Ga0105242_10020561 | Ga0105242_100205614 | 258 |
| 380 | 3300009176 | Ga0105242_10168470 | Ga0105242_101684701 | 258 |
| 381 | 3300009177 | Ga0105248_10022860 | Ga0105248_100228602 | 258 |
| 382 | 3300009177 | Ga0105248_10070681 | Ga0105248_100706813 | 258 |
| 383 | 3300009177 | Ga0105248_10143586 | Ga0105248_101435862 | 258 |
| 384 | 3300009177 | Ga0105248_10370123 | Ga0105248_103701232 | 258 |
| 385 | 3300009177 | Ga0105248_10839196 | Ga0105248_108391962 | 258 |
| 386 | 3300009553 | Ga0105249_10037658 | Ga0105249_100376584 | 258 |
| 387 | 3300009553 | Ga0105249_10126058 | Ga0105249_101260582 | 258 |
| 388 | 3300009553 | Ga0105249_10166060 | Ga0105249_101660602 | 258 |
| 389 | 3300009553 | Ga0105249_10321432 | Ga0105249_103214322 | 258 |
| 390 | 3300010375 | Ga0105239_10372883 | Ga0105239_103728832 | 258 |
| 391 | 3300011119 | Ga0105246_10056006 | Ga0105246_100560063 | 258 |
| 392 | 3300013100 | Ga0157373_10020479 | Ga0157373_100204792 | 258 |
| 393 | 3300013104 | Ga0157370_10027147 | Ga0157370_100271473 | 258 |
| 394 | 3300013296 | Ga0157374_10005174 | Ga0157374_100051743 | 258 |
| 395 | 3300013296 | Ga0157374_10007394 | Ga0157374_100073947 | 258 |
| 396 | 3300013296 | Ga0157374_10270641 | Ga0157374_102706412 | 258 |
| 397 | 3300013297 | Ga0157378_10070851 | Ga0157378_100708512 | 258 |
| 398 | 3300013297 | Ga0157378_10073140 | Ga0157378_100731402 | 258 |
| 399 | 3300013297 | Ga0157378_10254217 | Ga0157378_102542172 | 258 |
| 400 | 3300013306 | Ga0163162_10071050 | Ga0163162_100710503 | 258 |
| 401 | 3300013306 | Ga0163162_10093040 | Ga0163162_100930404 | 258 |
| 402 | 3300013306 | Ga0163162_10102097 | Ga0163162_101020972 | 258 |
| 403 | 3300013306 | Ga0163162_10191711 | Ga0163162_101917112 | 258 |
| 404 | 3300013306 | Ga0163162_10210271 | Ga0163162_102102712 | 258 |
| 405 | 3300013306 | Ga0163162_10212782 | Ga0163162_102127821 | 258 |
| 406 | 3300013307 | Ga0157372_10001809 | Ga0157372_1000180921 | 258 |
| 407 | 3300013308 | Ga0157375_10004231 | Ga0157375_100042319 | 258 |
| 408 | 3300013308 | Ga0157375_10112246 | Ga0157375_101122463 | 258 |
| 409 | 3300013308 | Ga0157375_10116543 | Ga0157375_101165432 | 258 |
| 410 | 3300013308 | Ga0157375_10187180 | Ga0157375_101871802 | 258 |
| 411 | 3300013308 | Ga0157375_10555305 | Ga0157375_105553052 | 258 |
| 412 | 3300014325 | Ga0163163_10007273 | Ga0163163_100072739 | 258 |
| 413 | 3300014325 | Ga0163163_10042499 | Ga0163163_100424991 | 258 |
| 414 | 3300014325 | Ga0163163_10143462 | Ga0163163_101434622 | 258 |
| 415 | 3300014325 | Ga0163163_10504262 | Ga0163163_105042621 | 258 |
| 416 | 3300014326 | Ga0157380_10017406 | Ga0157380_100174062 | 258 |
| 417 | 3300014326 | Ga0157380_10072892 | Ga0157380_100728921 | 258 |
| 418 | 3300014326 | Ga0157380_10304515 | Ga0157380_103045152 | 258 |
| 419 | 3300014745 | Ga0157377_10012385 | Ga0157377_100123853 | 258 |
