F471102

General Info

Members Datasets Scaffolds Average Seq Length
633 253 563 294

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0013262|Ga0495654_0013262_1814_2863
Length 349
Sequence MSKYSDQDLMLIRVFVPFLFRFRQVTAAFSYIAERLVCFRVPPLSTHLTYCEKGIYMLRNATTHYPILLVHGLFGFDRIGNLELFHDVKLALRSAGARVFIPHLSATHSNETRGEQLLAQIDRVLQGTGASKVNLIGHSQGALAARYAGALAPETVASVTSVSGPNHGSELADFLRKALTPGRLPEHVAGAVATLFADFLSLLSGNRHLPQNAIAALNALTTEGVGAFNDKYPQGLPKTWGGKGRELVNGVRYYSWSGTLQGSILDEGLHAFHPLHGFLRAFSHYFTTEAEQNDGMVGRFSSHLGKVIRSDYPLDHLDSLSQTTGQVRKGIDPITLYVQHAERLRNAGL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231020 Pseudomonas sp. GM74 Isolate Nodule
11 2511231022 Pseudomonas sp. GM79 Isolate Nodule
12 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
13 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
14 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
15 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
16 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
17 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
18 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
19 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
20 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
21 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
22 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
23 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
24 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
25 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
26 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
27 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
28 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
29 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
30 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
31 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
32 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
33 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
34 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
35 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
36 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
37 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
38 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
39 2773857670 Pseudomonas sp. 478 Isolate Unclassified
40 2784132072 Pseudomonas sp. 460 Isolate Unclassified
41 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
42 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
43 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
44 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
45 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
46 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
47 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
48 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
49 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
50 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
51 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
52 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
53 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
54 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
55 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
56 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
57 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
58 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
59 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
60 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
61 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
62 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
63 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
64 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
65 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
66 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
67 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
68 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
69 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
70 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
115 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
125 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
130 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
131 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
132 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
133 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
134 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
135 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
136 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
137 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
138 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
139 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
140 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
141 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
142 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
149 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
245 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
246 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
250 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
251 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
252 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
253 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.94
Metatranscriptomes 0
Isolates 11.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 1.74
Rhizoplane 3.95
Rhizosphere 84.04
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_164 2124908027 Bacteria 20503
2 SwRhRL2b_contig_2088678 2162886007 Bacteria 4364
3 JGI25163J39215_1000803 3300002771 Bacteria 7574
4 JGI25164J39214_1000005 3300002772 Bacteria 343384
5 JGI25165J46597_1000340 3300003214 Bacteria 54174
6 Ga0055536_1000452 3300003781 Bacteria 28896
7 Ga0055530_10000868 3300003791 Bacteria 24882
8 Ga0055540_1000009 3300003792 Bacteria 300466
9 Ga0055540_1000236 3300003792 Bacteria 50444
10 Ga0055531_10000668 3300003794 Bacteria 29325
11 Ga0065714_10001987 3300005288 Bacteria 4231
12 Ga0065714_10012499 3300005288 Bacteria 4383
13 Ga0065714_10072120 3300005288 Bacteria 3426
14 Ga0065714_10075802 3300005288 Bacteria 2862
15 Ga0065714_10080678 3300005288 Bacteria 2423
16 Ga0065714_10098826 3300005288 Bacteria 1701
17 Ga0065714_10116923 3300005288 Bacteria 1394
18 Ga0065714_10129903 3300005288 Bacteria 1244
19 Ga0065715_10125014 3300005293 Bacteria 2141
20 Ga0070669_100169083 3300005353 Bacteria 1703
21 Ga0075363_100118934 3300006048 Bacteria 1474
22 Ga0075432_10004319 3300006058 Bacteria 4838
23 Ga0075432_10012231 3300006058 Bacteria 2917
24 Ga0075432_10013500 3300006058 Bacteria 2775
25 Ga0075432_10037516 3300006058 Bacteria 1687
26 Ga0075432_10068132 3300006058 Bacteria 1275
27 Ga0075362_10158151 3300006177 Bacteria 1090
28 Ga0075369_10117443 3300006186 Bacteria 1202
29 Ga0075436_100279465 3300006914 Bacteria 1193
30 Ga0079104_1000081 3300006946 Bacteria 140632
31 Ga0105251_10016453 3300009011 Bacteria 3995
32 Ga0105244_10001116 3300009036 Bacteria 22333
33 Ga0105244_10001862 3300009036 Bacteria 16418
34 Ga0105244_10021297 3300009036 Bacteria 3588
35 Ga0105244_10049580 3300009036 Bacteria 2145
36 Ga0105244_10089077 3300009036 Bacteria 1519
37 Ga0105250_10005317 3300009092 Bacteria 5778
38 Ga0105250_10030610 3300009092 Bacteria 2163
39 Ga0105243_10000170 3300009148 Bacteria 74646
40 Ga0105243_10023788 3300009148 Bacteria 4668
41 Ga0105246_10000712 3300011119 Bacteria 18778
42 Ga0157373_10027056 3300013100 Bacteria 4138
43 Ga0157373_10053556 3300013100 Bacteria 2869
44 Ga0157373_10225109 3300013100 Bacteria 1324
45 Ga0157370_10056368 3300013104 Bacteria 3740
46 Ga0157370_10063422 3300013104 Bacteria 3501
47 Ga0157370_10107272 3300013104 Bacteria 2612
48 Ga0157369_10082474 3300013105 Bacteria 3440
49 Ga0163162_10021787 3300013306 Bacteria 6311
50 Ga0163162_10284463 3300013306 Bacteria 1785
51 Ga0182008_10005367 3300014497 Bacteria 7315
52 Ga0182008_10006214 3300014497 Bacteria 6715
53 Ga0182008_10006602 3300014497 Bacteria 6469
54 Ga0182006_1000700 3300015261 Bacteria 23197
55 Ga0182006_1002868 3300015261 Bacteria 9164
56 Ga0182006_1005669 3300015261 Bacteria 5915
57 Ga0182006_1015567 3300015261 Bacteria 3258
58 Ga0182006_1020389 3300015261 Bacteria 2778
59 Ga0182007_10000857 3300015262 Bacteria 16900
60 Ga0182005_1002885 3300015265 Bacteria 5976
61 Ga0182005_1004447 3300015265 Bacteria 4534
62 Ga0182005_1009625 3300015265 Bacteria 2805
63 Ga0182005_1010815 3300015265 Bacteria 2617
64 Ga0163161_10004005 3300017792 Bacteria 10310
65 Ga0163161_10052396 3300017792 Bacteria 2958
66 Ga0163161_10070189 3300017792 Bacteria 2561
67 Ga0209760_100007 3300025207 Bacteria 211381
68 Ga0207427_100018 3300025231 Bacteria 530735
69 Ga0209437_100031 3300025233 Bacteria 530871
70 Ga0209233_1000012 3300025261 Bacteria 1019519
71 Ga0209675_1017086 3300025291 Bacteria 2085
72 Ga0209676_1000002 3300025292 Bacteria 1732948
73 Ga0209676_1004635 3300025292 Bacteria 7564
74 Ga0209050_1000006 3300025298 Bacteria 1359702
75 Ga0209050_1000009 3300025298 Bacteria 1047265