| 420 | 3300014968 | Ga0157379_10000533 | Ga0157379_1000053311 | 258 |
| 421 | 3300014968 | Ga0157379_10015050 | Ga0157379_100150503 | 258 |
| 422 | 3300014968 | Ga0157379_10037128 | Ga0157379_100371284 | 258 |
| 423 | 3300014969 | Ga0157376_10004106 | Ga0157376_100041061 | 258 |
| 424 | 3300014969 | Ga0157376_10391430 | Ga0157376_103914302 | 258 |
| 425 | 3300017792 | Ga0163161_10023120 | Ga0163161_100231202 | 258 |
| 426 | 3300017792 | Ga0163161_10029370 | Ga0163161_100293704 | 258 |
| 427 | 3300017792 | Ga0163161_10096323 | Ga0163161_100963232 | 258 |
| 428 | 3300025271 | Ga0207666_1001994 | Ga0207666_10019943 | 258 |
| 429 | 3300025290 | Ga0207673_1000981 | Ga0207673_10009813 | 258 |
| 430 | 3300025315 | Ga0207697_10005168 | Ga0207697_100051682 | 258 |
| 431 | 3300025315 | Ga0207697_10009965 | Ga0207697_100099653 | 258 |
| 432 | 3300025315 | Ga0207697_10018739 | Ga0207697_100187392 | 258 |
| 433 | 3300025315 | Ga0207697_10057085 | Ga0207697_100570852 | 258 |
| 434 | 3300025321 | Ga0207656_10022098 | Ga0207656_100220983 | 258 |
| 435 | 3300025893 | Ga0207682_10011455 | Ga0207682_100114555 | 258 |
| 436 | 3300025899 | Ga0207642_10187453 | Ga0207642_101874531 | 258 |
| 437 | 3300025900 | Ga0207710_10046061 | Ga0207710_100460613 | 258 |
| 438 | 3300025901 | Ga0207688_10004759 | Ga0207688_100047594 | 258 |
| 439 | 3300025901 | Ga0207688_10030642 | Ga0207688_100306422 | 258 |
| 440 | 3300025901 | Ga0207688_10265275 | Ga0207688_102652751 | 258 |
| 441 | 3300025903 | Ga0207680_10009285 | Ga0207680_100092855 | 258 |
| 442 | 3300025903 | Ga0207680_10277024 | Ga0207680_102770242 | 258 |
| 443 | 3300025907 | Ga0207645_10000795 | Ga0207645_1000079521 | 258 |
| 444 | 3300025907 | Ga0207645_10003945 | Ga0207645_100039459 | 258 |
| 445 | 3300025907 | Ga0207645_10021354 | Ga0207645_100213542 | 258 |
| 446 | 3300025907 | Ga0207645_10242979 | Ga0207645_102429792 | 258 |
| 447 | 3300025907 | Ga0207645_10244361 | Ga0207645_102443612 | 258 |
| 448 | 3300025908 | Ga0207643_10002580 | Ga0207643_100025803 | 258 |
| 449 | 3300025908 | Ga0207643_10003232 | Ga0207643_100032328 | 258 |
| 450 | 3300025908 | Ga0207643_10169379 | Ga0207643_101693792 | 258 |
| 451 | 3300025910 | Ga0207684_10007136 | Ga0207684_100071363 | 258 |
| 452 | 3300025912 | Ga0207707_10016602 | Ga0207707_100166024 | 258 |
| 453 | 3300025917 | Ga0207660_10231795 | Ga0207660_102317952 | 258 |
| 454 | 3300025918 | Ga0207662_10007972 | Ga0207662_100079723 | 258 |
| 455 | 3300025919 | Ga0207657_10037377 | Ga0207657_100373774 | 258 |
| 456 | 3300025920 | Ga0207649_10009544 | Ga0207649_100095443 | 258 |
| 457 | 3300025920 | Ga0207649_10066902 | Ga0207649_100669022 | 258 |
| 458 | 3300025921 | Ga0207652_10018026 | Ga0207652_100180263 | 258 |
| 459 | 3300025922 | Ga0207646_10552235 | Ga0207646_105522351 | 258 |
| 460 | 3300025923 | Ga0207681_10015812 | Ga0207681_100158122 | 258 |
| 461 | 3300025923 | Ga0207681_10022327 | Ga0207681_100223273 | 258 |
| 462 | 3300025923 | Ga0207681_10030766 | Ga0207681_100307662 | 258 |
| 463 | 3300025923 | Ga0207681_10076808 | Ga0207681_100768082 | 258 |
| 464 | 3300025923 | Ga0207681_10078305 | Ga0207681_100783052 | 258 |
| 465 | 3300025923 | Ga0207681_10097230 | Ga0207681_100972302 | 258 |
| 466 | 3300025925 | Ga0207650_10002834 | Ga0207650_100028349 | 258 |
| 467 | 3300025925 | Ga0207650_10006285 | Ga0207650_100062853 | 258 |
| 468 | 3300025925 | Ga0207650_10013793 | Ga0207650_100137935 | 258 |
| 469 | 3300025925 | Ga0207650_10054190 | Ga0207650_100541903 | 258 |
| 470 | 3300025926 | Ga0207659_10009348 | Ga0207659_100093485 | 258 |
| 471 | 3300025926 | Ga0207659_10023048 | Ga0207659_100230484 | 258 |
| 472 | 3300025926 | Ga0207659_10036238 | Ga0207659_100362382 | 258 |
| 473 | 3300025926 | Ga0207659_10082194 | Ga0207659_100821943 | 258 |
| 474 | 3300025926 | Ga0207659_10145610 | Ga0207659_101456102 | 258 |
| 475 | 3300025926 | Ga0207659_10406298 | Ga0207659_104062981 | 258 |
| 476 | 3300025931 | Ga0207644_10049672 | Ga0207644_100496722 | 258 |
| 477 | 3300025931 | Ga0207644_10097547 | Ga0207644_100975472 | 258 |
| 478 | 3300025931 | Ga0207644_10130172 | Ga0207644_101301721 | 258 |
| 479 | 3300025931 | Ga0207644_10132004 | Ga0207644_101320041 | 258 |
| 480 | 3300025932 | Ga0207690_10064928 | Ga0207690_100649282 | 258 |
| 481 | 3300025933 | Ga0207706_10014824 | Ga0207706_100148244 | 258 |
| 482 | 3300025933 | Ga0207706_10068085 | Ga0207706_100680852 | 258 |
| 483 | 3300025933 | Ga0207706_10122911 | Ga0207706_101229112 | 258 |
| 484 | 3300025934 | Ga0207686_10178942 | Ga0207686_101789422 | 258 |
| 485 | 3300025935 | Ga0207709_10030941 | Ga0207709_100309412 | 258 |
| 486 | 3300025936 | Ga0207670_10027085 | Ga0207670_100270854 | 258 |
| 487 | 3300025936 | Ga0207670_10090654 | Ga0207670_100906542 | 258 |
| 488 | 3300025937 | Ga0207669_10037443 | Ga0207669_100374432 | 258 |
| 489 | 3300025940 | Ga0207691_10000528 | Ga0207691_1000052824 | 258 |
| 490 | 3300025940 | Ga0207691_10001035 | Ga0207691_100010358 | 258 |
| 491 | 3300025940 | Ga0207691_10005561 | Ga0207691_100055617 | 258 |
| 492 | 3300025940 | Ga0207691_10017366 | Ga0207691_100173663 | 258 |
| 493 | 3300025940 | Ga0207691_10063344 | Ga0207691_100633442 | 258 |
| 494 | 3300025940 | Ga0207691_10088604 | Ga0207691_100886042 | 258 |
| 495 | 3300025941 | Ga0207711_10033113 | Ga0207711_100331133 | 258 |
| 496 | 3300025941 | Ga0207711_10059772 | Ga0207711_100597722 | 258 |
| 497 | 3300025941 | Ga0207711_10144914 | Ga0207711_101449141 | 258 |
| 498 | 3300025941 | Ga0207711_10366051 | Ga0207711_103660512 | 258 |
| 499 | 3300025942 | Ga0207689_10001875 | Ga0207689_100018753 | 258 |
| 500 | 3300025942 | Ga0207689_10004867 | Ga0207689_100048674 | 258 |
| 501 | 3300025942 | Ga0207689_10010620 | Ga0207689_100106206 | 258 |