76 Ga0209051_1000001 3300025303 Bacteria 1732974
77 Ga0209051_1000008 3300025303 Bacteria 706935
78 Ga0209257_1000269 3300025304 Bacteria 119726
79 Ga0207696_1001504 3300025711 Bacteria 12527
80 Ga0207696_1008699 3300025711 Bacteria 3852
81 Ga0207655_1000167 3300025728 Bacteria 119650
82 Ga0207655_1000270 3300025728 Bacteria 81429
83 Ga0207655_1006979 3300025728 Bacteria 7400
84 Ga0207655_1025139 3300025728 Bacteria 2898
85 Ga0207655_1026236 3300025728 Bacteria 2802
86 Ga0207655_1029503 3300025728 Bacteria 2566
87 Ga0207655_1053060 3300025728 Bacteria 1625
88 Ga0207713_1000369 3300025735 Bacteria 48934
89 Ga0207713_1000725 3300025735 Bacteria 30860
90 Ga0207713_1024541 3300025735 Bacteria 2809
91 Ga0207709_10000004 3300025935 Bacteria 825156
92 Ga0207709_10056168 3300025935 Bacteria 2435
93 Ga0209281_1000055 3300027111 Bacteria 308297
94 Ga0207428_10016988 3300027907 Bacteria 6253
95 Ga0207428_10020972 3300027907 Bacteria 5539
96 Ga0207428_10053743 3300027907 Bacteria 3211
97 Ga0207428_10060993 3300027907 Bacteria 2987
98 Ga0207428_10105893 3300027907 Bacteria 2169
99 Ga0207428_10150334 3300027907 Bacteria 1773
100 Ga0307511_10067373 3300030521 Bacteria 2657
101 Ga0316183_1059472 3300030742 Bacteria 5069
102 Ga0316181_1042145 3300030744 Bacteria 2872
103 Ga0307408_100020672 3300031548 Bacteria 4446
104 Ga0307405_10000264 3300031731 Bacteria 19247
105 Ga0307406_10016094 3300031901 Bacteria 4338
106 Ga0307407_10012143 3300031903 Bacteria 4130
107 Ga0307412_10025866 3300031911 Bacteria 3640
108 Ga0307409_100265253 3300031995 Bacteria 1578
109 Ga0307414_10187435 3300032004 Bacteria 1670
110 Ga0307411_10075082 3300032005 Bacteria 2306
111 Ga0439438_000054 3300041405 Bacteria 55484
112 Ga0439438_002127 3300041405 Bacteria 8544
113 Ga0439447_000412 3300041407 Bacteria 15833
114 Ga0439447_005142 3300041407 Bacteria 4387
115 Ga0439466_0001040 3300041411 Bacteria 10706
116 Ga0439466_0005587 3300041411 Bacteria 4799
117 Ga0439466_0005682 3300041411 Bacteria 4753
118 Ga0439466_0005944 3300041411 Bacteria 4644
119 Ga0439466_0012503 3300041411 Bacteria 3124
120 Ga0439465_0010677 3300041413 Bacteria 2882
121 Ga0439432_000642 3300042006 Bacteria 13093
122 Ga0439432_010103 3300042006 Bacteria 3281
123 Ga0439432_012581 3300042006 Bacteria 2892
124 Ga0439451_001887 3300042009 Bacteria 4188
125 Ga0439451_002420 3300042009 Bacteria 3780
126 Ga0439452_000693 3300042010 Bacteria 16526
127 Ga0439452_001117 3300042010 Bacteria 11796
128 Ga0439452_002041 3300042010 Bacteria 7690
129 Ga0439452_004122 3300042010 Bacteria 4938
130 Ga0439452_022281 3300042010 Bacteria 1640
131 Ga0439456_001584 3300042013 Bacteria 4586
132 Ga0439456_002558 3300042013 Bacteria 3662
133 Ga0439456_017149 3300042013 Bacteria 1517
134 Ga0439463_003531 3300042016 Bacteria 3949
135 Ga0439463_015084 3300042016 Bacteria 1910
136 Ga0450911_001095 3300042115 Bacteria 6770
137 Ga0450911_005900 3300042115 Bacteria 1862
138 Ga0450919_000318 3300042121 Bacteria 5743
139 Ga0450920_001294 3300042122 Bacteria 4122
140 Ga0450922_000054 3300042124 Bacteria 10159
141 Ga0450903_002192 3300042138 Bacteria 3491
142 Ga0450903_018064 3300042138 Bacteria 1100
143 Ga0450904_001959 3300042139 Bacteria 2627
144 Ga0450905_000824 3300042142 Bacteria 3850
145 Ga0450906_001383 3300042145 Bacteria 5296
146 Ga0450907_000043 3300042146 Bacteria 55843
147 Ga0450907_001292 3300042146 Bacteria 5588
148 Ga0450907_004012 3300042146 Bacteria 2558
149 Ga0450910_006391 3300042147 Bacteria 1625
150 Ga0439446_0003837 3300042156 Bacteria 3766
151 Ga0450908_002769 3300042184 Bacteria 3415
152 Ga0439434_0004368 3300042435 Bacteria 4133
153 Ga0439464_0032100 3300042439 Bacteria 1475
154 Ga0439460_0002420 3300042461 Bacteria 4492
155 Ga0450901_002961 3300042533 Bacteria 1796
156 Ga0439440_0000889 3300042993 Bacteria 5228
157 Ga0439440_0040794 3300042993 Bacteria 1130
158 Ga0495617_000121 3300046452 Bacteria 51958
159 Ga0495617_004818 3300046452 Bacteria 4864
160 Ga0495617_007293 3300046452 Bacteria 3840
161 Ga0495617_009253 3300046452 Bacteria 3382
162 Ga0495617_011861 3300046452 Bacteria 2972
163 Ga0495617_019075 3300046452 Bacteria 2319
164 Ga0495627_016864 3300046453 Bacteria 2493
165 Ga0495627_048465 3300046453 Bacteria 1285
166 Ga0495627_053055 3300046453 Bacteria 1214
167 Ga0495603_0034042 3300046455 Bacteria 3064
168 Ga0495590_0003992 3300046457 Bacteria 5990
169 Ga0495590_0008230 3300046457 Bacteria 3988
170 Ga0495590_0009080 3300046457 Bacteria 3776
171 Ga0495590_0010730 3300046457 Bacteria 3434
172 Ga0495590_0026117 3300046457 Bacteria 2051
173 Ga0495590_0041988 3300046457 Bacteria 1594
174 Ga0495591_000086 3300046458 Bacteria 104667
175 Ga0495591_004870 3300046458 Bacteria 6394
176 Ga0495591_006144 3300046458 Bacteria 5380
177 Ga0495591_020592 3300046458 Bacteria 2175
178 Ga0495591_025843 3300046458 Bacteria 1834
179 Ga0495591_028043 3300046458 Bacteria 1727
180 Ga0495638_0003127 3300046460 Bacteria 13105
181 Ga0495638_0004482 3300046460 Bacteria 10577
182 Ga0495638_0005022 3300046460 Bacteria 9932
183 Ga0495638_0011398 3300046460 Bacteria 6125
184 Ga0495638_0017677 3300046460 Bacteria 4748
185 Ga0495638_0028892 3300046460 Bacteria 3577
186 Ga0495638_0034075 3300046460 Bacteria 3252
187 Ga0495638_0057299 3300046460 Bacteria 2416
188 Ga0495638_0092028 3300046460 Bacteria 1825
189 Ga0495638_0120312 3300046460 Bacteria 1552
190 Ga0495653_0017034 3300046463 Bacteria 5911
191 Ga0495653_0037726 3300046463 Bacteria 3794
192 Ga0495653_0088728 3300046463 Bacteria 2267
193 Ga0495650_0004241 3300046471 Bacteria 9920
194 Ga0495650_0004707 3300046471 Bacteria 9203
195 Ga0495650_0006805 3300046471 Bacteria 7053
196 Ga0495650_0016017 3300046471 Bacteria 3819
197 Ga0495650_0016510 3300046471 Bacteria 3737
198 Ga0495650_0022428 3300046471 Bacteria 3027
199 Ga0495580_0253975 3300046472 Bacteria 1203
200 Ga0495582_0023586 3300046473 Bacteria 3365
201 Ga0495605_0000346 3300046474 Bacteria 45641
202 Ga0495605_0000980 3300046474 Bacteria 19420
203 Ga0495605_0007860 3300046474 Bacteria 6038
204 Ga0495605_0015719 3300046474 Bacteria 4113
205 Ga0495605_0016963 3300046474 Bacteria 3933
206 Ga0495605_0023354 3300046474 Bacteria 3254
207 Ga0495605_0048263 3300046474 Bacteria 2085
208 Ga0495605_0078654 3300046474 Bacteria 1545
209 Ga0495605_0126116 3300046474 Bacteria 1157
210 Ga0495639_0000225 3300046475 Bacteria 28610
211 Ga0495639_0031917 3300046475 Bacteria 2347
212 Ga0495584_0002250 3300046491 Bacteria 11013
213 Ga0495584_0002725 3300046491 Bacteria 9905
214 Ga0495584_0003244 3300046491 Bacteria 9018
215 Ga0495584_0005172 3300046491 Bacteria 6926
216 Ga0495584_0005197 3300046491 Bacteria 6909
217 Ga0495584_0005876 3300046491 Bacteria 6469
218 Ga0495584_0007307 3300046491 Bacteria 5760
219 Ga0495584_0011095 3300046491 Bacteria 4620
220 Ga0495584_0011131 3300046491 Bacteria 4611
221 Ga0495584_0034120 3300046491 Bacteria 2574
222 Ga0495585_0000149 3300046492 Bacteria 75947
223 Ga0495585_0001687 3300046492 Bacteria 16882
224 Ga0495585_0008471 3300046492 Bacteria 6229
225 Ga0495585_0013206 3300046492 Bacteria 4839
226 Ga0495585_0028992 3300046492 Bacteria 3153
227 Ga0495585_0036783 3300046492 Bacteria 2758
228 Ga0495585_0040238 3300046492 Bacteria 2625
229 Ga0495585_0132937 3300046492 Bacteria 1308
230 Ga0495585_0154606 3300046492 Bacteria 1194
231 Ga0495594_0006355 3300046499 Bacteria 6073
232 Ga0495594_0050113 3300046499 Bacteria 2296
233 Ga0495596_0000027 3300046500 Bacteria 104155
234 Ga0495607_0000167 3300046501 Bacteria 69947
235 Ga0495607_0014160 3300046501 Bacteria 5203
236 Ga0495607_0014555 3300046501 Bacteria 5115
237 Ga0495607_0018345 3300046501 Bacteria 4462
238 Ga0495607_0024529 3300046501 Bacteria 3758
239 Ga0495607_0031670 3300046501 Bacteria 3235
240 Ga0495607_0039438 3300046501 Bacteria 2820
241 Ga0495607_0053901 3300046501 Bacteria 2320
242 Ga0495607_0128210 3300046501 Bacteria 1323
243 Ga0495607_0129310 3300046501 Bacteria 1316
244 Ga0495607_0133399 3300046501 Bacteria 1289
245 Ga0495607_0162759 3300046501 Bacteria 1132
246 Ga0495583_0014178 3300046506 Bacteria 4410
247 Ga0495583_0015125 3300046506 Bacteria 4211
248 Ga0495583_0016198 3300046506 Bacteria 4018
249 Ga0495606_0002405 3300046507 Bacteria 21856
250 Ga0495606_0003610 3300046507 Bacteria 16270
251 Ga0495606_0006238 3300046507 Bacteria 11072
252 Ga0495606_0007719 3300046507 Bacteria 9529
253 Ga0495606_0042264 3300046507 Bacteria 3049
254 Ga0495606_0068797 3300046507 Bacteria 2239
255 Ga0495606_0088950 3300046507 Bacteria 1903
256 Ga0495610_0003112 3300046512 Bacteria 13220
257 Ga0495610_0005293 3300046512 Bacteria 9227
258 Ga0495610_0021581 3300046512 Bacteria 3537
259 Ga0495610_0023637 3300046512 Bacteria 3334
260 Ga0495610_0029861 3300046512 Bacteria 2863
261 Ga0495610_0031745 3300046512 Bacteria 2752
262 Ga0495616_0000425 3300046513 Bacteria 32300
263 Ga0495616_0017558 3300046513 Bacteria 3946
264 Ga0495616_0022276 3300046513 Bacteria 3421
265 Ga0495616_0058076 3300046513 Bacteria 1906
266 Ga0495616_0072389 3300046513 Bacteria 1664
267 Ga0495616_0092122 3300046513 Bacteria 1433