| 502 | 3300025942 | Ga0207689_10014572 | Ga0207689_100145723 | 258 |
| 503 | 3300025944 | Ga0207661_10064872 | Ga0207661_100648722 | 258 |
| 504 | 3300025945 | Ga0207679_10105592 | Ga0207679_101055922 | 258 |
| 505 | 3300025945 | Ga0207679_10201182 | Ga0207679_102011822 | 258 |
| 506 | 3300025949 | Ga0207667_10193992 | Ga0207667_101939922 | 258 |
| 507 | 3300025960 | Ga0207651_10014296 | Ga0207651_100142962 | 258 |
| 508 | 3300025960 | Ga0207651_10014314 | Ga0207651_100143142 | 258 |
| 509 | 3300025960 | Ga0207651_10154922 | Ga0207651_101549222 | 258 |
| 510 | 3300025960 | Ga0207651_10626530 | Ga0207651_106265301 | 258 |
| 511 | 3300025961 | Ga0207712_10247991 | Ga0207712_102479911 | 258 |
| 512 | 3300025961 | Ga0207712_10331447 | Ga0207712_103314472 | 258 |
| 513 | 3300025961 | Ga0207712_10547001 | Ga0207712_105470011 | 258 |
| 514 | 3300025972 | Ga0207668_10055777 | Ga0207668_100557773 | 258 |
| 515 | 3300025972 | Ga0207668_10533245 | Ga0207668_105332452 | 258 |
| 516 | 3300025972 | Ga0207668_10610507 | Ga0207668_106105071 | 258 |
| 517 | 3300025986 | Ga0207658_10005684 | Ga0207658_100056845 | 258 |
| 518 | 3300025986 | Ga0207658_10007838 | Ga0207658_100078384 | 258 |
| 519 | 3300025986 | Ga0207658_10018723 | Ga0207658_100187234 | 258 |
| 520 | 3300025986 | Ga0207658_10033076 | Ga0207658_100330762 | 258 |
| 521 | 3300025986 | Ga0207658_10053826 | Ga0207658_100538264 | 258 |
| 522 | 3300025986 | Ga0207658_10084704 | Ga0207658_100847041 | 258 |
| 523 | 3300025986 | Ga0207658_10135637 | Ga0207658_101356372 | 258 |
| 524 | 3300025986 | Ga0207658_10164949 | Ga0207658_101649492 | 258 |
| 525 | 3300025986 | Ga0207658_10581983 | Ga0207658_105819832 | 258 |
| 526 | 3300026023 | Ga0207677_10011392 | Ga0207677_100113923 | 258 |
| 527 | 3300026023 | Ga0207677_10032492 | Ga0207677_100324922 | 258 |
| 528 | 3300026023 | Ga0207677_10040993 | Ga0207677_100409933 | 258 |
| 529 | 3300026023 | Ga0207677_10045930 | Ga0207677_100459304 | 258 |
| 530 | 3300026023 | Ga0207677_10126976 | Ga0207677_101269762 | 258 |
| 531 | 3300026035 | Ga0207703_10001325 | Ga0207703_1000132511 | 258 |
| 532 | 3300026035 | Ga0207703_10045837 | Ga0207703_100458372 | 258 |
| 533 | 3300026035 | Ga0207703_10049562 | Ga0207703_100495623 | 258 |
| 534 | 3300026041 | Ga0207639_10050913 | Ga0207639_100509134 | 258 |
| 535 | 3300026041 | Ga0207639_10108700 | Ga0207639_101087003 | 258 |
| 536 | 3300026041 | Ga0207639_10108937 | Ga0207639_101089372 | 258 |
| 537 | 3300026067 | Ga0207678_10032073 | Ga0207678_100320733 | 258 |
| 538 | 3300026067 | Ga0207678_10143570 | Ga0207678_101435702 | 258 |
| 539 | 3300026075 | Ga0207708_10003466 | Ga0207708_100034669 | 258 |
| 540 | 3300026075 | Ga0207708_10040895 | Ga0207708_100408952 | 258 |
| 541 | 3300026078 | Ga0207702_10301918 | Ga0207702_103019181 | 258 |
| 542 | 3300026088 | Ga0207641_10019612 | Ga0207641_100196123 | 258 |
| 543 | 3300026088 | Ga0207641_10083944 | Ga0207641_100839442 | 258 |
| 544 | 3300026088 | Ga0207641_10269377 | Ga0207641_102693772 | 258 |
| 545 | 3300026088 | Ga0207641_10278802 | Ga0207641_102788021 | 258 |
| 546 | 3300026088 | Ga0207641_10318458 | Ga0207641_103184582 | 258 |
| 547 | 3300026089 | Ga0207648_10000236 | Ga0207648_1000023641 | 258 |
| 548 | 3300026089 | Ga0207648_10002943 | Ga0207648_1000294316 | 258 |
| 549 | 3300026089 | Ga0207648_10006732 | Ga0207648_100067325 | 258 |
| 550 | 3300026089 | Ga0207648_10018037 | Ga0207648_100180372 | 258 |
| 551 | 3300026089 | Ga0207648_10058080 | Ga0207648_100580802 | 258 |
| 552 | 3300026089 | Ga0207648_10278384 | Ga0207648_102783842 | 258 |
| 553 | 3300026095 | Ga0207676_10010490 | Ga0207676_100104902 | 258 |
| 554 | 3300026095 | Ga0207676_10020109 | Ga0207676_100201092 | 258 |
| 555 | 3300026095 | Ga0207676_10205149 | Ga0207676_102051492 | 258 |
| 556 | 3300026116 | Ga0207674_10009121 | Ga0207674_100091212 | 258 |
| 557 | 3300026116 | Ga0207674_10022439 | Ga0207674_100224394 | 258 |
| 558 | 3300026118 | Ga0207675_100002772 | Ga0207675_1000027721 | 258 |
| 559 | 3300026118 | Ga0207675_100024342 | Ga0207675_1000243424 | 258 |
| 560 | 3300026118 | Ga0207675_100025833 | Ga0207675_1000258334 | 258 |
| 561 | 3300026118 | Ga0207675_100026629 | Ga0207675_1000266292 | 258 |
| 562 | 3300026118 | Ga0207675_100031486 | Ga0207675_1000314863 | 258 |
| 563 | 3300026118 | Ga0207675_100066156 | Ga0207675_1000661562 | 258 |
| 564 | 3300026121 | Ga0207683_10003305 | Ga0207683_100033055 | 258 |
| 565 | 3300026121 | Ga0207683_10004270 | Ga0207683_100042704 | 258 |
| 566 | 3300026121 | Ga0207683_10009565 | Ga0207683_100095652 | 258 |
| 567 | 3300026142 | Ga0207698_10017782 | Ga0207698_100177824 | 258 |
| 568 | 3300026142 | Ga0207698_10198772 | Ga0207698_101987722 | 258 |
| 569 | 3300027907 | Ga0207428_10135599 | Ga0207428_101355992 | 258 |
| 570 | 3300028379 | Ga0268266_10013977 | Ga0268266_100139776 | 258 |
| 571 | 3300028379 | Ga0268266_10197536 | Ga0268266_101975362 | 258 |
| 572 | 3300028380 | Ga0268265_10022503 | Ga0268265_100225032 | 258 |
| 573 | 3300028380 | Ga0268265_10095655 | Ga0268265_100956551 | 258 |
| 574 | 3300028380 | Ga0268265_10150241 | Ga0268265_101502412 | 258 |
| 575 | 3300028380 | Ga0268265_10152755 | Ga0268265_101527552 | 258 |
| 576 | 3300028380 | Ga0268265_10725456 | Ga0268265_107254562 | 258 |
| 577 | 3300028381 | Ga0268264_10012464 | Ga0268264_100124644 | 258 |
| 578 | 3300028381 | Ga0268264_10082891 | Ga0268264_100828913 | 258 |
| 579 | 3300028381 | Ga0268264_10122148 | Ga0268264_101221482 | 258 |
| 580 | 3300031235 | Ga0265330_10002735 | Ga0265330_100027352 | 258 |
| 581 | 3300031238 | Ga0265332_10000088 | Ga0265332_1000008839 | 258 |
| 582 | 3300031241 | Ga0265325_10005155 | Ga0265325_100051556 | 258 |
| 583 | 3300031242 | Ga0265329_10001308 | Ga0265329_100013086 | 258 |