268 Ga0495620_0000095 3300046515 Bacteria 70152
269 Ga0495620_0006007 3300046515 Bacteria 6721
270 Ga0495620_0010198 3300046515 Bacteria 4963
271 Ga0495620_0010580 3300046515 Bacteria 4863
272 Ga0495620_0011491 3300046515 Bacteria 4618
273 Ga0495620_0021804 3300046515 Bacteria 3102
274 Ga0495628_0094004 3300046516 Bacteria 2318
275 Ga0495630_0022453 3300046517 Bacteria 4660
276 Ga0495630_0049523 3300046517 Bacteria 3144
277 Ga0495630_0073016 3300046517 Bacteria 2583
278 Ga0495631_0000126 3300046518 Bacteria 51226
279 Ga0495631_0002781 3300046518 Bacteria 9700
280 Ga0495631_0008587 3300046518 Bacteria 5143
281 Ga0495631_0011462 3300046518 Bacteria 4357
282 Ga0495631_0050830 3300046518 Bacteria 1812
283 Ga0495632_0000619 3300046519 Bacteria 32813
284 Ga0495632_0001946 3300046519 Bacteria 16497
285 Ga0495632_0005924 3300046519 Bacteria 7969
286 Ga0495632_0009687 3300046519 Bacteria 5783
287 Ga0495632_0016744 3300046519 Bacteria 4066
288 Ga0495632_0019984 3300046519 Bacteria 3637
289 Ga0495632_0030266 3300046519 Bacteria 2811
290 Ga0495632_0054474 3300046519 Bacteria 1960
291 Ga0495632_0077715 3300046519 Bacteria 1587
292 Ga0495637_0000858 3300046520 Bacteria 19878
293 Ga0495637_0001819 3300046520 Bacteria 12215
294 Ga0495637_0002434 3300046520 Bacteria 10278
295 Ga0495637_0005066 3300046520 Bacteria 6764
296 Ga0495637_0005493 3300046520 Bacteria 6444
297 Ga0495637_0006493 3300046520 Bacteria 5865
298 Ga0495637_0009313 3300046520 Bacteria 4793
299 Ga0495637_0010825 3300046520 Bacteria 4397
300 Ga0495637_0015695 3300046520 Bacteria 3551
301 Ga0495643_0005605 3300046522 Bacteria 8438
302 Ga0495643_0011177 3300046522 Bacteria 5485
303 Ga0495643_0015024 3300046522 Bacteria 4590
304 Ga0495643_0020859 3300046522 Bacteria 3769
305 Ga0495643_0022395 3300046522 Bacteria 3606
306 Ga0495643_0031466 3300046522 Bacteria 2952
307 Ga0495643_0043282 3300046522 Bacteria 2451
308 Ga0495643_0049654 3300046522 Bacteria 2262
309 Ga0495644_0021443 3300046523 Bacteria 2465
310 Ga0495644_0056691 3300046523 Bacteria 1472
311 Ga0495648_0003663 3300046524 Bacteria 13437
312 Ga0495648_0004806 3300046524 Bacteria 11400
313 Ga0495648_0006773 3300046524 Bacteria 9262
314 Ga0495648_0015134 3300046524 Bacteria 5617
315 Ga0495648_0022065 3300046524 Bacteria 4393
316 Ga0495648_0022837 3300046524 Bacteria 4296
317 Ga0495648_0023413 3300046524 Bacteria 4230
318 Ga0495648_0046876 3300046524 Bacteria 2676
319 Ga0495648_0049729 3300046524 Bacteria 2567
320 Ga0495648_0054757 3300046524 Bacteria 2408
321 Ga0495648_0100588 3300046524 Bacteria 1596
322 Ga0495648_0100735 3300046524 Bacteria 1595
323 Ga0495666_0010600 3300046526 Bacteria 4593
324 Ga0495666_0013235 3300046526 Bacteria 4114
325 Ga0495666_0017940 3300046526 Bacteria 3524
326 Ga0495666_0034537 3300046526 Bacteria 2467
327 Ga0495666_0046875 3300046526 Bacteria 2082
328 Ga0495666_0066628 3300046526 Bacteria 1716
329 Ga0495642_0000036 3300046528 Bacteria 79741
330 Ga0495642_0000528 3300046528 Bacteria 19457
331 Ga0495642_0002651 3300046528 Bacteria 7206
332 Ga0495654_0003123 3300046530 Bacteria 10288
333 Ga0495654_0004391 3300046530 Bacteria 8387
334 Ga0495654_0004729 3300046530 Bacteria 8009
335 Ga0495654_0012454 3300046530 Bacteria 4566
336 Ga0495654_0013262 3300046530 Bacteria 4414
337 Ga0495654_0014538 3300046530 Bacteria 4189
338 Ga0495654_0020565 3300046530 Bacteria 3438
339 Ga0495654_0029416 3300046530 Bacteria 2802
340 Ga0495654_0082318 3300046530 Bacteria 1506
341 Ga0495654_0134640 3300046530 Bacteria 1106
342 Ga0495586_0015288 3300046535 Bacteria 4082
343 Ga0495587_0011515 3300046536 Bacteria 5601
344 Ga0495587_0015675 3300046536 Bacteria 4727
345 Ga0495609_0000160 3300046538 Bacteria 69846
346 Ga0495609_0000300 3300046538 Bacteria 45229
347 Ga0495609_0000549 3300046538 Bacteria 29734
348 Ga0495597_0002262 3300046542 Bacteria 12520
349 Ga0495597_0007550 3300046542 Bacteria 5512
350 Ga0495597_0010063 3300046542 Bacteria 4640
351 Ga0495597_0010782 3300046542 Bacteria 4453
352 Ga0495597_0038041 3300046542 Bacteria 2158
353 Ga0495645_0095165 3300046543 Bacteria 2124
354 Ga0495622_0000887 3300046557 Bacteria 16307
355 Ga0495622_0032950 3300046557 Bacteria 2419
356 Ga0495633_0000525 3300046558 Bacteria 38410
357 Ga0495633_0012920 3300046558 Bacteria 4418
358 Ga0495633_0059695 3300046558 Bacteria 1788
359 Ga0495633_0069533 3300046558 Bacteria 1644
360 Ga0495656_0010122 3300046615 Bacteria 3416
361 Ga0495668_0000281 3300046616 Bacteria 70290
362 Ga0495668_0049150 3300046616 Bacteria 2339
363 Ga0495634_0000218 3300046642 Bacteria 53752
364 Ga0495634_0154312 3300046642 Bacteria 1450
365 Ga0495611_0010734 3300046648 Bacteria 3879
366 Ga0495625_0011382 3300046660 Bacteria 7259
367 Ga0495625_0015216 3300046660 Bacteria 6103
368 Ga0495625_0017521 3300046660 Bacteria 5607
369 Ga0495625_0029060 3300046660 Bacteria 4138
370 Ga0495625_0039764 3300046660 Bacteria 3432
371 Ga0495625_0055612 3300046660 Bacteria 2821
372 Ga0495625_0109306 3300046660 Bacteria 1891
373 Ga0495635_0006074 3300046663 Bacteria 8426
374 Ga0495635_0016760 3300046663 Bacteria 5118
375 Ga0495659_0002133 3300046664 Bacteria 6449
376 Ga0495659_0004191 3300046664 Bacteria 4551
377 Ga0495659_0009335 3300046664 Bacteria 3129
378 Ga0495661_0020626 3300046665 Bacteria 4300
379 Ga0495661_0030256 3300046665 Bacteria 3449
380 Ga0495661_0035919 3300046665 Bacteria 3106
381 Ga0495661_0036662 3300046665 Bacteria 3068
382 Ga0495661_0040135 3300046665 Bacteria 2905
383 Ga0495661_0177064 3300046665 Bacteria 1133
384 Ga0495588_0009770 3300046674 Bacteria 4448
385 Ga0495588_0062588 3300046674 Bacteria 1929
386 Ga0495588_0088842 3300046674 Bacteria 1618
387 Ga0495623_0005642 3300046679 Bacteria 8167
388 Ga0495623_0025983 3300046679 Bacteria 3771
389 Ga0495646_0018468 3300046680 Bacteria 4416
390 Ga0495646_0027360 3300046680 Bacteria 3578
391 Ga0495646_0033555 3300046680 Bacteria 3190
392 Ga0495669_0040841 3300046684 Bacteria 2058
393 Ga0495613_0030894 3300046689 Bacteria 3978
394 Ga0495613_0031533 3300046689 Bacteria 3937
395 Ga0495613_0215594 3300046689 Bacteria 1349
396 Ga0495670_0005071 3300046691 Bacteria 6476
397 Ga0495670_0015253 3300046691 Bacteria 3777
398 Ga0495670_0016555 3300046691 Bacteria 3625
399 Ga0495670_0028457 3300046691 Bacteria 2770
400 Ga0495670_0028652 3300046691 Bacteria 2760
401 Ga0495670_0038949 3300046691 Bacteria 2370
402 Ga0495670_0118631 3300046691 Bacteria 1373
403 Ga0495670_0155017 3300046691 Bacteria 1202
404 Ga0495670_0177911 3300046691 Bacteria 1122
405 Ga0495671_0000885 3300046692 Bacteria 21379
406 Ga0495671_0006149 3300046692 Bacteria 6968
407 Ga0495671_0008126 3300046692 Bacteria 5924
408 Ga0495671_0008290 3300046692 Bacteria 5852
409 Ga0495671_0016569 3300046692 Bacteria 3932
410 Ga0495671_0042848 3300046692 Bacteria 2273
411 Ga0495671_0049115 3300046692 Bacteria 2103
412 Ga0495649_0000257 3300046694 Bacteria 47325
413 Ga0495649_0003010 3300046694 Bacteria 11561
414 Ga0495649_0004846 3300046694 Bacteria 8703
415 Ga0495649_0008571 3300046694 Bacteria 6141
416 Ga0495649_0011094 3300046694 Bacteria 5304
417 Ga0495649_0011260 3300046694 Bacteria 5256
418 Ga0495649_0016847 3300046694 Bacteria 4137
419 Ga0495649_0019189 3300046694 Bacteria 3841
420 Ga0495649_0034608 3300046694 Bacteria 2779
421 Ga0495649_0040005 3300046694 Bacteria 2569
422 Ga0495649_0098047 3300046694 Bacteria 1559
423 Ga0495649_0120206 3300046694 Bacteria 1389
424 Ga0495649_0125807 3300046694 Bacteria 1354
425 Ga0495589_0000239 3300046794 Bacteria 45943
426 Ga0495589_0001071 3300046794 Bacteria 16431
427 Ga0495589_0005108 3300046794 Bacteria 6943
428 Ga0495589_0015678 3300046794 Bacteria 3895
429 Ga0495589_0019700 3300046794 Bacteria 3454
430 Ga0495589_0023436 3300046794 Bacteria 3145
431 Ga0495589_0035606 3300046794 Bacteria 2495
432 Ga0495589_0046316 3300046794 Bacteria 2158
433 Ga0495589_0104644 3300046794 Bacteria 1368
434 Ga0495600_0030641 3300046809 Bacteria 3484
435 Ga0495600_0199125 3300046809 Bacteria 1286
436 Ga0495660_0000507 3300046810 Bacteria 31985
437 Ga0495660_0020387 3300046810 Bacteria 3800
438 Ga0495660_0022072 3300046810 Bacteria 3637
439 Ga0495660_0022765 3300046810 Bacteria 3575
440 Ga0495660_0024307 3300046810 Bacteria 3452
441 Ga0495660_0057281 3300046810 Bacteria 2102
442 Ga0495660_0076203 3300046810 Bacteria 1767
443 Ga0495660_0079644 3300046810 Bacteria 1720
444 Ga0495660_0080894 3300046810 Bacteria 1704
445 Ga0495660_0101322 3300046810 Bacteria 1482
446 Ga0495581_0011688 3300047315 Bacteria 5080
447 Ga0495581_0056979 3300047315 Bacteria 2255
448 Ga0495604_0042298 3300047317 Bacteria 3571
449 Ga0495604_0100637 3300047317 Bacteria 2124
450 Ga0495604_0187461 3300047317 Bacteria 1443
451 Ga0495636_0001781 3300047318 Bacteria 8223
452 Ga0495674_0000139 3300047319 Bacteria 55581
453 Ga0495672_0000948 3300047320 Bacteria 30242
454 Ga0495672_0001337 3300047320 Bacteria 24480
455 Ga0495672_0009226 3300047320 Bacteria 7177
456 Ga0495672_0012214 3300047320 Bacteria 6006
457 Ga0495672_0023731 3300047320 Bacteria 3963
458 Ga0495672_0045981 3300047320 Bacteria 2607
459 Ga0495672_0051015 3300047320 Bacteria 2438
460 Ga0495672_0130816 3300047320 Bacteria 1320
461 Ga0495672_0142480 3300047320 Bacteria 1250
462 Ga0495672_0143823 3300047320 Bacteria 1243
463 Ga0495680_0003577 3300047322 Bacteria 15215
464 Ga0495680_0041390 3300047322 Bacteria 3664
465 Ga0495680_0061338 3300047322 Bacteria 2893
466 Ga0495680_0135675 3300047322 Bacteria 1804
467 Ga0495683_0000231 3300047323 Bacteria 51177
468 Ga0495683_0000564 3300047323 Bacteria 27981
469 Ga0495683_0012517 3300047323 Bacteria 4453
470 Ga0495683_0019057 3300047323 Bacteria 3541
471 Ga0495683_0022556 3300047323 Bacteria 3236
472 Ga0495683_0070630 3300047323 Bacteria 1714
473 Ga0495687_002031 3300047443 Bacteria 17116
474 Ga0495687_002866 3300047443 Bacteria 13204
475 Ga0495687_005355 3300047443 Bacteria 8204
476 Ga0495687_006475 3300047443 Bacteria 7164
477 Ga0495675_0029549 3300047444 Bacteria 3496
478 Ga0495675_0035151 3300047444 Bacteria 3200
479 Ga0495677_0002577 3300047445 Bacteria 7097
480 Ga0495677_0084578 3300047445 Bacteria 1191
481 Ga0495679_008487 3300047446 Bacteria 4171
482 Ga0495679_010649 3300047446 Bacteria 3599
483 Ga0495673_0000845 3300047469 Bacteria 28468
484 Ga0495673_0000966 3300047469 Bacteria 25951
485 Ga0495673_0002887 3300047469 Bacteria 11671
486 Ga0495673_0004283 3300047469 Bacteria 9002
487 Ga0495673_0007147 3300047469 Bacteria 6460
488 Ga0495673_0011266 3300047469 Bacteria 4820
489 Ga0495673_0012063 3300047469 Bacteria 4607
490 Ga0495673_0058828 3300047469 Bacteria 1654
491 Ga0495673_0067790 3300047469 Bacteria 1509
492 Ga0495673_0114662 3300047469 Bacteria 1073
493 Ga0495681_0000031 3300047470 Bacteria 128177
494 Ga0495681_0000234 3300047470 Bacteria 45933
495 Ga0495681_0009517 3300047470 Bacteria 5975
496 Ga0495681_0013850 3300047470 Bacteria 4660
497 Ga0495681_0016607 3300047470 Bacteria 4115
498 Ga0495681_0018420 3300047470 Bacteria 3847
499 Ga0495681_0020404 3300047470 Bacteria 3597
500 Ga0495681_0034182 3300047470 Bacteria 2535
501 Ga0495681_0036301 3300047470 Bacteria 2438
502 Ga0495681_0036336 3300047470 Bacteria 2437
503 Ga0495681_0037932 3300047470 Bacteria 2368
504 Ga0495681_0044263 3300047470 Bacteria 2141
505 Ga0495684_0017511 3300047471 Bacteria 5516
506 Ga0495686_0005597 3300047472 Bacteria 9868
507 Ga0495686_0010890 3300047472 Bacteria 6440
508 Ga0495686_0083745 3300047472 Bacteria 1944
509 Ga0495593_0016129 3300047673 Bacteria 4216
510 Ga0495593_0022706 3300047673 Bacteria 3491
511 Ga0495593_0079928 3300047673 Bacteria 1692
512 Ga0495626_0000247 3300048091 Bacteria 62776
513 Ga0495626_0000451 3300048091 Bacteria 41891
514 Ga0495626_0001178 3300048091 Bacteria 21718
515 Ga0495626_0001217 3300048091 Bacteria 21209
516 Ga0495626_0001296 3300048091 Bacteria 20398
517 Ga0495626_0010470 3300048091 Bacteria 4944
518 Ga0496102_0000475 3300048905 Bacteria 44485
519 Ga0496103_0001816 3300048906 Bacteria 13891
520 Ga0496105_0155945 3300048908 Bacteria 1875
521 Ga0496106_0105711 3300048909 Bacteria 2187
522 Ga0496110_0027602 3300048913 Bacteria 4867
523 Ga0496110_0077805 3300048913 Bacteria 2951
524 Ga0496110_0285528 3300048913 Bacteria 1503
525 Ga0496111_0043472 3300048914 Bacteria 3229
526 Ga0496112_0102765 3300048915 Bacteria 2828
527 Ga0496115_0018542 3300048918 Bacteria 5346
528 Ga0496116_0002071 3300048919 Bacteria 21456
529 Ga0496117_0012424 3300048920 Bacteria 7506
530 Ga0496117_0044472 3300048920 Bacteria 3216
531 Ga0496117_0049105 3300048920 Bacteria 3005
532 Ga0496117_0049556 3300048920 Bacteria 2986
533 Ga0496118_0047361 3300048921 Bacteria 3332
534 Ga0496118_0049118 3300048921 Bacteria 3251
535 Ga0496118_0051398 3300048921 Bacteria 3153
536 Ga0496118_0053977 3300048921 Bacteria 3048
537 Ga0496118_0071547 3300048921 Bacteria 2496
538 Ga0496118_0128802 3300048921 Bacteria 1630
539 Ga0496121_0004116 3300048924 Bacteria 19935
540 Ga0496121_0044788 3300048924 Bacteria 3811
541 Ga0496121_0072584 3300048924 Bacteria 2762
542 Ga0496121_0124421 3300048924 Bacteria 1941
543 Ga0496122_0008573 3300048925 Bacteria 10992
544 Ga0496123_0110728 3300048926 Bacteria 1570
545 Ga0496124_0060008 3300048927 Bacteria 3192
546 Ga0496124_0079532 3300048927 Bacteria 2699
547 Ga0496124_0200241 3300048927 Bacteria 1519
548 Ga0496125_0025773 3300048928 Bacteria 5377
549 Ga0496125_0259821 3300048928 Bacteria 1089
550 Ga0496126_0229376 3300048929 Bacteria 1556
551 Ga0496126_0378243 3300048929 Bacteria 1153
552 Ga0495678_001629 3300049459 Bacteria 17088
553 Ga0495678_003034 3300049459 Bacteria 10675
554 Ga0495678_005298 3300049459 Bacteria 7162
555 Ga0495678_010861 3300049459 Bacteria 4393
556 Ga0495678_030058 3300049459 Bacteria 2276
557 Ga0495682_0038019 3300049460 Bacteria 1769
558 Ga0495682_0049283 3300049460 Bacteria 1534
559 Ga0495682_0063805 3300049460 Bacteria 1328
560 Ga0501222_000675 3300049662 Bacteria 4991
561 Ga0501269_001135 3300049766 Bacteria 3691
562 nmdc:mga03683_10350_c1 3300050489 Bacteria 3343
563 nmdc:mga0sz30_36361_c1 3300050516 Bacteria 2058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100020672 Ga0307408_1000206723 255
2 3300032004 Ga0307414_10187435 Ga0307414_101874352 255
3 3300049766 Ga0501269_001135 Ga0501269_001135_1166_2065 256
4 3300046501 Ga0495607_0129310 Ga0495607_0129310_295_1224 279
5 3300046513 Ga0495616_0058076 Ga0495616_0058076_483_1325 280
6 3300013104 Ga0157370_10063422 Ga0157370_100634223 281
7 3300046453 Ga0495627_053055 Ga0495627_053055_350_1195 281
8 3300046501 Ga0495607_0014555 Ga0495607_0014555_896_1741 281
9 3300046513 Ga0495616_0017558 Ga0495616_0017558_1548_2393 281
10 3300046515 Ga0495620_0021804 Ga0495620_0021804_850_1695 281
11 3300046530 Ga0495654_0020565 Ga0495654_0020565_1302_2147 281
12 3300046674 Ga0495588_0009770 Ga0495588_0009770_806_1651 281
13 3300046691 Ga0495670_0155017 Ga0495670_0155017_31_876 281
14 3300047320 Ga0495672_0143823 Ga0495672_0143823_82_927 281
15 3300048927 Ga0496124_0200241 Ga0496124_0200241_648_1493 281
16 iso_pu_bacteria 8056143049 8056146843 281
17 iso_pu_bacteria 2919063839 2919064742 283
18 3300046457 Ga0495590_0026117 Ga0495590_0026117_393_1274 285
19 3300046471 Ga0495650_0016017 Ga0495650_0016017_955_1836 285
20 3300046491 Ga0495584_0034120 Ga0495584_0034120_89_970 285
21 3300046492 Ga0495585_0013206 Ga0495585_0013206_1462_2343 285
22 3300046519 Ga0495632_0000619 Ga0495632_0000619_21921_22802 285
23 3300046520 Ga0495637_0001819 Ga0495637_0001819_9028_9909 285
24 3300046615 Ga0495656_0010122 Ga0495656_0010122_1450_2331 285
25 3300046691 Ga0495670_0118631 Ga0495670_0118631_240_1121 285
26 3300046692 Ga0495671_0042848 Ga0495671_0042848_196_1077 285
27 3300047323 Ga0495683_0022556 Ga0495683_0022556_941_1822 285
28 3300047445 Ga0495677_0002577 Ga0495677_0002577_3606_4487 285
29 iso_pu_bacteria 2511231010 2511288640 285
30 iso_pu_bacteria 2511231156 2511825261 285
31 iso_pu_bacteria 2599185306 2599968267 285
32 iso_pu_bacteria 2599185308 2599979453 285
33 iso_pu_bacteria 2599185314 2600009992 285
34 iso_pu_bacteria 2599185318 2600035913 285
35 iso_pu_bacteria 2599185319 2600042976 285
36 iso_pu_bacteria 2599185323 2600066262 285
37 iso_pu_bacteria 2600255318 2601798824 285
38 iso_pu_bacteria 2603880185 2606077719 285
39 iso_pu_bacteria 2603880199 2606130106 285
40 iso_pu_bacteria 2623620443 2624481020 285
41 iso_pu_bacteria 2643221650 2644280856 285
42 iso_pu_bacteria 2713897149 2715757064 285
43 iso_pu_bacteria 2825651385 2825652558 285
44 iso_pu_bacteria 2842854478 2842855142 285
45 iso_pu_bacteria 2878029506 2878032946 285
46 iso_pu_bacteria 2929144301 2929147893 285
47 iso_pu_bacteria 2931369376 2931370161 285
48 iso_pu_bacteria 3007718800 3007722557 285
49 iso_pu_bacteria 3007866637 3007868626 285
50 3300005288 Ga0065714_10098826 Ga0065714_100988262 287
51 3300005353 Ga0070669_100169083 Ga0070669_1001690832 287
52 3300013100 Ga0157373_10053556 Ga0157373_100535562 287
53 3300015265 Ga0182005_1002885 Ga0182005_10028853 287
54 3300042142 Ga0450905_000824 Ga0450905_000824_165_1028 287
55 3300042993 Ga0439440_0000889 Ga0439440_0000889_808_1689 287
56 3300046460 Ga0495638_0057299 Ga0495638_0057299_750_1631 287
57 3300046616 Ga0495668_0049150 Ga0495668_0049150_436_1317 287
58 3300046694 Ga0495649_0098047 Ga0495649_0098047_153_1034 287
59 3300047446 Ga0495679_010649 Ga0495679_010649_1782_2663 287
60 iso_pu_bacteria 2651869719 2652547133 287
61 iso_pu_bacteria 2599185302 2599941399 288
62 iso_pu_bacteria 2599185304 2599953081 288
63 iso_pu_bacteria 2599185309 2599982665 288
64 iso_pu_bacteria 2599185310 2599989734 288
65 iso_pu_bacteria 2599185312 2599998631 288
66 iso_pu_bacteria 2599185320 2600047309 288
67 iso_pu_bacteria 2808606361 2808855283 288
68 iso_pu_bacteria 2808606376 2808923005 288
69 iso_pu_bacteria 2808606378 2808935141 288
70 iso_pu_bacteria 2808606380 2808945121 288
71 iso_pu_bacteria 2808606383 2808963788 288
72 iso_pu_bacteria 2808606389 2808998676 288
73 iso_pu_bacteria 2913036834 2913038986 288
74 iso_pu_bacteria 2988728565 2988733973 288
75 2162886007 SwRhRL2b_contig_2088678 SwRhRL2b_0462.00005590 289
76 3300003781 Ga0055536_1000452 Ga0055536_100045210 289
77 3300003791 Ga0055530_10000868 Ga0055530_1000086810 289
78 3300003792 Ga0055540_1000009 Ga0055540_1000009197 289
79 3300003792 Ga0055540_1000236 Ga0055540_100023611 289
80 3300003794 Ga0055531_10000668 Ga0055531_1000066819 289
81 3300006177 Ga0075362_10158151 Ga0075362_101581512 289
82 3300009011 Ga0105251_10016453 Ga0105251_100164532 289
83 3300009036 Ga0105244_10001862 Ga0105244_100018628 289
84 3300009092 Ga0105250_10005317 Ga0105250_100053173 289
85 3300009148 Ga0105243_10000170 Ga0105243_1000017047 289
86 3300011119 Ga0105246_10000712 Ga0105246_100007128 289
87 3300013100 Ga0157373_10027056 Ga0157373_100270562 289
88 3300013104 Ga0157370_10056368 Ga0157370_100563683 289
89 3300015261 Ga0182006_1015567 Ga0182006_10155673 289
90 3300015261 Ga0182006_1020389 Ga0182006_10203893 289
91 3300025291 Ga0209675_1017086 Ga0209675_10170861 289
92 3300025292 Ga0209676_1000002 Ga0209676_1000002874 289
93 3300025292 Ga0209676_1004635 Ga0209676_10046354 289
94 3300025298 Ga0209050_1000006 Ga0209050_1000006696 289
95 3300025298 Ga0209050_1000009 Ga0209050_1000009809 289
96 3300025303 Ga0209051_1000001 Ga0209051_1000001874 289
97 3300025303 Ga0209051_1000008 Ga0209051_1000008566 289
98 3300025304 Ga0209257_1000269 Ga0209257_100026981 289
99 3300025711 Ga0207696_1001504 Ga0207696_10015046 289
100 3300025728 Ga0207655_1000270 Ga0207655_100027084 289
101 3300025728 Ga0207655_1006979 Ga0207655_10069792 289
102 3300025728 Ga0207655_1025139 Ga0207655_10251393 289
103 3300025735 Ga0207713_1000369 Ga0207713_10003697 289
104 3300025735 Ga0207713_1024541 Ga0207713_10245412 289
105 3300025935 Ga0207709_10000004 Ga0207709_10000004631 289
106 3300042013 Ga0439456_002558 Ga0439456_002558_139_1008 289
107 3300042138 Ga0450903_018064 Ga0450903_018064_10_879 289
108 3300046452 Ga0495617_007293 Ga0495617_007293_2694_3563 289
109 3300046453 Ga0495627_048465 Ga0495627_048465_178_1056 289
110 3300046457 Ga0495590_0008230 Ga0495590_0008230_2636_3505 289
111 3300046460 Ga0495638_0028892 Ga0495638_0028892_2509_3378 289
112 3300046471 Ga0495650_0016510 Ga0495650_0016510_2659_3537 289
113 3300046491 Ga0495584_0011095 Ga0495584_0011095_1968_2846 289
114 3300046501 Ga0495607_0133399 Ga0495607_0133399_278_1174 289
115 3300046507 Ga0495606_0006238 Ga0495606_0006238_2636_3514 289
116 3300046513 Ga0495616_0092122 Ga0495616_0092122_20_898 289
117 3300046515 Ga0495620_0000095 Ga0495620_0000095_43764_44642 289
118 3300046518 Ga0495631_0008587 Ga0495631_0008587_2690_3568 289
119 3300046519 Ga0495632_0009687 Ga0495632_0009687_548_1426 289
120 3300046520 Ga0495637_0002434 Ga0495637_0002434_6903_7781 289
121 3300046522 Ga0495643_0049654 Ga0495643_0049654_1193_2089 289
122 3300046524 Ga0495648_0022065 Ga0495648_0022065_1714_2610 289
123 3300046530 Ga0495654_0134640 Ga0495654_0134640_109_987 289
124 3300046538 Ga0495609_0000160 Ga0495609_0000160_43475_44353 289
125 3300046660 Ga0495625_0011382 Ga0495625_0011382_3794_4690 289
126 3300046660 Ga0495625_0015216 Ga0495625_0015216_2732_3610 289
127 3300046689 Ga0495613_0030894 Ga0495613_0030894_2754_3623 289
128 3300046694 Ga0495649_0004846 Ga0495649_0004846_2619_3497 289
129 3300046794 Ga0495589_0000239 Ga0495589_0000239_2630_3508 289
130 3300046810 Ga0495660_0000507 Ga0495660_0000507_24161_25057 289
131 3300047470 Ga0495681_0000234 Ga0495681_0000234_2625_3503 289
132 3300048913 Ga0496110_0077805 Ga0496110_0077805_1990_2859 289
133 3300048920 Ga0496117_0044472 Ga0496117_0044472_2197_3093 289
134 3300048920 Ga0496117_0049105 Ga0496117_0049105_124_1020 289
135 3300048921 Ga0496118_0047361 Ga0496118_0047361_129_1025 289
136 3300048921 Ga0496118_0053977 Ga0496118_0053977_134_1030 289
137 3300048921 Ga0496118_0071547 Ga0496118_0071547_191_1060 289
138 3300048921 Ga0496118_0128802 Ga0496118_0128802_430_1299 289
139 3300048924 Ga0496121_0044788 Ga0496121_0044788_2716_3585 289
140 3300048924 Ga0496121_0072584 Ga0496121_0072584_1740_2636 289
141 3300048927 Ga0496124_0060008 Ga0496124_0060008_121_990 289
142 3300048927 Ga0496124_0079532 Ga0496124_0079532_1716_2612 289
143 3300048928 Ga0496125_0259821 Ga0496125_0259821_118_1014 289
144 3300048929 Ga0496126_0378243 Ga0496126_0378243_155_1051 289
145 3300049459 Ga0495678_003034 Ga0495678_003034_7607_8485 289
146 iso_pu_bacteria 2511231007 2511269527 289
147 iso_pu_bacteria 2511231008 2511275967 289
148 iso_pu_bacteria 2511231014 2511312850 289
149 iso_pu_bacteria 2511231015 2511320172 289
150 iso_pu_bacteria 2511231018 2511338630 289
151 iso_pu_bacteria 2511231019 2511342456 289
152 iso_pu_bacteria 2511231020 2511351616 289
153 iso_pu_bacteria 2511231022 2511360264 289
154 iso_pu_bacteria 2623620446 2624491640 289
155 iso_pu_bacteria 2643221565 2643841538 289
156 iso_pu_bacteria 2643221589 2643954223 289
157 iso_pu_bacteria 2643221602 2644023032 289
158 iso_pu_bacteria 2643221633 2644186524 289
159 iso_pu_bacteria 2738543004 2739199254 289
160 iso_pu_bacteria 2738543015 2739257099 289
161 iso_pu_bacteria 2773857670 2774120134 289
162 iso_pu_bacteria 2784132072 2784311935 289
163 iso_pu_bacteria 2808606377 2808932901 289
164 iso_pu_bacteria 2808606381 2808955030 289
165 iso_pu_bacteria 2808606382 2808956359 289
166 iso_pu_bacteria 2808606445 2809214652 289
167 iso_pu_bacteria 2860339153 2860342930 289
168 iso_pu_bacteria 2919456309 2919460549 289
169 iso_pu_bacteria 2919697872 2919703365 289
170 iso_pu_bacteria 2931396565 2931401582 289
171 iso_pu_bacteria 2939636861 2939639101 289
172 iso_pu_bacteria 3007511990 3007514039 289
173 iso_pu_bacteria 3007619802 3007625246 289
174 iso_pu_bacteria 8019775933 8019778484 289
175 iso_pu_bacteria 8056125926 8056128598 289
176 iso_pu_bacteria 8056155041 8056159108 289
177 iso_pu_bacteria 8056177738 8056177999 289
178 3300046501 Ga0495607_0053901 Ga0495607_0053901_1322_2200 290
179 3300015261 Ga0182006_1005669 Ga0182006_10056694 292
180 3300030744 Ga0316181_1042145 Ga0316181_10421452 292
181 3300042016 Ga0439463_003531 Ga0439463_003531_1612_2517 292
182 3300042533 Ga0450901_002961 Ga0450901_002961_502_1386 292
183 3300042993 Ga0439440_0040794 Ga0439440_0040794_74_979 292
184 3300046460 Ga0495638_0004482 Ga0495638_0004482_7899_8783 292
185 3300047470 Ga0495681_0020404 Ga0495681_0020404_1110_1994 292
186 2124908027 MRS2a_Contig_164 MRS2a_00063710 293
187 3300002771 JGI25163J39215_1000803 JGI25163J39215_100080311 293
188 3300002772 JGI25164J39214_1000005 JGI25164J39214_100000542 293
189 3300003214 JGI25165J46597_1000340 JGI25165J46597_10003409 293
190 3300005288 Ga0065714_10001987 Ga0065714_100019873 293
191 3300005288 Ga0065714_10012499 Ga0065714_100124996 293
192 3300005288 Ga0065714_10072120 Ga0065714_100721202 293
193 3300005288 Ga0065714_10075802 Ga0065714_100758022 293
194 3300005288 Ga0065714_10080678 Ga0065714_100806782 293
195 3300005288 Ga0065714_10116923 Ga0065714_101169231 293
196 3300005288 Ga0065714_10129903 Ga0065714_101299031 293
197 3300005293 Ga0065715_10125014 Ga0065715_101250141 293
198 3300006048 Ga0075363_100118934 Ga0075363_1001189342 293
199 3300006058 Ga0075432_10004319 Ga0075432_100043193 293
200 3300006058 Ga0075432_10012231 Ga0075432_100122312 293
201 3300006058 Ga0075432_10013500 Ga0075432_100135003 293
202 3300006058 Ga0075432_10037516 Ga0075432_100375161 293
203 3300006058 Ga0075432_10068132 Ga0075432_100681321 293
204 3300006186 Ga0075369_10117443 Ga0075369_101174431 293
205 3300006914 Ga0075436_100279465 Ga0075436_1002794651 293
206 3300006946 Ga0079104_1000081 Ga0079104_100008179 293
207 3300009036 Ga0105244_10001116 Ga0105244_100011166 293
208 3300009036 Ga0105244_10021297 Ga0105244_100212972 293
209 3300009036 Ga0105244_10049580 Ga0105244_100495802 293
210 3300009036 Ga0105244_10089077 Ga0105244_100890771 293
211 3300009092 Ga0105250_10030610 Ga0105250_100306101 293
212 3300009148 Ga0105243_10023788 Ga0105243_100237882 293
213 3300013100 Ga0157373_10225109 Ga0157373_102251091 293
214 3300013104 Ga0157370_10107272 Ga0157370_101072722 293
215 3300013105 Ga0157369_10082474 Ga0157369_100824743 293
216 3300013306 Ga0163162_10021787 Ga0163162_100217875 293
217 3300013306 Ga0163162_10284463 Ga0163162_102844632 293
218 3300014497 Ga0182008_10005367 Ga0182008_100053672 293
219 3300014497 Ga0182008_10006214 Ga0182008_100062146 293
220 3300014497 Ga0182008_10006602 Ga0182008_100066025 293
221 3300015261 Ga0182006_1000700 Ga0182006_100070019 293
222 3300015261 Ga0182006_1002868 Ga0182006_10028686 293
223 3300015262 Ga0182007_10000857 Ga0182007_100008579 293
224 3300015265 Ga0182005_1004447 Ga0182005_10044474 293
225 3300015265 Ga0182005_1009625 Ga0182005_10096252 293
226 3300015265 Ga0182005_1010815 Ga0182005_10108152 293
227 3300017792 Ga0163161_10004005 Ga0163161_100040057 293
228 3300017792 Ga0163161_10052396 Ga0163161_100523962 293
229 3300017792 Ga0163161_10070189 Ga0163161_100701892 293
230 3300025207 Ga0209760_100007 Ga0209760_10000739 293
231 3300025231 Ga0207427_100018 Ga0207427_100018216 293
232 3300025233 Ga0209437_100031 Ga0209437_100031216 293
233 3300025261 Ga0209233_1000012 Ga0209233_1000012214 293
234 3300025711 Ga0207696_1008699 Ga0207696_10086991 293
235 3300025728 Ga0207655_1000167 Ga0207655_100016774 293
236 3300025728 Ga0207655_1026236 Ga0207655_10262363 293
237 3300025728 Ga0207655_1029503 Ga0207655_10295032 293
238 3300025728 Ga0207655_1053060 Ga0207655_10530601 293
239 3300025735 Ga0207713_1000725 Ga0207713_100072530 293
240 3300025935 Ga0207709_10056168 Ga0207709_100561682 293
241 3300027111 Ga0209281_1000055 Ga0209281_1000055176 293
242 3300027907 Ga0207428_10016988 Ga0207428_100169883 293
243 3300027907 Ga0207428_10020972 Ga0207428_100209725 293
244 3300027907 Ga0207428_10053743 Ga0207428_100537433 293
245 3300027907 Ga0207428_10060993 Ga0207428_100609932 293
246 3300027907 Ga0207428_10105893 Ga0207428_101058932 293
247 3300027907 Ga0207428_10150334 Ga0207428_101503342 293
248 3300030521 Ga0307511_10067373 Ga0307511_100673733 293
249 3300030742 Ga0316183_1059472 Ga0316183_10594722 293
250 3300031731 Ga0307405_10000264 Ga0307405_100002649 293
251 3300031901 Ga0307406_10016094 Ga0307406_100160943 293
252 3300031903 Ga0307407_10012143 Ga0307407_100121433 293
253 3300031911 Ga0307412_10025866 Ga0307412_100258662 293
254 3300031995 Ga0307409_100265253 Ga0307409_1002652532 293
255 3300032005 Ga0307411_10075082 Ga0307411_100750823 293
256 3300041405 Ga0439438_000054 Ga0439438_000054_51069_52091 293
257 3300041405 Ga0439438_002127 Ga0439438_002127_7641_8522 293
258 3300041407 Ga0439447_000412 Ga0439447_000412_14930_15811 293
259 3300041407 Ga0439447_005142 Ga0439447_005142_1922_2803 293
260 3300041411 Ga0439466_0001040 Ga0439466_0001040_7619_8500 293
261 3300041411 Ga0439466_0005587 Ga0439466_0005587_1300_2181 293
262 3300041411 Ga0439466_0005682 Ga0439466_0005682_2023_2904 293
263 3300041411 Ga0439466_0005944 Ga0439466_0005944_2492_3514 293
264 3300041411 Ga0439466_0012503 Ga0439466_0012503_771_1652 293
265 3300041413 Ga0439465_0010677 Ga0439465_0010677_1376_2398 293
266 3300042006 Ga0439432_000642 Ga0439432_000642_6660_7682 293
267 3300042006 Ga0439432_010103 Ga0439432_010103_1121_2002 293
268 3300042006 Ga0439432_012581 Ga0439432_012581_540_1421 293
269 3300042009 Ga0439451_001887 Ga0439451_001887_1937_2824 293
270 3300042009 Ga0439451_002420 Ga0439451_002420_2548_3570 293
271 3300042010 Ga0439452_000693 Ga0439452_000693_12773_13654 293
272 3300042010 Ga0439452_001117 Ga0439452_001117_8255_9136 293
273 3300042010 Ga0439452_002041 Ga0439452_002041_6164_7045 293
274 3300042010 Ga0439452_004122 Ga0439452_004122_1623_2504 293
275 3300042010 Ga0439452_022281 Ga0439452_022281_380_1261 293
276 3300042013 Ga0439456_001584 Ga0439456_001584_971_1852 293
277 3300042013 Ga0439456_017149 Ga0439456_017149_391_1413 293
278 3300042016 Ga0439463_015084 Ga0439463_015084_69_956 293
279 3300042115 Ga0450911_001095 Ga0450911_001095_2997_3878 293
280 3300042115 Ga0450911_005900 Ga0450911_005900_715_1596 293
281 3300042121 Ga0450919_000318 Ga0450919_000318_1924_2805 293
282 3300042122 Ga0450920_001294 Ga0450920_001294_1973_2860 293
283 3300042124 Ga0450922_000054 Ga0450922_000054_1694_2581 293
284 3300042138 Ga0450903_002192 Ga0450903_002192_1237_2118 293
285 3300042139 Ga0450904_001959 Ga0450904_001959_1311_2231 293
286 3300042145 Ga0450906_001383 Ga0450906_001383_1458_2480 293
287 3300042146 Ga0450907_000043 Ga0450907_000043_46378_47259 293
288 3300042146 Ga0450907_001292 Ga0450907_001292_2084_3106 293
289 3300042146 Ga0450907_004012 Ga0450907_004012_1263_2150 293
290 3300042147 Ga0450910_006391 Ga0450910_006391_30_917 293
291 3300042156 Ga0439446_0003837 Ga0439446_0003837_303_1325 293
292 3300042184 Ga0450908_002769 Ga0450908_002769_2320_3342 293
293 3300042435 Ga0439434_0004368 Ga0439434_0004368_2138_3019 293
294 3300042439 Ga0439464_0032100 Ga0439464_0032100_183_1205 293
295 3300042461 Ga0439460_0002420 Ga0439460_0002420_1002_1883 293
296 3300046452 Ga0495617_000121 Ga0495617_000121_10638_11519 293
297 3300046452 Ga0495617_004818 Ga0495617_004818_1886_2767 293
298 3300046452 Ga0495617_009253 Ga0495617_009253_1354_2241 293
299 3300046452 Ga0495617_011861 Ga0495617_011861_1058_1939 293
300 3300046452 Ga0495617_019075 Ga0495617_019075_384_1271 293
301 3300046453 Ga0495627_016864 Ga0495627_016864_1393_2280 293
302 3300046455 Ga0495603_0034042 Ga0495603_0034042_1483_2364 293
303 3300046457 Ga0495590_0003992 Ga0495590_0003992_2207_3088 293
304 3300046457 Ga0495590_0009080 Ga0495590_0009080_1419_2306 293
305 3300046457 Ga0495590_0010730 Ga0495590_0010730_2245_3126 293
306 3300046457 Ga0495590_0041988 Ga0495590_0041988_83_970 293
307 3300046458 Ga0495591_000086 Ga0495591_000086_61549_62436 293
308 3300046458 Ga0495591_004870 Ga0495591_004870_2701_3582 293
309 3300046458 Ga0495591_006144 Ga0495591_006144_4328_5209 293
310 3300046458 Ga0495591_020592 Ga0495591_020592_1001_1888 293
311 3300046458 Ga0495591_025843 Ga0495591_025843_313_1194 293
312 3300046458 Ga0495591_028043 Ga0495591_028043_704_1591 293
313 3300046460 Ga0495638_0003127 Ga0495638_0003127_8320_9201 293
314 3300046460 Ga0495638_0005022 Ga0495638_0005022_7108_7989 293
315 3300046460 Ga0495638_0011398 Ga0495638_0011398_2621_3508 293
316 3300046460 Ga0495638_0017677 Ga0495638_0017677_1175_2062 293
317 3300046460 Ga0495638_0034075 Ga0495638_0034075_1168_2055 293
318 3300046460 Ga0495638_0092028 Ga0495638_0092028_66_953 293
319 3300046460 Ga0495638_0120312 Ga0495638_0120312_458_1345 293
320 3300046463 Ga0495653_0017034 Ga0495653_0017034_267_1175 293
321 3300046463 Ga0495653_0037726 Ga0495653_0037726_1142_2029 293
322 3300046463 Ga0495653_0088728 Ga0495653_0088728_1349_2236 293
323 3300046471 Ga0495650_0004241 Ga0495650_0004241_6522_7409 293
324 3300046471 Ga0495650_0004707 Ga0495650_0004707_2231_3118 293
325 3300046471 Ga0495650_0006805 Ga0495650_0006805_4594_5475 293
326 3300046471 Ga0495650_0022428 Ga0495650_0022428_1091_1972 293
327 3300046472 Ga0495580_0253975 Ga0495580_0253975_206_1093 293
328 3300046473 Ga0495582_0023586 Ga0495582_0023586_1453_2361 293
329 3300046474 Ga0495605_0000346 Ga0495605_0000346_39796_40677 293
330 3300046474 Ga0495605_0000980 Ga0495605_0000980_2693_3580 293
331 3300046474 Ga0495605_0007860 Ga0495605_0007860_853_1734 293
332 3300046474 Ga0495605_0015719 Ga0495605_0015719_1499_2386 293
333 3300046474 Ga0495605_0016963 Ga0495605_0016963_2907_3794 293
334 3300046474 Ga0495605_0023354 Ga0495605_0023354_1534_2415 293
335 3300046474 Ga0495605_0048263 Ga0495605_0048263_467_1348 293
336 3300046474 Ga0495605_0078654 Ga0495605_0078654_543_1430 293
337 3300046474 Ga0495605_0126116 Ga0495605_0126116_10_897 293
338 3300046475 Ga0495639_0000225 Ga0495639_0000225_16265_17152 293
339 3300046475 Ga0495639_0031917 Ga0495639_0031917_226_1134 293
340 3300046491 Ga0495584_0002250 Ga0495584_0002250_1235_2122 293
341 3300046491 Ga0495584_0002725 Ga0495584_0002725_2878_3759 293
342 3300046491 Ga0495584_0003244 Ga0495584_0003244_5961_6848 293
343 3300046491 Ga0495584_0005172 Ga0495584_0005172_2656_3537 293
344 3300046491 Ga0495584_0005197 Ga0495584_0005197_2675_3562 293
345 3300046491 Ga0495584_0005876 Ga0495584_0005876_2844_3725 293
346 3300046491 Ga0495584_0007307 Ga0495584_0007307_2701_3582 293
347 3300046491 Ga0495584_0011131 Ga0495584_0011131_2751_3632 293
348 3300046492 Ga0495585_0000149 Ga0495585_0000149_31930_32817 293
349 3300046492 Ga0495585_0001687 Ga0495585_0001687_9075_9956 293
350 3300046492 Ga0495585_0008471 Ga0495585_0008471_1905_2786 293
351 3300046492 Ga0495585_0028992 Ga0495585_0028992_713_1600 293
352 3300046492 Ga0495585_0036783 Ga0495585_0036783_1664_2551 293
353 3300046492 Ga0495585_0040238 Ga0495585_0040238_692_1573 293
354 3300046492 Ga0495585_0132937 Ga0495585_0132937_292_1179 293
355 3300046492 Ga0495585_0154606 Ga0495585_0154606_168_1049 293
356 3300046499 Ga0495594_0006355 Ga0495594_0006355_1967_2854 293
357 3300046499 Ga0495594_0050113 Ga0495594_0050113_1163_2071 293
358 3300046500 Ga0495596_0000027 Ga0495596_0000027_61101_61988 293
359 3300046501 Ga0495607_0000167 Ga0495607_0000167_40852_41733 293
360 3300046501 Ga0495607_0014160 Ga0495607_0014160_1836_2723 293
361 3300046501 Ga0495607_0018345 Ga0495607_0018345_943_1824 293
362 3300046501 Ga0495607_0024529 Ga0495607_0024529_2594_3481 293
363 3300046501 Ga0495607_0031670 Ga0495607_0031670_2172_3053 293
364 3300046501 Ga0495607_0039438 Ga0495607_0039438_1385_2272 293
365 3300046501 Ga0495607_0128210 Ga0495607_0128210_253_1134 293
366 3300046501 Ga0495607_0162759 Ga0495607_0162759_213_1094 293
367 3300046506 Ga0495583_0014178 Ga0495583_0014178_926_1807 293
368 3300046506 Ga0495583_0015125 Ga0495583_0015125_3141_4022 293
369 3300046506 Ga0495583_0016198 Ga0495583_0016198_1708_2595 293
370 3300046507 Ga0495606_0002405 Ga0495606_0002405_3725_4606 293
371 3300046507 Ga0495606_0003610 Ga0495606_0003610_1708_2589 293
372 3300046507 Ga0495606_0007719 Ga0495606_0007719_549_1436 293
373 3300046507 Ga0495606_0042264 Ga0495606_0042264_1773_2660 293
374 3300046507 Ga0495606_0068797 Ga0495606_0068797_316_1197 293
375 3300046507 Ga0495606_0088950 Ga0495606_0088950_653_1540 293
376 3300046512 Ga0495610_0003112 Ga0495610_0003112_1647_2528 293
377 3300046512 Ga0495610_0005293 Ga0495610_0005293_2154_3035 293
378 3300046512 Ga0495610_0021581 Ga0495610_0021581_1429_2316 293
379 3300046512 Ga0495610_0023637 Ga0495610_0023637_1698_2585 293
380 3300046512 Ga0495610_0029861 Ga0495610_0029861_366_1247 293
381 3300046512 Ga0495610_0031745 Ga0495610_0031745_119_1006 293
382 3300046513 Ga0495616_0000425 Ga0495616_0000425_26176_27057 293
383 3300046513 Ga0495616_0022276 Ga0495616_0022276_347_1228 293
384 3300046513 Ga0495616_0072389 Ga0495616_0072389_549_1436 293
385 3300046515 Ga0495620_0006007 Ga0495620_0006007_2017_2898 293
386 3300046515 Ga0495620_0010198 Ga0495620_0010198_2829_3710 293
387 3300046515 Ga0495620_0010580 Ga0495620_0010580_2689_3576 293
388 3300046515 Ga0495620_0011491 Ga0495620_0011491_1049_1930 293
389 3300046516 Ga0495628_0094004 Ga0495628_0094004_83_991 293
390 3300046517 Ga0495630_0022453 Ga0495630_0022453_1471_2358 293
391 3300046517 Ga0495630_0049523 Ga0495630_0049523_1063_1971 293
392 3300046517 Ga0495630_0073016 Ga0495630_0073016_1230_2138 293
393 3300046518 Ga0495631_0000126 Ga0495631_0000126_43817_44704 293
394 3300046518 Ga0495631_0002781 Ga0495631_0002781_6768_7649 293
395 3300046518 Ga0495631_0011462 Ga0495631_0011462_863_1750 293
396 3300046518 Ga0495631_0050830 Ga0495631_0050830_334_1215 293
397 3300046519 Ga0495632_0001946 Ga0495632_0001946_11788_12669 293
398 3300046519 Ga0495632_0005924 Ga0495632_0005924_1382_2269 293
399 3300046519 Ga0495632_0016744 Ga0495632_0016744_243_1124 293
400 3300046519 Ga0495632_0019984 Ga0495632_0019984_2023_2904 293
401 3300046519 Ga0495632_0030266 Ga0495632_0030266_1379_2266 293
402 3300046519 Ga0495632_0054474 Ga0495632_0054474_193_1074 293
403 3300046519 Ga0495632_0077715 Ga0495632_0077715_319_1200 293
404 3300046520 Ga0495637_0000858 Ga0495637_0000858_13943_14830 293
405 3300046520 Ga0495637_0005066 Ga0495637_0005066_3703_4584 293
406 3300046520 Ga0495637_0005493 Ga0495637_0005493_2225_3112 293
407 3300046520 Ga0495637_0006493 Ga0495637_0006493_2757_3638 293
408 3300046520 Ga0495637_0009313 Ga0495637_0009313_1731_2618 293
409 3300046520 Ga0495637_0010825 Ga0495637_0010825_723_1604 293
410 3300046520 Ga0495637_0015695 Ga0495637_0015695_2362_3243 293
411 3300046522 Ga0495643_0005605 Ga0495643_0005605_5792_6673 293
412 3300046522 Ga0495643_0011177 Ga0495643_0011177_3636_4517 293
413 3300046522 Ga0495643_0015024 Ga0495643_0015024_2632_3513 293
414 3300046522 Ga0495643_0020859 Ga0495643_0020859_2104_2991 293
415 3300046522 Ga0495643_0022395 Ga0495643_0022395_2623_3504 293
416 3300046522 Ga0495643_0031466 Ga0495643_0031466_322_1203 293
417 3300046522 Ga0495643_0043282 Ga0495643_0043282_984_1865 293
418 3300046523 Ga0495644_0021443 Ga0495644_0021443_342_1223 293
419 3300046523 Ga0495644_0056691 Ga0495644_0056691_205_1092 293
420 3300046524 Ga0495648_0003663 Ga0495648_0003663_10169_11056 293
421 3300046524 Ga0495648_0004806 Ga0495648_0004806_2700_3581 293
422 3300046524 Ga0495648_0006773 Ga0495648_0006773_7857_8738 293
423 3300046524 Ga0495648_0015134 Ga0495648_0015134_1547_2434 293
424 3300046524 Ga0495648_0022837 Ga0495648_0022837_525_1412 293
425 3300046524 Ga0495648_0023413 Ga0495648_0023413_1121_2002 293
426 3300046524 Ga0495648_0046876 Ga0495648_0046876_1693_2580 293
427 3300046524 Ga0495648_0049729 Ga0495648_0049729_375_1262 293
428 3300046524 Ga0495648_0054757 Ga0495648_0054757_990_1871 293
429 3300046524 Ga0495648_0100588 Ga0495648_0100588_193_1074 293
430 3300046524 Ga0495648_0100735 Ga0495648_0100735_444_1331 293
431 3300046526 Ga0495666_0010600 Ga0495666_0010600_720_1628 293
432 3300046526 Ga0495666_0013235 Ga0495666_0013235_2651_3538 293
433 3300046526 Ga0495666_0017940 Ga0495666_0017940_1225_2112 293
434 3300046526 Ga0495666_0034537 Ga0495666_0034537_1317_2204 293
435 3300046526 Ga0495666_0046875 Ga0495666_0046875_416_1303 293
436 3300046526 Ga0495666_0066628 Ga0495666_0066628_692_1573 293
437 3300046528 Ga0495642_0000036 Ga0495642_0000036_57071_57952 293
438 3300046528 Ga0495642_0000528 Ga0495642_0000528_11203_12090 293
439 3300046528 Ga0495642_0002651 Ga0495642_0002651_2909_3790 293
440 3300046530 Ga0495654_0003123 Ga0495654_0003123_6510_7397 293
441 3300046530 Ga0495654_0004391 Ga0495654_0004391_3812_4693 293
442 3300046530 Ga0495654_0004729 Ga0495654_0004729_1422_2309 293
443 3300046530 Ga0495654_0012454 Ga0495654_0012454_2904_3791 293
444 3300046530 Ga0495654_0013262 Ga0495654_0013262_1814_2863 293
445 3300046530 Ga0495654_0014538 Ga0495654_0014538_2056_2937 293
446 3300046530 Ga0495654_0029416 Ga0495654_0029416_96_977 293
447 3300046530 Ga0495654_0082318 Ga0495654_0082318_247_1128 293
448 3300046535 Ga0495586_0015288 Ga0495586_0015288_1933_2841 293
449 3300046536 Ga0495587_0011515 Ga0495587_0011515_4081_4968 293
450 3300046536 Ga0495587_0015675 Ga0495587_0015675_2930_3838 293
451 3300046538 Ga0495609_0000300 Ga0495609_0000300_3274_4155 293
452 3300046538 Ga0495609_0000549 Ga0495609_0000549_8237_9118 293
453 3300046542 Ga0495597_0002262 Ga0495597_0002262_9181_10068 293
454 3300046542 Ga0495597_0007550 Ga0495597_0007550_2703_3584 293
455 3300046542 Ga0495597_0010063 Ga0495597_0010063_2330_3217 293
456 3300046542 Ga0495597_0010782 Ga0495597_0010782_1791_2672 293
457 3300046542 Ga0495597_0038041 Ga0495597_0038041_287_1168 293
458 3300046543 Ga0495645_0095165 Ga0495645_0095165_294_1202 293
459 3300046557 Ga0495622_0000887 Ga0495622_0000887_9781_10668 293
460 3300046557 Ga0495622_0032950 Ga0495622_0032950_779_1687 293
461 3300046558 Ga0495633_0000525 Ga0495633_0000525_1962_2849 293
462 3300046558 Ga0495633_0012920 Ga0495633_0012920_832_1713 293
463 3300046558 Ga0495633_0059695 Ga0495633_0059695_589_1470 293
464 3300046558 Ga0495633_0069533 Ga0495633_0069533_718_1599 293
465 3300046616 Ga0495668_0000281 Ga0495668_0000281_8355_9242 293
466 3300046642 Ga0495634_0000218 Ga0495634_0000218_4982_5869 293
467 3300046642 Ga0495634_0154312 Ga0495634_0154312_184_1092 293
468 3300046648 Ga0495611_0010734 Ga0495611_0010734_2611_3492 293
469 3300046660 Ga0495625_0017521 Ga0495625_0017521_3289_4170 293
470 3300046660 Ga0495625_0029060 Ga0495625_0029060_557_1438 293
471 3300046660 Ga0495625_0039764 Ga0495625_0039764_1117_2004 293
472 3300046660 Ga0495625_0055612 Ga0495625_0055612_1555_2442 293
473 3300046660 Ga0495625_0109306 Ga0495625_0109306_40_927 293
474 3300046663 Ga0495635_0006074 Ga0495635_0006074_1741_2628 293
475 3300046663 Ga0495635_0016760 Ga0495635_0016760_1069_1977 293
476 3300046664 Ga0495659_0002133 Ga0495659_0002133_3744_4631 293
477 3300046664 Ga0495659_0004191 Ga0495659_0004191_1227_2114 293
478 3300046664 Ga0495659_0009335 Ga0495659_0009335_1757_2638 293
479 3300046665 Ga0495661_0020626 Ga0495661_0020626_2560_3441 293
480 3300046665 Ga0495661_0030256 Ga0495661_0030256_1134_2021 293
481 3300046665 Ga0495661_0035919 Ga0495661_0035919_1324_2211 293
482 3300046665 Ga0495661_0036662 Ga0495661_0036662_311_1198 293
483 3300046665 Ga0495661_0040135 Ga0495661_0040135_1244_2131 293
484 3300046665 Ga0495661_0177064 Ga0495661_0177064_195_1082 293
485 3300046674 Ga0495588_0062588 Ga0495588_0062588_61_969 293
486 3300046674 Ga0495588_0088842 Ga0495588_0088842_488_1396 293
487 3300046679 Ga0495623_0005642 Ga0495623_0005642_5841_6728 293
488 3300046679 Ga0495623_0025983 Ga0495623_0025983_1346_2233 293
489 3300046680 Ga0495646_0018468 Ga0495646_0018468_1058_1945 293
490 3300046680 Ga0495646_0027360 Ga0495646_0027360_1649_2557 293
491 3300046680 Ga0495646_0033555 Ga0495646_0033555_1058_1945 293
492 3300046684 Ga0495669_0040841 Ga0495669_0040841_159_1046 293
493 3300046689 Ga0495613_0031533 Ga0495613_0031533_1400_2308 293
494 3300046689 Ga0495613_0215594 Ga0495613_0215594_27_908 293
495 3300046691 Ga0495670_0005071 Ga0495670_0005071_597_1484 293
496 3300046691 Ga0495670_0015253 Ga0495670_0015253_1403_2284 293
497 3300046691 Ga0495670_0016555 Ga0495670_0016555_1587_2474 293
498 3300046691 Ga0495670_0028457 Ga0495670_0028457_157_1044 293
499 3300046691 Ga0495670_0028652 Ga0495670_0028652_298_1185 293
500 3300046691 Ga0495670_0038949 Ga0495670_0038949_610_1491 293
501 3300046691 Ga0495670_0177911 Ga0495670_0177911_99_980 293
502 3300046692 Ga0495671_0000885 Ga0495671_0000885_17818_18705 293
503 3300046692 Ga0495671_0006149 Ga0495671_0006149_2204_3085 293
504 3300046692 Ga0495671_0008126 Ga0495671_0008126_1213_2094 293
505 3300046692 Ga0495671_0008290 Ga0495671_0008290_2273_3154 293
506 3300046692 Ga0495671_0016569 Ga0495671_0016569_234_1115 293
507 3300046692 Ga0495671_0049115 Ga0495671_0049115_582_1463 293
508 3300046694 Ga0495649_0000257 Ga0495649_0000257_13006_13887 293
509 3300046694 Ga0495649_0003010 Ga0495649_0003010_7982_8869 293
510 3300046694 Ga0495649_0008571 Ga0495649_0008571_3915_4802 293
511 3300046694 Ga0495649_0011094 Ga0495649_0011094_2542_3429 293
512 3300046694 Ga0495649_0011260 Ga0495649_0011260_3362_4243 293
513 3300046694 Ga0495649_0016847 Ga0495649_0016847_3075_3956 293
514 3300046694 Ga0495649_0019189 Ga0495649_0019189_2947_3828 293
515 3300046694 Ga0495649_0034608 Ga0495649_0034608_1183_2070 293
516 3300046694 Ga0495649_0040005 Ga0495649_0040005_1162_2049 293
517 3300046694 Ga0495649_0120206 Ga0495649_0120206_475_1356 293
518 3300046694 Ga0495649_0125807 Ga0495649_0125807_208_1089 293
519 3300046794 Ga0495589_0001071 Ga0495589_0001071_7747_8628 293
520 3300046794 Ga0495589_0005108 Ga0495589_0005108_2192_3073 293
521 3300046794 Ga0495589_0015678 Ga0495589_0015678_1714_2601 293
522 3300046794 Ga0495589_0019700 Ga0495589_0019700_1225_2106 293
523 3300046794 Ga0495589_0023436 Ga0495589_0023436_321_1208 293
524 3300046794 Ga0495589_0035606 Ga0495589_0035606_49_936 293
525 3300046794 Ga0495589_0046316 Ga0495589_0046316_142_1029 293
526 3300046794 Ga0495589_0104644 Ga0495589_0104644_212_1093 293
527 3300046809 Ga0495600_0030641 Ga0495600_0030641_894_1781 293
528 3300046809 Ga0495600_0199125 Ga0495600_0199125_38_946 293
529 3300046810 Ga0495660_0020387 Ga0495660_0020387_374_1255 293
530 3300046810 Ga0495660_0022072 Ga0495660_0022072_2701_3582 293
531 3300046810 Ga0495660_0022765 Ga0495660_0022765_1234_2115 293
532 3300046810 Ga0495660_0024307 Ga0495660_0024307_2019_2900 293
533 3300046810 Ga0495660_0057281 Ga0495660_0057281_1029_1910 293
534 3300046810 Ga0495660_0076203 Ga0495660_0076203_651_1538 293
535 3300046810 Ga0495660_0079644 Ga0495660_0079644_393_1280 293
536 3300046810 Ga0495660_0080894 Ga0495660_0080894_261_1142 293
537 3300046810 Ga0495660_0101322 Ga0495660_0101322_388_1275 293
538 3300047315 Ga0495581_0011688 Ga0495581_0011688_3134_4021 293
539 3300047315 Ga0495581_0056979 Ga0495581_0056979_1243_2151 293
540 3300047317 Ga0495604_0042298 Ga0495604_0042298_1509_2417 293
541 3300047317 Ga0495604_0100637 Ga0495604_0100637_1109_1996 293
542 3300047317 Ga0495604_0187461 Ga0495604_0187461_519_1406 293
543 3300047318 Ga0495636_0001781 Ga0495636_0001781_6291_7172 293
544 3300047319 Ga0495674_0000139 Ga0495674_0000139_1500_2387 293
545 3300047320 Ga0495672_0000948 Ga0495672_0000948_24836_25717 293
546 3300047320 Ga0495672_0001337 Ga0495672_0001337_20901_21788 293
547 3300047320 Ga0495672_0009226 Ga0495672_0009226_6151_7038 293
548 3300047320 Ga0495672_0012214 Ga0495672_0012214_2096_2977 293
549 3300047320 Ga0495672_0023731 Ga0495672_0023731_352_1233 293
550 3300047320 Ga0495672_0045981 Ga0495672_0045981_446_1333 293
551 3300047320 Ga0495672_0051015 Ga0495672_0051015_861_1742 293
552 3300047320 Ga0495672_0130816 Ga0495672_0130816_352_1239 293
553 3300047320 Ga0495672_0142480 Ga0495672_0142480_224_1111 293
554 3300047322 Ga0495680_0003577 Ga0495680_0003577_7680_8588 293
555 3300047322 Ga0495680_0041390 Ga0495680_0041390_1170_2078 293
556 3300047322 Ga0495680_0061338 Ga0495680_0061338_1064_1951 293
557 3300047322 Ga0495680_0135675 Ga0495680_0135675_228_1115 293
558 3300047323 Ga0495683_0000231 Ga0495683_0000231_43753_44640 293
559 3300047323 Ga0495683_0000564 Ga0495683_0000564_8320_9201 293
560 3300047323 Ga0495683_0012517 Ga0495683_0012517_1572_2459 293
561 3300047323 Ga0495683_0019057 Ga0495683_0019057_1404_2291 293
562 3300047323 Ga0495683_0070630 Ga0495683_0070630_469_1356 293
563 3300047443 Ga0495687_002031 Ga0495687_002031_6976_7857 293
564 3300047443 Ga0495687_002866 Ga0495687_002866_5813_6700 293
565 3300047443 Ga0495687_005355 Ga0495687_005355_6953_7834 293
566 3300047443 Ga0495687_006475 Ga0495687_006475_2908_3795 293
567 3300047444 Ga0495675_0029549 Ga0495675_0029549_763_1650 293
568 3300047444 Ga0495675_0035151 Ga0495675_0035151_2108_3016 293
569 3300047445 Ga0495677_0084578 Ga0495677_0084578_59_946 293
570 3300047446 Ga0495679_008487 Ga0495679_008487_561_1442 293
571 3300047469 Ga0495673_0000845 Ga0495673_0000845_24123_25004 293
572 3300047469 Ga0495673_0000966 Ga0495673_0000966_23553_24440 293
573 3300047469 Ga0495673_0002887 Ga0495673_0002887_8100_8981 293
574 3300047469 Ga0495673_0004283 Ga0495673_0004283_7371_8252 293
575 3300047469 Ga0495673_0007147 Ga0495673_0007147_4579_5466 293
576 3300047469 Ga0495673_0011266 Ga0495673_0011266_1250_2131 293
577 3300047469 Ga0495673_0012063 Ga0495673_0012063_1034_1921 293
578 3300047469 Ga0495673_0058828 Ga0495673_0058828_510_1418 293
579 3300047469 Ga0495673_0067790 Ga0495673_0067790_435_1322 293
580 3300047469 Ga0495673_0114662 Ga0495673_0114662_140_1021 293
581 3300047470 Ga0495681_0000031 Ga0495681_0000031_38983_39870 293
582 3300047470 Ga0495681_0009517 Ga0495681_0009517_3199_4080 293
583 3300047470 Ga0495681_0013850 Ga0495681_0013850_1108_1995 293
584 3300047470 Ga0495681_0016607 Ga0495681_0016607_2896_3783 293
585 3300047470 Ga0495681_0018420 Ga0495681_0018420_1963_2850 293
586 3300047470 Ga0495681_0034182 Ga0495681_0034182_963_1844 293
587 3300047470 Ga0495681_0036301 Ga0495681_0036301_1413_2294 293
588 3300047470 Ga0495681_0036336 Ga0495681_0036336_1293_2174 293
589 3300047470 Ga0495681_0037932 Ga0495681_0037932_555_1442 293
590 3300047470 Ga0495681_0044263 Ga0495681_0044263_778_1659 293
591 3300047471 Ga0495684_0017511 Ga0495684_0017511_1790_2677 293
592 3300047472 Ga0495686_0005597 Ga0495686_0005597_6120_7001 293
593 3300047472 Ga0495686_0010890 Ga0495686_0010890_2859_3740 293
594 3300047472 Ga0495686_0083745 Ga0495686_0083745_907_1794 293
595 3300047673 Ga0495593_0016129 Ga0495593_0016129_1904_2791 293
596 3300047673 Ga0495593_0022706 Ga0495593_0022706_1207_2094 293
597 3300047673 Ga0495593_0079928 Ga0495593_0079928_230_1138 293
598 3300048091 Ga0495626_0000247 Ga0495626_0000247_38707_39588 293
599 3300048091 Ga0495626_0000451 Ga0495626_0000451_33025_33912 293
600 3300048091 Ga0495626_0001178 Ga0495626_0001178_12431_13318 293
601 3300048091 Ga0495626_0001217 Ga0495626_0001217_4513_5394 293
602 3300048091 Ga0495626_0001296 Ga0495626_0001296_9191_10072 293
603 3300048091 Ga0495626_0010470 Ga0495626_0010470_1399_2286 293
604 3300048905 Ga0496102_0000475 Ga0496102_0000475_22812_23699 293
605 3300048906 Ga0496103_0001816 Ga0496103_0001816_6514_7401 293
606 3300048908 Ga0496105_0155945 Ga0496105_0155945_403_1290 293
607 3300048909 Ga0496106_0105711 Ga0496106_0105711_35_922 293
608 3300048913 Ga0496110_0027602 Ga0496110_0027602_2511_3392 293
609 3300048913 Ga0496110_0285528 Ga0496110_0285528_346_1233 293
610 3300048914 Ga0496111_0043472 Ga0496111_0043472_1777_2658 293
611 3300048915 Ga0496112_0102765 Ga0496112_0102765_997_1878 293
612 3300048918 Ga0496115_0018542 Ga0496115_0018542_3651_4538 293
613 3300048919 Ga0496116_0002071 Ga0496116_0002071_17792_18679 293
614 3300048920 Ga0496117_0012424 Ga0496117_0012424_6100_6987 293
615 3300048920 Ga0496117_0049556 Ga0496117_0049556_520_1407 293
616 3300048921 Ga0496118_0049118 Ga0496118_0049118_856_1737 293
617 3300048921 Ga0496118_0051398 Ga0496118_0051398_786_1673 293
618 3300048924 Ga0496121_0004116 Ga0496121_0004116_10786_11673 293
619 3300048924 Ga0496121_0124421 Ga0496121_0124421_102_983 293
620 3300048925 Ga0496122_0008573 Ga0496122_0008573_3756_4643 293
621 3300048926 Ga0496123_0110728 Ga0496123_0110728_594_1481 293
622 3300048928 Ga0496125_0025773 Ga0496125_0025773_4041_4922 293
623 3300048929 Ga0496126_0229376 Ga0496126_0229376_585_1472 293
624 3300049459 Ga0495678_001629 Ga0495678_001629_13006_13887 293
625 3300049459 Ga0495678_005298 Ga0495678_005298_2783_3670 293
626 3300049459 Ga0495678_010861 Ga0495678_010861_2036_2923 293
627 3300049459 Ga0495678_030058 Ga0495678_030058_932_1813 293
628 3300049460 Ga0495682_0038019 Ga0495682_0038019_375_1262 293
629 3300049460 Ga0495682_0049283 Ga0495682_0049283_134_1015 293
630 3300049460 Ga0495682_0063805 Ga0495682_0063805_115_1002 293
631 3300049662 Ga0501222_000675 Ga0501222_000675_1438_2349 293
632 3300050489 nmdc:mga03683_10350_c1 nmdc:mga03683_10350_c1_274_1155 293
633 3300050516 nmdc:mga0sz30_36361_c1 nmdc:mga0sz30_36361_c1_1097_1984 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

65

313

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cl4-assembly1.cif.gz_A lipc12 - lipase from metagenomics 0.9076 7 293
3w9u-assembly1.cif.gz_A crystal structure of lipk107 0.9054 6 293
3w9u-assembly1.cif.gz_A crystal structure of lipk107 0.9023 6 293
4gxn-assembly1.cif.gz_A diethylphosphonate inhibited structure of the proteus mirabilis lipase 0.8969 6 293
4gw3-assembly1.cif.gz_A crystal structure of the lipase from proteus mirabilis 0.8961 6 293
ID Description Score Start End Superfamily
3w9uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9054 6 293 3.40.50.1820
3w9uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9023 6 293 3.40.50.1820
3qzuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8123 9 108 3.40.50.1820
1qgeD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.809 5 203 3.40.50.1820
1ex9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8006 5 293 3.40.50.1820
ID Description Score Start End GO Terms
AF-Q56594-F1-model_v4 Lipase-related protein 0.9613 5 105 GO:0016020
GO:0016787
AF-A0A4Q5ZER4-F1-model_v4 deleted 0.9416 7 105
AF-A0A0S2SDQ5-F1-model_v4 Lipase 0.9408 2 105
AF-A0A7Y6EB58-F1-model_v4 Triacylglycerol lipase 0.9375 1 293
AF-A0A7U9CND3-F1-model_v4 Acetyltransferase/hydrolase 0.9355 1 293 GO:0016740
GO:0016787

Feature Viewer

pLDDT pTM Quality
80.7 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map