| 584 | 3300031250 | Ga0265331_10000214 | Ga0265331_1000021417 | 258 |
| 585 | 3300031251 | Ga0265327_10011172 | Ga0265327_100111725 | 258 |
| 586 | 3300031595 | Ga0265313_10138190 | Ga0265313_101381901 | 258 |
| 587 | 3300031712 | Ga0265342_10005461 | Ga0265342_100054612 | 258 |
| 588 | 3300035692 | Ga0373935_0051717 | Ga0373935_0051717_1807_2583 | 258 |
| 589 | 3300035695 | Ga0373927_0022459 | Ga0373927_0022459_1599_2375 | 258 |
| 590 | 3300035695 | Ga0373927_0313985 | Ga0373927_0313985_172_951 | 258 |
| 591 | 3300035724 | Ga0373933_0146638 | Ga0373933_0146638_687_1463 | 258 |
| 592 | 3300036401 | Ga0373937_0050361 | Ga0373937_0050361_2394_3173 | 258 |
| 593 | 3300036401 | Ga0373937_0298543 | Ga0373937_0298543_220_1026 | 258 |
| 594 | 3300037068 | Ga0373925_0084296 | Ga0373925_0084296_1088_1867 | 258 |
| 595 | 3300046455 | Ga0495603_0172187 | Ga0495603_0172187_459_1235 | 258 |
| 596 | 3300046537 | Ga0495598_0055407 | Ga0495598_0055407_126_902 | 258 |
| 597 | 3300048903 | Ga0496100_0109270 | Ga0496100_0109270_520_1296 | 258 |
| 598 | 3300048904 | Ga0496101_0013616 | Ga0496101_0013616_977_1753 | 258 |
| 599 | 3300048905 | Ga0496102_0125679 | Ga0496102_0125679_348_1124 | 258 |
| 600 | 3300048906 | Ga0496103_0025748 | Ga0496103_0025748_1868_2644 | 258 |
| 601 | 3300048906 | Ga0496103_0111637 | Ga0496103_0111637_38_814 | 258 |
| 602 | 3300048907 | Ga0496104_0044377 | Ga0496104_0044377_3093_3869 | 258 |
| 603 | 3300048908 | Ga0496105_0028062 | Ga0496105_0028062_1909_2685 | 258 |
| 604 | 3300048909 | Ga0496106_0009734 | Ga0496106_0009734_3047_3823 | 258 |
| 605 | 3300048910 | Ga0496107_0098338 | Ga0496107_0098338_763_1539 | 258 |
| 606 | 3300048911 | Ga0496108_0003218 | Ga0496108_0003218_9982_10758 | 258 |
| 607 | 3300048911 | Ga0496108_0251957 | Ga0496108_0251957_482_1258 | 258 |
| 608 | 3300048912 | Ga0496109_0012278 | Ga0496109_0012278_4036_4812 | 258 |
| 609 | 3300048912 | Ga0496109_0031434 | Ga0496109_0031434_2819_3595 | 258 |
| 610 | 3300048912 | Ga0496109_0218433 | Ga0496109_0218433_840_1685 | 258 |
| 611 | 3300048912 | Ga0496109_0254720 | Ga0496109_0254720_735_1511 | 258 |
| 612 | 3300048913 | Ga0496110_0012953 | Ga0496110_0012953_2084_2860 | 258 |
| 613 | 3300048913 | Ga0496110_0294668 | Ga0496110_0294668_429_1205 | 258 |
| 614 | 3300048913 | Ga0496110_0410281 | Ga0496110_0410281_83_859 | 258 |
| 615 | 3300048914 | Ga0496111_0216996 | Ga0496111_0216996_476_1252 | 258 |
| 616 | 3300048915 | Ga0496112_0319801 | Ga0496112_0319801_123_899 | 258 |
| 617 | 3300048916 | Ga0496113_0098363 | Ga0496113_0098363_662_1438 | 258 |
| 618 | 3300048917 | Ga0496114_0093701 | Ga0496114_0093701_1013_1789 | 258 |
| 619 | 3300049571 | Ga0501034_0096059 | Ga0501034_0096059_844_1623 | 258 |
| 620 | 3300049581 | Ga0501047_0115364 | Ga0501047_0115364_1501_2280 | 258 |
| 621 | 3300049586 | Ga0501070_0076227 | Ga0501070_0076227_1456_2235 | 258 |
| 622 | 3300049588 | Ga0501072_0183039 | Ga0501072_0183039_642_1421 | 258 |
| 623 | 3300049589 | Ga0501073_0052677 | Ga0501073_0052677_60_839 | 258 |
| 624 | 3300049590 | Ga0501074_0043412 | Ga0501074_0043412_1712_2491 | 258 |
| 625 | 3300049742 | Ga0501080_0022481 | Ga0501080_0022481_3654_4433 | 258 |
| 626 | 3300049742 | Ga0501080_0023269 | Ga0501080_0023269_1661_2440 | 258 |
| 627 | 3300049744 | Ga0501083_0066521 | Ga0501083_0066521_269_1048 | 258 |
| 628 | 3300050507 | nmdc:mga05p37_171678_c1 | nmdc:mga05p37_171678_c1_423_1199 | 258 |
| 629 | 3300050511 | nmdc:mga08y16_65012_c1 | nmdc:mga08y16_65012_c1_1902_2678 | 258 |
| 630 | 3300050512 | nmdc:mga0n895_148919_c1 | nmdc:mga0n895_148919_c1_17_793 | 258 |
| 631 | 3300050513 | nmdc:mga0rr50_106597_c1 | nmdc:mga0rr50_106597_c1_488_1264 | 258 |
| 632 | 3300050513 | nmdc:mga0rr50_395847_c1 | nmdc:mga0rr50_395847_c1_183_959 | 258 |
| 633 | 3300050515 | nmdc:mga0a205_8372_c1 | nmdc:mga0a205_8372_c1_2314_3090 | 258 |
| 634 | 3300054114 | Ga0501084_0130083 | Ga0501084_0130083_384_1163 | 258 |
| 635 | 3300060353 | Ga0501082_0434721 | Ga0501082_0434721_204_983 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b5m-assembly2.cif.gz_B | neisseria ap endonuclease bound to the substrate with a cytosine orphan base | 0.9568 | 1 | 258 |
| 4b5h-assembly1.cif.gz_A | substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions | 0.9566 | 1 | 258 |
| 4b5m-assembly2.cif.gz_B | neisseria ap endonuclease bound to the substrate with a cytosine orphan base | 0.9532 | 1 | 258 |
| 4b5h-assembly1.cif.gz_A | substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions | 0.953 | 1 | 258 |
| 4f1r-assembly1.cif.gz_A | structure analysis of the global metabolic regulator crc from pseudomonas aeruginos | 0.9494 | 1 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b5gC00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9558 | 1 | 258 | 3.60.10.10 |
| 4b5gC00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9522 | 1 | 258 | 3.60.10.10 |
| 4f1rA00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9494 | 1 | 257 | 3.60.10.10 |
| 4f1rA00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9423 | 1 | 257 | 3.60.10.10 |
| 3g3cB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9383 | 1 | 256 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A496KI47-F1-model_v4 | deleted | 0.9684 | 3 | 172 |
|
| AF-A0A497X7J2-F1-model_v4 | deleted | 0.9655 | 1 | 256 |
|
| AF-A0A7V8K5Y8-F1-model_v4 | DNA-(Apurinic or apyrimidinic site) lyase | 0.9643 | 1 | 154 |
GO:0003677
GO:0003906 GO:0004519 GO:0006284 GO:0008081 GO:0008311 GO:0016829 GO:0046872 |
| AF-A0A378Z4L5-F1-model_v4 | deleted | 0.9638 | 1 | 254 |
|
| AF-A0A2C6XWG1-F1-model_v4 | Exodeoxyribonuclease III | 0.9618 | 1 | 178 |
GO:0003906
GO:0006284 GO:0008081 GO:0008311 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar