F470251

General Info

Members Datasets Scaffolds Average Seq Length
624 253 1248 178

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100033663|Ga0070661_1000336633
Length 196
Sequence MIELYGRAPYHSVSSITELKSDKIRSMLGKDYEAQDCSLARALEVVGERWTLLILRDAFYGVRRFSDFAAHLDIPRAVLSDRLNGLVEAGLMERKPDPDHAGREVYVLTRSARELWPALHALMRWGSRYRFKAGKPRRFMHAACGTELDEHSACPTCRVVPRADEVVTVAAKKPFRDDPVSAALQAERRLLDPLVL

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 2643221548 Streptomyces sp. Root55 Isolate Unclassified
246 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
247 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
248 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
249 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
250 2862574272 Streptomyces sp. AcE210 Isolate Nodule
251 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
252 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
253 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0.32
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 1.6
Nodule 0.16
Rhizoplane 9.46
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 3.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100033663 3300005344 Bacteria 3712
2 JGI24746J21847_1001470 3300001977 Bacteria 3744
3 JGI24743J22301_10004449 3300001991 Bacteria 2286
4 JGI24749J21850_1014504 3300002076 Bacteria 1105
5 JGI24744J21845_10000035 3300002077 Bacteria 15837
6 JGI24744J21845_10005265 3300002077 Bacteria 2677
7 JGI24742J22300_10000647 3300002244 Bacteria 5247
8 Ga0055540_1000617 3300003792 Bacteria 25319
9 Ga0070658_10013393 3300005327 Bacteria 6580
10 Ga0070658_10068561 3300005327 Bacteria 2900
11 Ga0070676_10321901 3300005328 Bacteria 1055
12 Ga0070683_100153711 3300005329 Bacteria 2182
13 Ga0070683_100178559 3300005329 Bacteria 2015
14 Ga0070683_100227605 3300005329 Bacteria 1772
15 Ga0070683_100346335 3300005329 Bacteria 1415
16 Ga0070690_100022838 3300005330 Bacteria 3831
17 Ga0068869_100026174 3300005334 Bacteria 4059
18 Ga0070680_100093892 3300005336 Bacteria 2486
19 Ga0070680_100489281 3300005336 Bacteria 1052
20 Ga0070682_100012199 3300005337 Bacteria 4921
21 Ga0070682_100017455 3300005337 Bacteria 4185
22 Ga0070682_100053390 3300005337 Bacteria 2532
23 Ga0070682_100132503 3300005337 Bacteria 1689
24 Ga0070682_100264809 3300005337 Bacteria 1246
25 Ga0068868_100000858 3300005338 Bacteria 20639
26 Ga0068868_100030183 3300005338 Bacteria 4156
27 Ga0068868_100038152 3300005338 Bacteria 3728
28 Ga0068868_100053544 3300005338 Bacteria 3179
29 Ga0070660_100076778 3300005339 Bacteria 2617
30 Ga0070660_100092596 3300005339 Bacteria 2386
31 Ga0070660_100406004 3300005339 Bacteria 1127
32 Ga0070689_100075459 3300005340 Bacteria 2640
33 Ga0070689_100411504 3300005340 Bacteria 1145
34 Ga0070691_10001191 3300005341 Bacteria 10897
35 Ga0070691_10192722 3300005341 Bacteria 1067
36 Ga0070691_10267416 3300005341 Bacteria 923
37 Ga0070687_100098288 3300005343 Bacteria 1634
38 Ga0070687_100276531 3300005343 Bacteria 1055
39 Ga0070692_10146108 3300005345 Unclassified 1343
40 Ga0070692_10190687 3300005345 Bacteria 1194
41 Ga0070692_10252738 3300005345 Bacteria 1056
42 Ga0070668_100138370 3300005347 Bacteria 1960
43 Ga0070669_100030979 3300005353 Bacteria 3861
44 Ga0070669_100495524 3300005353 Bacteria 1013
45 Ga0070675_100045721 3300005354 Bacteria 3583
46 Ga0070671_100161148 3300005355 Bacteria 1896
47 Ga0070671_100389301 3300005355 Bacteria 1192
48 Ga0070674_100000228 3300005356 Bacteria 27614
49 Ga0070674_100076961 3300005356 Bacteria 2374
50 Ga0070674_100157932 3300005356 Bacteria 1718
51 Ga0070674_100202516 3300005356 Bacteria 1534
52 Ga0070674_100527256 3300005356 Bacteria 987
53 Ga0070673_100612322 3300005364 Bacteria 994
54 Ga0070688_100013623 3300005365 Bacteria 4591
55 Ga0070688_100114527 3300005365 Bacteria 1798
56 Ga0070688_100470559 3300005365 Bacteria 943
57 Ga0070659_100006932 3300005366 Bacteria 8203
58 Ga0070659_100115400 3300005366 Bacteria 2170
59 Ga0070659_100118059 3300005366 Bacteria 2146
60 Ga0070667_100662842 3300005367 Bacteria 964
61 Ga0070709_10007782 3300005434 Bacteria 5884
62 Ga0070709_10027347 3300005434 Bacteria 3391
63 Ga0070714_100000719 3300005435 Bacteria 23487
64 Ga0070714_100194533 3300005435 Bacteria 1852
65 Ga0070714_100327117 3300005435 Bacteria 1435
66 Ga0070714_100615610 3300005435 Bacteria 1044
67 Ga0070713_100154349 3300005436 Bacteria 2045
68 Ga0070713_100194710 3300005436 Bacteria 1828
69 Ga0070713_100232717 3300005436 Bacteria 1675
70 Ga0070713_100322538 3300005436 Bacteria 1427
71 Ga0070710_10013262 3300005437 Bacteria 4122
72 Ga0070710_10014602 3300005437 Bacteria 3957
73 Ga0070710_10156037 3300005437 Unclassified 1411
74 Ga0070710_10286346 3300005437 Bacteria 1071
75 Ga0070701_10000633 3300005438 Bacteria 12334
76 Ga0070701_10034091 3300005438 Bacteria 2548
77 Ga0070701_10036513 3300005438 Bacteria 2476
78 Ga0070701_10102440 3300005438 Bacteria 1588
79 Ga0070711_100000347 3300005439 Bacteria 23841
80 Ga0070711_100001248 3300005439 Bacteria 13770
81 Ga0070711_100075765 3300005439 Bacteria 2383
82 Ga0070705_100006932 3300005440 Bacteria 5567
83 Ga0070705_100724302 3300005440 Bacteria 784
84 Ga0070700_100002728 3300005441 Bacteria 9026
85 Ga0070700_100180175 3300005441 Bacteria 1470
86 Ga0070694_100031517 3300005444 Bacteria 3476
87 Ga0070694_100051258 3300005444 Bacteria 2785
88 Ga0070708_101527904 3300005445 Bacteria 622
89 Ga0070663_100020071 3300005455 Bacteria 4418
90 Ga0070663_100052934 3300005455 Bacteria 2897
91 Ga0070678_100000601 3300005456 Bacteria 17728
92 Ga0070678_100010028 3300005456 Bacteria 5765
93 Ga0070662_100039437 3300005457 Bacteria 3359
94 Ga0070662_100183010 3300005457 Bacteria 1653
95 Ga0070662_100230323 3300005457 Bacteria 1482
96 Ga0070681_10646237 3300005458 Bacteria 973
97 Ga0068867_100044051 3300005459 Bacteria 3268
98 Ga0070685_10025410 3300005466 Bacteria 3261
99 Ga0070679_100156665 3300005530 Bacteria 2252
100 Ga0070679_100391831 3300005530 Unclassified 1335
101 Ga0070679_100443437 3300005530 Bacteria 1243
102 Ga0070684_100007399 3300005535 Bacteria 8535
103 Ga0070684_100281477 3300005535 Bacteria 1524
104 Ga0070684_100902877 3300005535 Bacteria 828
105 Ga0070672_101186647 3300005543 Bacteria 680
106 Ga0070695_100167157 3300005545 Bacteria 1549
107 Ga0070695_100367942 3300005545 Bacteria 1081
108 Ga0070696_100022450 3300005546 Bacteria 4287
109 Ga0070696_100126847 3300005546 Bacteria 1852
110 Ga0070693_100014909 3300005547 Bacteria 3995
111 Ga0070693_100028369 3300005547 Bacteria 3043
112 Ga0070693_100201080 3300005547 Bacteria 1294
113 Ga0070665_100057859 3300005548 Bacteria 3887
114 Ga0070665_100060638 3300005548 Bacteria 3792
115 Ga0070665_100067467 3300005548 Bacteria 3587
116 Ga0070665_100280865 3300005548 Bacteria 1667
117 Ga0070704_100052299 3300005549 Bacteria 2881
118 Ga0070704_100104209 3300005549 Bacteria 2144
119 Ga0068855_100029554 3300005563 Bacteria 6551
120 Ga0068855_100092474 3300005563 Bacteria 3488
121 Ga0068855_100187480 3300005563 Bacteria 2335
122 Ga0070664_100027755 3300005564 Bacteria 4706
123 Ga0070664_100291559 3300005564 Bacteria 1473
124 Ga0070664_100376275 3300005564 Bacteria 1295
125 Ga0068857_100906262 3300005577 Bacteria 846
126 Ga0068857_101027516 3300005577 Bacteria 794
127 Ga0068854_100002688 3300005578 Bacteria 11023
128 Ga0068856_100208432 3300005614 Bacteria 1969
129 Ga0068856_100300230 3300005614 Bacteria 1623
130 Ga0068856_100690562 3300005614 Unclassified 1041
131 Ga0070702_100001387 3300005615 Bacteria 9901
132 Ga0070702_100055822 3300005615 Bacteria 2279
133 Ga0070702_100326280 3300005615 Bacteria 1072
134 Ga0068852_100005307 3300005616 Bacteria 9199
135 Ga0068852_100022028 3300005616 Bacteria 5100
136 Ga0068852_100042598 3300005616 Bacteria 3843
137 Ga0068852_100780243 3300005616 Bacteria 969
138 Ga0068859_100010816 3300005617 Bacteria 9185
139 Ga0068859_100045535 3300005617 Bacteria 4407
140 Ga0068859_100057712 3300005617 Bacteria 3910
141 Ga0068864_100072420 3300005618 Bacteria 3003
142 Ga0068864_100188914 3300005618 Bacteria 1887
143 Ga0068866_10000214 3300005718 Bacteria 27363
144 Ga0068866_10036270 3300005718 Bacteria 2414
145 Ga0068866_10439149 3300005718 Bacteria 851
146 Ga0068861_100003065 3300005719 Bacteria 11036
147 Ga0068861_100031753 3300005719 Bacteria 3882
148 Ga0068861_100046012 3300005719 Bacteria 3289
149 Ga0068861_100458577 3300005719 Bacteria 1144
150 Ga0068851_10451835 3300005834 Bacteria 764
151 Ga0068870_10086954 3300005840 Bacteria 1740
152 Ga0068870_10208501 3300005840 Bacteria 1189
153 Ga0068870_10301115 3300005840 Bacteria 1012
154 Ga0068863_100166519 3300005841 Bacteria 2113
155 Ga0068863_100707018 3300005841 Bacteria 1002
156 Ga0068863_100742448 3300005841 Bacteria 977
157 Ga0068858_100031101 3300005842 Bacteria 4957
158 Ga0068858_100032545 3300005842 Bacteria 4841
159 Ga0068860_100028462 3300005843 Bacteria 5378
160 Ga0068860_100048471 3300005843 Bacteria 4049
161 Ga0068862_100009360 3300005844 Bacteria 8103
162 Ga0068862_100115313 3300005844 Bacteria 2362
163 Ga0081455_10012912 3300005937 Bacteria 8286
164 Ga0081455_10051591 3300005937 Bacteria 3527
165 Ga0081540_1010737 3300005983 Bacteria 6168
166 Ga0070717_10090392 3300006028 Bacteria 2583
167 Ga0070717_10109897 3300006028 Bacteria 2350
168 Ga0075363_100107086 3300006048 Bacteria 1551
169 Ga0070716_100003612 3300006173 Bacteria 7310
170 Ga0070716_100015068 3300006173 Bacteria 3968
171 Ga0070712_100001274 3300006175 Bacteria 15214
172 Ga0070712_100002173 3300006175 Bacteria 12062
173 Ga0070712_100103774 3300006175 Bacteria 2108
174 Ga0070712_100189275 3300006175 Bacteria 1609
175 Ga0075367_10087231 3300006178 Bacteria 1895
176 Ga0097621_100039060 3300006237 Bacteria 3811
177 Ga0097621_100245070 3300006237 Bacteria 1568
178 Ga0097621_100500243 3300006237 Bacteria 1101
179 Ga0075370_10058562 3300006353 Bacteria 2191
180 Ga0075370_10082545 3300006353 Bacteria 1849
181 Ga0068871_100080849 3300006358 Bacteria 2691
182 Ga0068871_100102168 3300006358 Bacteria 2403
183 Ga0075433_10809347 3300006852 Bacteria 818
184 Ga0075434_100188385 3300006871 Bacteria 2083
185 Ga0075434_101732246 3300006871 Bacteria 632
186 Ga0068865_100002687 3300006881 Bacteria 10547
187 Ga0068865_100063487 3300006881 Bacteria 2596
188 Ga0068865_101141431 3300006881 Bacteria 688
189 Ga0097620_100010816 3300006931 Bacteria 9185
190 Ga0097620_100045535 3300006931 Bacteria 4407
191 Ga0097620_100057713 3300006931 Bacteria 3910
192 Ga0105250_10260703 3300009092 Bacteria 742
193 Ga0111539_10188844 3300009094 Bacteria 2405
194 Ga0111539_11482005 3300009094 Bacteria 787
195 Ga0105245_10001888 3300009098 Bacteria 19021
196 Ga0105245_10029449 3300009098 Bacteria 4851
197 Ga0105245_10041436 3300009098 Bacteria 4105
198 Ga0105245_10103121 3300009098 Bacteria 2642
199 Ga0105245_10151263 3300009098 Bacteria 2195
200 Ga0105245_10252200 3300009098 Bacteria 1715
201 Ga0105245_10377556 3300009098 Bacteria 1411
202 Ga0105245_10569414 3300009098 Bacteria 1156
203 Ga0105247_10001265 3300009101 Bacteria 18737
204 Ga0105247_10008178 3300009101 Bacteria 6388
205 Ga0105247_10061125 3300009101 Bacteria 2335
206 Ga0105247_10095548 3300009101 Bacteria 1893
207 Ga0105243_10001270 3300009148 Bacteria 22670
208 Ga0105243_10028523 3300009148 Bacteria 4286
209 Ga0105243_10211667 3300009148 Bacteria 1707
210 Ga0105243_10977582 3300009148 Bacteria 847
211 Ga0105241_10022189 3300009174 Bacteria 4700
212 Ga0105241_10754170 3300009174 Bacteria 893
213 Ga0105242_10002230 3300009176 Bacteria 15288
214 Ga0105242_10025068 3300009176 Bacteria 4714
215 Ga0105242_10066214 3300009176 Bacteria 2983
216 Ga0105242_11799256 3300009176 Bacteria 651
217 Ga0105248_10208697 3300009177 Bacteria 2201
218 Ga0105248_10229500 3300009177 Bacteria 2090
219 Ga0105248_10746944 3300009177 Bacteria 1104
220 Ga0105248_10791733 3300009177 Bacteria 1070
221 Ga0105237_10026962 3300009545 Bacteria 5869
222 Ga0105237_10067883 3300009545 Bacteria 3559
223 Ga0105237_10462676 3300009545 Bacteria 1274
224 Ga0105237_10609242 3300009545 Unclassified 1099
225 Ga0105238_10295710 3300009551 Bacteria 1602
226 Ga0105238_11146883 3300009551 Unclassified 801
227 Ga0105249_10003282 3300009553 Bacteria 14021
228 Ga0105249_10035137 3300009553 Bacteria 4544
229 Ga0105249_10243372 3300009553 Bacteria 1779
230 Ga0105249_10461299 3300009553 Bacteria 1310
231 Ga0105249_10756528 3300009553 Bacteria 1034
232 Ga0105239_10027440 3300010375 Bacteria 6269
233 Ga0105239_10044928 3300010375 Bacteria 4842
234 Ga0105239_10056496 3300010375 Bacteria 4305
235 Ga0105239_10256394 3300010375 Bacteria 1965
236 Ga0105246_10032210 3300011119 Bacteria 3475
237 Ga0105246_10069854 3300011119 Bacteria 2468
238 Ga0105246_10278447 3300011119 Bacteria 1341
239 Ga0105246_10726112 3300011119 Bacteria 873
240 Ga0157371_10056096 3300013102 Bacteria 2794
241 Ga0157371_10269379 3300013102 Bacteria 1229
242 Ga0157371_10663210 3300013102 Bacteria 779
243 Ga0157370_10008967 3300013104 Bacteria 10740
244 Ga0157370_10076313 3300013104 Bacteria 3157
245 Ga0157369_10011850 3300013105 Bacteria 9904
246 Ga0157369_10152707 3300013105 Bacteria 2441
247 Ga0157369_10219419 3300013105 Bacteria 1991
248 Ga0157369_10481420 3300013105 Bacteria 1285
249 Ga0157369_10665684 3300013105 Bacteria 1073
250 Ga0157374_10095805 3300013296 Bacteria 2838
251 Ga0157374_10207447 3300013296 Bacteria 1921
252 Ga0157374_10220889 3300013296 Bacteria 1859
253 Ga0157374_10274500 3300013296 Bacteria 1663
254 Ga0157374_10515610 3300013296 Bacteria 1201
255 Ga0157378_10001139 3300013297 Bacteria 24164
256 Ga0163162_10012642 3300013306 Bacteria 8242
257 Ga0163162_10014957 3300013306 Bacteria 7578
258 Ga0163162_10023842 3300013306 Bacteria 6039
259 Ga0163162_10059122 3300013306 Bacteria 3864
260 Ga0163162_10219696 3300013306 Bacteria 2030
261 Ga0163162_10229400 3300013306 Bacteria 1987
262 Ga0157372_10001931 3300013307 Bacteria 22495
263 Ga0157372_10097093 3300013307 Bacteria 3359
264 Ga0157372_10341396 3300013307 Bacteria 1744
265 Ga0157372_10355219 3300013307 Bacteria 1708
266 Ga0157372_10394358 3300013307 Bacteria 1613
267 Ga0157372_11389020 3300013307 Bacteria 810
268 Ga0157375_10000802 3300013308 Bacteria 27587
269 Ga0157375_10028496 3300013308 Bacteria 5235
270 Ga0163163_10255738 3300014325 Bacteria 1802
271 Ga0157380_10002537 3300014326 Bacteria 12327
272 Ga0157380_10043897 3300014326 Bacteria 3501
273 Ga0157380_10175472 3300014326 Bacteria 1877
274 Ga0157380_10406135 3300014326 Bacteria 1294
275 Ga0182008_10013175 3300014497 Bacteria 4348
276 Ga0157377_10015520 3300014745 Bacteria 3899
277 Ga0157377_10083604 3300014745 Bacteria 1871
278 Ga0157377_10669607 3300014745 Bacteria 749
279 Ga0157379_10014601 3300014968 Bacteria 6889
280 Ga0157379_10045803 3300014968 Bacteria 3904
281 Ga0157379_10114929 3300014968 Bacteria 2419
282 Ga0157376_10055038 3300014969 Bacteria 3319
283 Ga0157376_10130159 3300014969 Bacteria 2244
284 Ga0157376_10203864 3300014969 Bacteria 1822
285 Ga0182006_1010312 3300015261 Bacteria 4158
286 Ga0182007_10004614 3300015262 Bacteria 6226
287 Ga0163161_10000706 3300017792 Bacteria 26557
288 Ga0163161_10058236 3300017792 Bacteria 2808
289 Ga0163161_10078640 3300017792 Bacteria 2424
290 Ga0163161_10264822 3300017792 Bacteria 1343
291 Ga0163161_10423355 3300017792 Bacteria 1072
292 Ga0206354_11716280 3300020081 Bacteria 907
293 Ga0206353_11263128 3300020082 Bacteria 5258
294 Ga0213876_10045656 3300021384 Bacteria 2316
295 Ga0213875_10000468 3300021388 Bacteria 34648
296 Ga0213875_10043350 3300021388 Bacteria 2113
297 Ga0213875_10133016 3300021388 Bacteria 1163
298 Ga0209051_1000049 3300025303 Bacteria 287483
299 Ga0207692_10002631 3300025898 Bacteria 6906
300 Ga0207692_10005768 3300025898 Bacteria 4984
301 Ga0207692_10125860 3300025898 Bacteria 1441
302 Ga0207692_10268802 3300025898 Bacteria 1028
303 Ga0207692_10716116 3300025898 Bacteria 650
304 Ga0207642_10000561 3300025899 Bacteria 11408
305 Ga0207642_10013846 3300025899 Bacteria 2956
306 Ga0207642_10045545 3300025899 Bacteria 1948
307 Ga0207642_10492903 3300025899 Bacteria 749
308 Ga0207710_10020451 3300025900 Bacteria 2830
309 Ga0207710_10087510 3300025900 Bacteria 1453
310 Ga0207710_10100495 3300025900 Bacteria 1364
311 Ga0207688_10000043 3300025901 Bacteria 43682
312 Ga0207688_10028092 3300025901 Bacteria 3096
313 Ga0207688_10038240 3300025901 Bacteria 2662
314 Ga0207688_10138014 3300025901 Bacteria 1433
315 Ga0207680_10159963 3300025903 Bacteria 1509
316 Ga0207647_10073559 3300025904 Bacteria 2059
317 Ga0207647_10213903 3300025904 Bacteria 1112
318 Ga0207699_10070103 3300025906 Bacteria 2140
319 Ga0207699_10201977 3300025906 Bacteria 1347
320 Ga0207699_10332600 3300025906 Bacteria 1068
321 Ga0207645_10032281 3300025907 Bacteria 3366
322 Ga0207645_10343988 3300025907 Bacteria 997
323 Ga0207643_10111163 3300025908 Unclassified 1614
324 Ga0207705_10097322 3300025909 Bacteria 2161
325 Ga0207705_10978361 3300025909 Unclassified 654
326 Ga0207654_10046008 3300025911 Bacteria 2487
327 Ga0207654_10084835 3300025911 Bacteria 1916
328 Ga0207707_10014390 3300025912 Bacteria 6891
329 Ga0207707_10484440 3300025912 Bacteria 1056
330 Ga0207695_10958819 3300025913 Bacteria 735
331 Ga0207671_10017430 3300025914 Bacteria 5536
332 Ga0207671_10066702 3300025914 Bacteria 2679
333 Ga0207671_10156338 3300025914 Bacteria 1764
334 Ga0207671_10301874 3300025914 Unclassified 1265
335 Ga0207671_10680674 3300025914 Bacteria 818
336 Ga0207693_10001369 3300025915 Bacteria 21586
337 Ga0207693_10009335 3300025915 Bacteria 7998
338 Ga0207693_10011529 3300025915 Bacteria 7148
339 Ga0207663_10012892 3300025916 Bacteria 4532
340 Ga0207663_10014504 3300025916 Bacteria 4316
341 Ga0207663_10024946 3300025916 Bacteria 3449
342 Ga0207660_10007097 3300025917 Bacteria 7255
343 Ga0207660_10072324 3300025917 Bacteria 2511
344 Ga0207660_10701408 3300025917 Bacteria 826
345 Ga0207662_10286840 3300025918 Bacteria 1091
346 Ga0207657_10035527 3300025919 Bacteria 4468
347 Ga0207657_10077726 3300025919 Bacteria 2796
348 Ga0207657_10241175 3300025919 Bacteria 1443
349 Ga0207649_10284610 3300025920 Unclassified 1203
350 Ga0207652_10277721 3300025921 Bacteria 1511
351 Ga0207652_10464425 3300025921 Unclassified 1141
352 Ga0207681_10089974 3300025923 Bacteria 2190
353 Ga0207681_10268322 3300025923 Bacteria 1339
354 Ga0207694_10122473 3300025924 Bacteria 2077
355 Ga0207694_10218449 3300025924 Bacteria 1554
356 Ga0207694_10720231 3300025924 Bacteria 842
357 Ga0207687_10000710 3300025927 Bacteria 22564
358 Ga0207687_10027626 3300025927 Bacteria 3809
359 Ga0207687_10221017 3300025927 Bacteria 1492
360 Ga0207687_10438924 3300025927 Bacteria 1081
361 Ga0207687_10523850 3300025927 Bacteria 992
362 Ga0207700_10234119 3300025928 Bacteria 1563
363 Ga0207700_10280539 3300025928 Bacteria 1433
364 Ga0207700_10339250 3300025928 Bacteria 1306
365 Ga0207700_10730358 3300025928 Bacteria 885
366 Ga0207664_10166294 3300025929 Bacteria 1885
367 Ga0207644_10101033 3300025931 Bacteria 2167
368 Ga0207644_10113761 3300025931 Bacteria 2050
369 Ga0207644_10341681 3300025931 Bacteria 1214
370 Ga0207690_10013507 3300025932 Bacteria 4908
371 Ga0207690_10040105 3300025932 Bacteria 3059
372 Ga0207690_10040474 3300025932 Bacteria 3047
373 Ga0207690_10793606 3300025932 Bacteria 782
374 Ga0207706_10009643 3300025933 Bacteria 8863
375 Ga0207706_10010740 3300025933 Bacteria 8362
376 Ga0207706_10328217 3300025933 Bacteria 1331
377 Ga0207686_10008219 3300025934 Bacteria 5631
378 Ga0207686_10069704 3300025934 Bacteria 2257
379 Ga0207709_10003353 3300025935 Bacteria 9571
380 Ga0207709_10018129 3300025935 Bacteria 3938
381 Ga0207709_10105213 3300025935 Bacteria 1875
382 Ga0207709_10127673 3300025935 Bacteria 1728
383 Ga0207709_10128354 3300025935 Bacteria 1724
384 Ga0207670_10017134 3300025936 Bacteria 4373
385 Ga0207670_10790375 3300025936 Bacteria 790
386 Ga0207669_10002300 3300025937 Bacteria 8125
387 Ga0207669_10112025 3300025937 Bacteria 1831
388 Ga0207669_10139511 3300025937 Bacteria 1680
389 Ga0207669_10188459 3300025937 Bacteria 1486
390 Ga0207669_10274913 3300025937 Bacteria 1267
391 Ga0207704_10000980 3300025938 Bacteria 12659
392 Ga0207704_10013381 3300025938 Bacteria 4103
393 Ga0207704_10051056 3300025938 Bacteria 2498
394 Ga0207665_10004071 3300025939 Bacteria 9766
395 Ga0207665_10008886 3300025939 Bacteria 6597
396 Ga0207665_10084704 3300025939 Bacteria 2188
397 Ga0207691_10089917 3300025940 Bacteria 2753
398 Ga0207691_10322067 3300025940 Bacteria 1325
399 Ga0207691_10323303 3300025940 Bacteria 1322
400 Ga0207711_10021042 3300025941 Bacteria 5448
401 Ga0207711_10515358 3300025941 Bacteria 1115
402 Ga0207689_10027165 3300025942 Bacteria 4792
403 Ga0207689_10034299 3300025942 Bacteria 4216
404 Ga0207661_10002148 3300025944 Bacteria 13576
405 Ga0207661_10105075 3300025944 Bacteria 2379
406 Ga0207661_10200928 3300025944 Bacteria 1752
407 Ga0207661_10265244 3300025944 Bacteria 1531
408 Ga0207661_10928293 3300025944 Bacteria 802
409 Ga0207679_10018283 3300025945 Bacteria 4693
410 Ga0207679_10181307 3300025945 Bacteria 1742
411 Ga0207679_10283400 3300025945 Bacteria 1422
412 Ga0207667_10022575 3300025949 Bacteria 6947
413 Ga0207667_10597107 3300025949 Bacteria 1113
414 Ga0207712_10005096 3300025961 Bacteria 8310
415 Ga0207712_10028054 3300025961 Bacteria 3764
416 Ga0207712_10048730 3300025961 Bacteria 2948
417 Ga0207712_10686507 3300025961 Bacteria 893
418 Ga0207668_10017304 3300025972 Bacteria 4513
419 Ga0207668_10293692 3300025972 Bacteria 1338
420 Ga0207668_10453064 3300025972 Bacteria 1095
421 Ga0207640_10003250 3300025981 Bacteria 8755
422 Ga0207640_10069441 3300025981 Bacteria 2366
423 Ga0207640_10455978 3300025981 Bacteria 1055
424 Ga0207658_10437469 3300025986 Bacteria 1156
425 Ga0207677_10002521 3300026023 Bacteria 9600
426 Ga0207677_10050261 3300026023 Bacteria 2819
427 Ga0207677_10207141 3300026023 Bacteria 1563
428 Ga0207677_10571606 3300026023 Bacteria 988
429 Ga0207703_10010659 3300026035 Bacteria 7179
430 Ga0207703_10025839 3300026035 Bacteria 4621
431 Ga0207703_10127638 3300026035 Bacteria 2192
432 Ga0207703_10254769 3300026035 Bacteria 1584
433 Ga0207639_10113641 3300026041 Bacteria 2211
434 Ga0207639_10429361 3300026041 Unclassified 1196
435 Ga0207639_11077686 3300026041 Bacteria 753
436 Ga0207678_10006580 3300026067 Bacteria 10303
437 Ga0207678_10058296 3300026067 Bacteria 3322
438 Ga0207678_10088897 3300026067 Unclassified 2640
439 Ga0207678_10190499 3300026067 Bacteria 1752
440 Ga0207678_10243577 3300026067 Bacteria 1540
441 Ga0207678_10247150 3300026067 Bacteria 1528
442 Ga0207708_10007612 3300026075 Bacteria 8018
443 Ga0207708_10056749 3300026075 Bacteria 2987
444 Ga0207708_10181616 3300026075 Bacteria 1671
445 Ga0207708_10440321 3300026075 Bacteria 1084
446 Ga0207702_10122708 3300026078 Bacteria 2327
447 Ga0207702_10303958 3300026078 Bacteria 1515
448 Ga0207702_11021987 3300026078 Unclassified 820
449 Ga0207641_10129126 3300026088 Bacteria 2267
450 Ga0207641_10563307 3300026088 Bacteria 1112
451 Ga0207648_10004029 3300026089 Bacteria 15253
452 Ga0207648_10038189 3300026089 Bacteria 4226
453 Ga0207648_10086901 3300026089 Bacteria 2728
454 Ga0207648_10519703 3300026089 Bacteria 1091
455 Ga0207676_10017382 3300026095 Bacteria 5211
456 Ga0207676_10071626 3300026095 Bacteria 2784
457 Ga0207676_10151386 3300026095 Bacteria 1998
458 Ga0207674_10023946 3300026116 Bacteria 6530
459 Ga0207674_10966712 3300026116 Bacteria 820
460 Ga0207675_100001279 3300026118 Bacteria 25154
461 Ga0207675_100013039 3300026118 Bacteria 7761
462 Ga0207675_100082409 3300026118 Bacteria 3017
463 Ga0207675_100104897 3300026118 Bacteria 2664
464 Ga0207675_100108474 3300026118 Bacteria 2618
465 Ga0207675_100153700 3300026118 Bacteria 2192
466 Ga0207683_10001760 3300026121 Bacteria 19163
467 Ga0207683_10020176 3300026121 Bacteria 5697
468 Ga0207683_10169999 3300026121 Bacteria 1974
469 Ga0207683_10254983 3300026121 Bacteria 1601
470 Ga0207698_10024568 3300026142 Bacteria 4232
471 Ga0207698_10112529 3300026142 Bacteria 2285
472 Ga0207698_10740327 3300026142 Bacteria 981
473 Ga0207428_10326647 3300027907 Bacteria 1132
474 Ga0268266_10018537 3300028379 Bacteria 5932
475 Ga0268266_10066073 3300028379 Bacteria 3127
476 Ga0268266_10511784 3300028379 Bacteria 1147
477 Ga0268265_10009379 3300028380 Bacteria 6613
478 Ga0268265_10172927 3300028380 Bacteria 1848
479 Ga0268265_10838624 3300028380 Bacteria 898
480 Ga0268264_10012033 3300028381 Bacteria 7124
481 Ga0268264_10077889 3300028381 Bacteria 2825
482 Ga0268264_10103177 3300028381 Bacteria 2483
483 Ga0268264_10368568 3300028381 Bacteria 1372
484 Ga0307509_10571151 3300031507 Bacteria 806
485 Ga0373959_0043716 3300034820 Bacteria 948
486 Ga0373928_0022145 3300035084 Bacteria 1346
487 Ga0373928_0053679 3300035084 Bacteria 958
488 Ga0373940_0151198 3300035088 Bacteria 740
489 Ga0373949_0012518 3300035090 Bacteria 1878
490 Ga0373932_0034126 3300035112 Bacteria 1432
491 Ga0373942_0037548 3300035207 Bacteria 1310
492 Ga0373962_0008709 3300035242 Bacteria 2503
493 Ga0373931_0212258 3300035691 Bacteria 1161
494 Ga0373931_0622240 3300035691 Bacteria 707
495 Ga0436364_0769592 3300037853 Unclassified 810
496 Ga0436364_1031907 3300037853 Bacteria 102112
497 Ga0436364_1157350 3300037853 Bacteria 9824
498 Ga0436364_1524723 3300037853 Bacteria 5884
499 Ga0436365_0389962 3300039437 Bacteria 1135
500 Ga0436365_1061792 3300039437 Bacteria 46945
501 Ga0436365_1655600 3300039437 Bacteria 4758
502 Ga0439461_0012748 3300041410 Bacteria 1578
503 Ga0439465_0107657 3300041413 Unclassified 967
504 Ga0439431_0006992 3300041997 Bacteria 2511
505 Ga0439445_0016946 3300042004 Bacteria 1797
506 Ga0466969_0118826 3300044656 Bacteria 1232
507 Ga0466963_0133067 3300044694 Bacteria 1719
508 Ga0466964_0205475 3300044706 Bacteria 948
509 Ga0466964_0234973 3300044706 Bacteria 896
510 Ga0466971_0043694 3300044719 Bacteria 2013
511 Ga0466968_0144001 3300044735 Bacteria 1092
512 Ga0466970_0375928 3300044765 Bacteria 808
513 Ga0466957_0090731 3300044842 Bacteria 1914
514 Ga0466960_0027955 3300044901 Bacteria 2578
515 Ga0466959_0009255 3300045049 Bacteria 7000
516 Ga0466959_0218191 3300045049 Bacteria 1323
517 Ga0466959_0263175 3300045049 Bacteria 1187
518 Ga0466958_0012823 3300045836 Bacteria 4756
519 Ga0466958_0097078 3300045836 Bacteria 1828
520 Ga0466958_0248142 3300045836 Bacteria 1138
521 Ga0466967_0005164 3300045976 Bacteria 8983
522 Ga0466967_0284223 3300045976 Bacteria 1588
523 Ga0466967_0294108 3300045976 Bacteria 1561
524 Ga0466967_0429247 3300045976 Bacteria 1289
525 Ga0466967_0569926 3300045976 Bacteria 1115
526 Ga0466967_0603636 3300045976 Bacteria 1083
527 Ga0466967_0829713 3300045976 Unclassified 918
528 Ga0495592_0089162 3300046454 Bacteria 2216
529 Ga0495652_0264622 3300046529 Bacteria 1267
530 Ga0495624_0168187 3300046690 Unclassified 1338
531 Ga0495604_0489733 3300047317 Bacteria 799
532 Ga0496100_0001186 3300048903 Bacteria 12682
533 Ga0496100_0006360 3300048903 Bacteria 6436
534 Ga0496100_0272121 3300048903 Bacteria 1260
535 Ga0496100_1235496 3300048903 Bacteria 589
536 Ga0496101_0000082 3300048904 Bacteria 104164
537 Ga0496101_0014884 3300048904 Bacteria 5235
538 Ga0496101_0168380 3300048904 Bacteria 1683
539 Ga0496101_0311017 3300048904 Bacteria 1235
540 Ga0496102_0000135 3300048905 Bacteria 100763
541 Ga0496102_0002203 3300048905 Bacteria 16737
542 Ga0496102_0033490 3300048905 Bacteria 4618
543 Ga0496102_0093889 3300048905 Bacteria 2779
544 Ga0496102_0101573 3300048905 Bacteria 2672
545 Ga0496102_0213035 3300048905 Bacteria 1821
546 Ga0496102_0575770 3300048905 Bacteria 1049
547 Ga0496102_0661091 3300048905 Bacteria 968
548 Ga0496103_0000092 3300048906 Bacteria 100968
549 Ga0496103_0003391 3300048906 Bacteria 9737
550 Ga0496103_0065675 3300048906 Bacteria 2263
551 Ga0496104_0079445 3300048907 Bacteria 3126
552 Ga0496104_0412301 3300048907 Bacteria 1263
553 Ga0496105_0103645 3300048908 Bacteria 2349
554 Ga0496105_0340108 3300048908 Bacteria 1200
555 Ga0496105_0525667 3300048908 Bacteria 926
556 Ga0496106_0007691 3300048909 Bacteria 7970
557 Ga0496106_0013821 3300048909 Bacteria 5965
558 Ga0496106_0134869 3300048909 Bacteria 1938
559 Ga0496106_0364383 3300048909 Bacteria 1161
560 Ga0496107_0002093 3300048910 Bacteria 12783
561 Ga0496107_0033047 3300048910 Bacteria 3700
562 Ga0496107_0062337 3300048910 Bacteria 2701
563 Ga0496107_0298230 3300048910 Bacteria 1199
564 Ga0496108_0000330 3300048911 Bacteria 40103
565 Ga0496108_0013654 3300048911 Bacteria 6631
566 Ga0496108_0083633 3300048911 Bacteria 2707
567 Ga0496108_0163546 3300048911 Bacteria 1924
568 Ga0496108_0771976 3300048911 Unclassified 830
569 Ga0496109_0006552 3300048912 Bacteria 9801
570 Ga0496109_0027073 3300048912 Bacteria 5116
571 Ga0496109_0031787 3300048912 Bacteria 4739
572 Ga0496109_0113143 3300048912 Bacteria 2524
573 Ga0496109_0196414 3300048912 Bacteria 1896
574 Ga0496109_0869955 3300048912 Bacteria 839
575 Ga0496110_0024814 3300048913 Bacteria 5115
576 Ga0496110_0425643 3300048913 Bacteria 1210
577 Ga0496111_0031140 3300048914 Bacteria 3799
578 Ga0496111_0038134 3300048914 Bacteria 3442
579 Ga0496111_0150926 3300048914 Bacteria 1723
580 Ga0496112_0053654 3300048915 Bacteria 3960
581 Ga0496112_0081670 3300048915 Bacteria 3197
582 Ga0496112_0189090 3300048915 Bacteria 2021
583 Ga0496113_0021914 3300048916 Bacteria 4512
584 Ga0496113_0101332 3300048916 Bacteria 2232
585 Ga0496114_0001806 3300048917 Bacteria 16233
586 Ga0496114_0349134 3300048917 Bacteria 1308
587 Ga0496114_0456133 3300048917 Bacteria 1132
588 Ga0496114_0479556 3300048917 Bacteria 1100
589 Ga0496115_0000858 3300048918 Bacteria 22064
590 Ga0496115_0072330 3300048918 Bacteria 2798
591 Ga0496116_0000238 3300048919 Bacteria 100797
592 Ga0496117_0000019 3300048920 Bacteria 469256
593 Ga0496118_0000020 3300048921 Bacteria 470521
594 Ga0496119_0031338 3300048922 Bacteria 3568
595 Ga0496119_0098543 3300048922 Bacteria 1646
596 Ga0496120_0028226 3300048923 Bacteria 3440
597 Ga0496120_0245121 3300048923 Bacteria 844
598 Ga0496121_0000064 3300048924 Bacteria 272488
599 Ga0496126_0000668 3300048929 Bacteria 63397
600 Ga0496126_0009011 3300048929 Bacteria 10674
601 Ga0501047_0048200 3300049581 Bacteria 4114
602 Ga0501047_0129498 3300049581 Bacteria 2404
603 Ga0501047_0668571 3300049581 Bacteria 857
604 Ga0501070_0448743 3300049586 Bacteria 1040
605 nmdc:mga06z11_85887_c1 3300050494 Bacteria 1698
606 nmdc:mga07m45_313550_c1 3300050496 Bacteria 912
607 nmdc:mga07m45_42413_c1 3300050496 Bacteria 2550
608 nmdc:mga08y16_435764_c1 3300050511 Bacteria 1338
609 nmdc:mga0n895_1051443_c1 3300050512 Bacteria 793
610 nmdc:mga0n895_137700_c1 3300050512 Bacteria 2469
611 nmdc:mga08x19_29120_c1 3300050514 Bacteria 3462
612 nmdc:mga0a205_46240_c1 3300050515 Bacteria 4197
613 nmdc:mga0a205_694462_c1 3300050515 Bacteria 867
614 nmdc:mga0sz30_42448_c2 3300050516 Bacteria 864
615 Ga0495612_0100276 3300053078 Bacteria 1233
616 2643765338 2643221548 Bacteria 8053412
617 2644462591 2643221682 Bacteria 6743283
618 2676473164 2675903058 Bacteria 6822861
619 2819693441 2818991463 Bacteria 7948711
620 2827633345 2827628540 Bacteria 6858585
621 2862579736 2862574272 Bacteria 10567477
622 2974318394 2974315732 Bacteria 4602776
623 2984526604 2984523437 Bacteria 4508481
624 8053954029 8053945823 Bacteria 8962862
625 Ga0070661_100033663
626 JGI24746J21847_1001470
627 JGI24743J22301_10004449
628 JGI24749J21850_1014504
629 JGI24744J21845_10000035
630 JGI24744J21845_10005265
631 JGI24742J22300_10000647
632 Ga0055540_1000617
633 Ga0070658_10013393
634 Ga0070658_10068561
635 Ga0070676_10321901
636 Ga0070683_100153711
637 Ga0070683_100178559
638 Ga0070683_100227605
639 Ga0070683_100346335
640 Ga0070690_100022838
641 Ga0068869_100026174
642 Ga0070680_100093892
643 Ga0070680_100489281
644 Ga0070682_100012199
645 Ga0070682_100017455
646 Ga0070682_100053390
647 Ga0070682_100132503
648 Ga0070682_100264809
649 Ga0068868_100000858
650 Ga0068868_100030183
651 Ga0068868_100038152
652 Ga0068868_100053544
653 Ga0070660_100076778
654 Ga0070660_100092596
655 Ga0070660_100406004
656 Ga0070689_100075459
657 Ga0070689_100411504
658 Ga0070691_10001191
659 Ga0070691_10192722
660 Ga0070691_10267416
661 Ga0070687_100098288
662 Ga0070687_100276531
663 Ga0070692_10146108
664 Ga0070692_10190687
665 Ga0070692_10252738
666 Ga0070668_100138370
667 Ga0070669_100030979
668 Ga0070669_100495524
669 Ga0070675_100045721
670 Ga0070671_100161148
671 Ga0070671_100389301
672 Ga0070674_100000228
673 Ga0070674_100076961
674 Ga0070674_100157932
675 Ga0070674_100202516
676 Ga0070674_100527256
677 Ga0070673_100612322
678 Ga0070688_100013623
679 Ga0070688_100114527
680 Ga0070688_100470559
681 Ga0070659_100006932
682 Ga0070659_100115400
683 Ga0070659_100118059
684 Ga0070667_100662842
685 Ga0070709_10007782
686 Ga0070709_10027347
687 Ga0070714_100000719
688 Ga0070714_100194533
689 Ga0070714_100327117
690 Ga0070714_100615610
691 Ga0070713_100154349
692 Ga0070713_100194710
693 Ga0070713_100232717
694 Ga0070713_100322538
695 Ga0070710_10013262
696 Ga0070710_10014602
697 Ga0070710_10156037
698 Ga0070710_10286346
699 Ga0070701_10000633
700 Ga0070701_10034091
701 Ga0070701_10036513
702 Ga0070701_10102440
703 Ga0070711_100000347
704 Ga0070711_100001248
705 Ga0070711_100075765
706 Ga0070705_100006932
707 Ga0070705_100724302
708 Ga0070700_100002728
709 Ga0070700_100180175
710 Ga0070694_100031517
711 Ga0070694_100051258
712 Ga0070708_101527904
713 Ga0070663_100020071
714 Ga0070663_100052934
715 Ga0070678_100000601
716 Ga0070678_100010028
717 Ga0070662_100039437
718 Ga0070662_100183010
719 Ga0070662_100230323
720 Ga0070681_10646237
721 Ga0068867_100044051
722 Ga0070685_10025410
723 Ga0070679_100156665
724 Ga0070679_100391831
725 Ga0070679_100443437
726 Ga0070684_100007399
727 Ga0070684_100281477
728 Ga0070684_100902877
729 Ga0070672_101186647
730 Ga0070695_100167157
731 Ga0070695_100367942
732 Ga0070696_100022450
733 Ga0070696_100126847
734 Ga0070693_100014909
735 Ga0070693_100028369
736 Ga0070693_100201080
737 Ga0070665_100057859
738 Ga0070665_100060638
739 Ga0070665_100067467
740 Ga0070665_100280865
741 Ga0070704_100052299
742 Ga0070704_100104209
743 Ga0068855_100029554
744 Ga0068855_100092474
745 Ga0068855_100187480
746 Ga0070664_100027755
747 Ga0070664_100291559
748 Ga0070664_100376275
749 Ga0068857_100906262
750 Ga0068857_101027516
751 Ga0068854_100002688
752 Ga0068856_100208432
753 Ga0068856_100300230
754 Ga0068856_100690562
755 Ga0070702_100001387
756 Ga0070702_100055822
757 Ga0070702_100326280
758 Ga0068852_100005307
759 Ga0068852_100022028
760 Ga0068852_100042598
761 Ga0068852_100780243
762 Ga0068859_100010816
763 Ga0068859_100045535
764 Ga0068859_100057712
765 Ga0068864_100072420
766 Ga0068864_100188914
767 Ga0068866_10000214
768 Ga0068866_10036270
769 Ga0068866_10439149
770 Ga0068861_100003065
771 Ga0068861_100031753
772 Ga0068861_100046012
773 Ga0068861_100458577
774 Ga0068851_10451835
775 Ga0068870_10086954
776 Ga0068870_10208501
777 Ga0068870_10301115
778 Ga0068863_100166519
779 Ga0068863_100707018
780 Ga0068863_100742448
781 Ga0068858_100031101
782 Ga0068858_100032545
783 Ga0068860_100028462
784 Ga0068860_100048471
785 Ga0068862_100009360
786 Ga0068862_100115313
787 Ga0081455_10012912
788 Ga0081455_10051591
789 Ga0081540_1010737
790 Ga0070717_10090392
791 Ga0070717_10109897
792 Ga0075363_100107086
793 Ga0070716_100003612
794 Ga0070716_100015068
795 Ga0070712_100001274
796 Ga0070712_100002173
797 Ga0070712_100103774
798 Ga0070712_100189275
799 Ga0075367_10087231
800 Ga0097621_100039060
801 Ga0097621_100245070
802 Ga0097621_100500243
803 Ga0075370_10058562
804 Ga0075370_10082545
805 Ga0068871_100080849
806 Ga0068871_100102168
807 Ga0075433_10809347
808 Ga0075434_100188385
809 Ga0075434_101732246
810 Ga0068865_100002687
811 Ga0068865_100063487
812 Ga0068865_101141431
813 Ga0097620_100010816
814 Ga0097620_100045535
815 Ga0097620_100057713
816 Ga0105250_10260703
817 Ga0111539_10188844
818 Ga0111539_11482005
819 Ga0105245_10001888
820 Ga0105245_10029449
821 Ga0105245_10041436
822 Ga0105245_10103121
823 Ga0105245_10151263
824 Ga0105245_10252200
825 Ga0105245_10377556
826 Ga0105245_10569414
827 Ga0105247_10001265
828 Ga0105247_10008178
829 Ga0105247_10061125
830 Ga0105247_10095548
831 Ga0105243_10001270
832 Ga0105243_10028523
833 Ga0105243_10211667
834 Ga0105243_10977582
835 Ga0105241_10022189
836 Ga0105241_10754170
837 Ga0105242_10002230
838 Ga0105242_10025068
839 Ga0105242_10066214
840 Ga0105242_11799256
841 Ga0105248_10208697
842 Ga0105248_10229500
843 Ga0105248_10746944
844 Ga0105248_10791733
845 Ga0105237_10026962
846 Ga0105237_10067883
847 Ga0105237_10462676
848 Ga0105237_10609242
849 Ga0105238_10295710
850 Ga0105238_11146883
851 Ga0105249_10003282
852 Ga0105249_10035137
853 Ga0105249_10243372
854 Ga0105249_10461299
855 Ga0105249_10756528
856 Ga0105239_10027440
857 Ga0105239_10044928
858 Ga0105239_10056496
859 Ga0105239_10256394
860 Ga0105246_10032210
861 Ga0105246_10069854
862 Ga0105246_10278447
863 Ga0105246_10726112
864 Ga0157371_10056096
865 Ga0157371_10269379
866 Ga0157371_10663210
867 Ga0157370_10008967
868 Ga0157370_10076313
869 Ga0157369_10011850
870 Ga0157369_10152707
871 Ga0157369_10219419
872 Ga0157369_10481420
873 Ga0157369_10665684
874 Ga0157374_10095805
875 Ga0157374_10207447
876 Ga0157374_10220889
877 Ga0157374_10274500
878 Ga0157374_10515610
879 Ga0157378_10001139
880 Ga0163162_10012642
881 Ga0163162_10014957
882 Ga0163162_10023842
883 Ga0163162_10059122
884 Ga0163162_10219696
885 Ga0163162_10229400
886 Ga0157372_10001931
887 Ga0157372_10097093
888 Ga0157372_10341396
889 Ga0157372_10355219
890 Ga0157372_10394358
891 Ga0157372_11389020
892 Ga0157375_10000802
893 Ga0157375_10028496
894 Ga0163163_10255738
895 Ga0157380_10002537
896 Ga0157380_10043897
897 Ga0157380_10175472
898 Ga0157380_10406135
899 Ga0182008_10013175
900 Ga0157377_10015520
901 Ga0157377_10083604
902 Ga0157377_10669607
903 Ga0157379_10014601
904 Ga0157379_10045803
905 Ga0157379_10114929
906 Ga0157376_10055038
907 Ga0157376_10130159
908 Ga0157376_10203864
909 Ga0182006_1010312
910 Ga0182007_10004614
911 Ga0163161_10000706
912 Ga0163161_10058236
913 Ga0163161_10078640
914 Ga0163161_10264822
915 Ga0163161_10423355
916 Ga0206354_11716280
917 Ga0206353_11263128
918 Ga0213876_10045656
919 Ga0213875_10000468
920 Ga0213875_10043350
921 Ga0213875_10133016
922 Ga0209051_1000049
923 Ga0207692_10002631
924 Ga0207692_10005768
925 Ga0207692_10125860
926 Ga0207692_10268802
927 Ga0207692_10716116
928 Ga0207642_10000561
929 Ga0207642_10013846
930 Ga0207642_10045545
931 Ga0207642_10492903
932 Ga0207710_10020451
933 Ga0207710_10087510
934 Ga0207710_10100495
935 Ga0207688_10000043
936 Ga0207688_10028092
937 Ga0207688_10038240
938 Ga0207688_10138014
939 Ga0207680_10159963
940 Ga0207647_10073559
941 Ga0207647_10213903
942 Ga0207699_10070103
943 Ga0207699_10201977
944 Ga0207699_10332600
945 Ga0207645_10032281
946 Ga0207645_10343988
947 Ga0207643_10111163
948 Ga0207705_10097322
949 Ga0207705_10978361
950 Ga0207654_10046008
951 Ga0207654_10084835
952 Ga0207707_10014390
953 Ga0207707_10484440
954 Ga0207695_10958819
955 Ga0207671_10017430
956 Ga0207671_10066702
957 Ga0207671_10156338
958 Ga0207671_10301874
959 Ga0207671_10680674
960 Ga0207693_10001369
961 Ga0207693_10009335
962 Ga0207693_10011529
963 Ga0207663_10012892
964 Ga0207663_10014504
965 Ga0207663_10024946
966 Ga0207660_10007097
967 Ga0207660_10072324
968 Ga0207660_10701408
969 Ga0207662_10286840
970 Ga0207657_10035527
971 Ga0207657_10077726
972 Ga0207657_10241175
973 Ga0207649_10284610
974 Ga0207652_10277721
975 Ga0207652_10464425
976 Ga0207681_10089974
977 Ga0207681_10268322
978 Ga0207694_10122473
979 Ga0207694_10218449
980 Ga0207694_10720231
981 Ga0207687_10000710
982 Ga0207687_10027626
983 Ga0207687_10221017
984 Ga0207687_10438924
985 Ga0207687_10523850
986 Ga0207700_10234119
987 Ga0207700_10280539
988 Ga0207700_10339250
989 Ga0207700_10730358
990 Ga0207664_10166294
991 Ga0207644_10101033
992 Ga0207644_10113761
993 Ga0207644_10341681
994 Ga0207690_10013507
995 Ga0207690_10040105
996 Ga0207690_10040474
997 Ga0207690_10793606
998 Ga0207706_10009643
999 Ga0207706_10010740
1000 Ga0207706_10328217
1001 Ga0207686_10008219
1002 Ga0207686_10069704
1003 Ga0207709_10003353
1004 Ga0207709_10018129
1005 Ga0207709_10105213
1006 Ga0207709_10127673
1007 Ga0207709_10128354
1008 Ga0207670_10017134
1009 Ga0207670_10790375
1010 Ga0207669_10002300
1011 Ga0207669_10112025
1012 Ga0207669_10139511
1013 Ga0207669_10188459
1014 Ga0207669_10274913
1015 Ga0207704_10000980
1016 Ga0207704_10013381
1017 Ga0207704_10051056
1018 Ga0207665_10004071
1019 Ga0207665_10008886
1020 Ga0207665_10084704
1021 Ga0207691_10089917
1022 Ga0207691_10322067
1023 Ga0207691_10323303
1024 Ga0207711_10021042
1025 Ga0207711_10515358
1026 Ga0207689_10027165
1027 Ga0207689_10034299
1028 Ga0207661_10002148
1029 Ga0207661_10105075
1030 Ga0207661_10200928
1031 Ga0207661_10265244
1032 Ga0207661_10928293
1033 Ga0207679_10018283
1034 Ga0207679_10181307
1035 Ga0207679_10283400
1036 Ga0207667_10022575
1037 Ga0207667_10597107
1038 Ga0207712_10005096
1039 Ga0207712_10028054
1040 Ga0207712_10048730
1041 Ga0207712_10686507
1042 Ga0207668_10017304
1043 Ga0207668_10293692
1044 Ga0207668_10453064
1045 Ga0207640_10003250
1046 Ga0207640_10069441
1047 Ga0207640_10455978
1048 Ga0207658_10437469
1049 Ga0207677_10002521
1050 Ga0207677_10050261
1051 Ga0207677_10207141
1052 Ga0207677_10571606
1053 Ga0207703_10010659
1054 Ga0207703_10025839
1055 Ga0207703_10127638
1056 Ga0207703_10254769
1057 Ga0207639_10113641
1058 Ga0207639_10429361
1059 Ga0207639_11077686
1060 Ga0207678_10006580
1061 Ga0207678_10058296
1062 Ga0207678_10088897
1063 Ga0207678_10190499
1064 Ga0207678_10243577
1065 Ga0207678_10247150
1066 Ga0207708_10007612
1067 Ga0207708_10056749
1068 Ga0207708_10181616
1069 Ga0207708_10440321
1070 Ga0207702_10122708
1071 Ga0207702_10303958
1072 Ga0207702_11021987
1073 Ga0207641_10129126
1074 Ga0207641_10563307
1075 Ga0207648_10004029
1076 Ga0207648_10038189
1077 Ga0207648_10086901
1078 Ga0207648_10519703
1079 Ga0207676_10017382
1080 Ga0207676_10071626
1081 Ga0207676_10151386
1082 Ga0207674_10023946
1083 Ga0207674_10966712
1084 Ga0207675_100001279
1085 Ga0207675_100013039
1086 Ga0207675_100082409
1087 Ga0207675_100104897
1088 Ga0207675_100108474
1089 Ga0207675_100153700
1090 Ga0207683_10001760
1091 Ga0207683_10020176
1092 Ga0207683_10169999
1093 Ga0207683_10254983
1094 Ga0207698_10024568
1095 Ga0207698_10112529
1096 Ga0207698_10740327
1097 Ga0207428_10326647
1098 Ga0268266_10018537
1099 Ga0268266_10066073
1100 Ga0268266_10511784
1101 Ga0268265_10009379
1102 Ga0268265_10172927
1103 Ga0268265_10838624
1104 Ga0268264_10012033
1105 Ga0268264_10077889
1106 Ga0268264_10103177
1107 Ga0268264_10368568
1108 Ga0307509_10571151
1109 Ga0373959_0043716
1110 Ga0373928_0022145
1111 Ga0373928_0053679
1112 Ga0373940_0151198
1113 Ga0373949_0012518
1114 Ga0373932_0034126
1115 Ga0373942_0037548
1116 Ga0373962_0008709
1117 Ga0373931_0212258
1118 Ga0373931_0622240
1119 Ga0436364_0769592
1120 Ga0436364_1031907
1121 Ga0436364_1157350
1122 Ga0436364_1524723
1123 Ga0436365_0389962
1124 Ga0436365_1061792
1125 Ga0436365_1655600
1126 Ga0439461_0012748
1127 Ga0439465_0107657
1128 Ga0439431_0006992
1129 Ga0439445_0016946
1130 Ga0466969_0118826
1131 Ga0466963_0133067
1132 Ga0466964_0205475
1133 Ga0466964_0234973
1134 Ga0466971_0043694
1135 Ga0466968_0144001
1136 Ga0466970_0375928
1137 Ga0466957_0090731
1138 Ga0466960_0027955
1139 Ga0466959_0009255
1140 Ga0466959_0218191
1141 Ga0466959_0263175
1142 Ga0466958_0012823
1143 Ga0466958_0097078
1144 Ga0466958_0248142
1145 Ga0466967_0005164
1146 Ga0466967_0284223
1147 Ga0466967_0294108
1148 Ga0466967_0429247
1149 Ga0466967_0569926
1150 Ga0466967_0603636
1151 Ga0466967_0829713
1152 Ga0495592_0089162
1153 Ga0495652_0264622
1154 Ga0495624_0168187
1155 Ga0495604_0489733
1156 Ga0496100_0001186
1157 Ga0496100_0006360
1158 Ga0496100_0272121
1159 Ga0496100_1235496
1160 Ga0496101_0000082
1161 Ga0496101_0014884
1162 Ga0496101_0168380
1163 Ga0496101_0311017
1164 Ga0496102_0000135
1165 Ga0496102_0002203
1166 Ga0496102_0033490
1167 Ga0496102_0093889
1168 Ga0496102_0101573
1169 Ga0496102_0213035
1170 Ga0496102_0575770
1171 Ga0496102_0661091
1172 Ga0496103_0000092
1173 Ga0496103_0003391
1174 Ga0496103_0065675
1175 Ga0496104_0079445
1176 Ga0496104_0412301
1177 Ga0496105_0103645
1178 Ga0496105_0340108
1179 Ga0496105_0525667
1180 Ga0496106_0007691
1181 Ga0496106_0013821
1182 Ga0496106_0134869
1183 Ga0496106_0364383
1184 Ga0496107_0002093
1185 Ga0496107_0033047
1186 Ga0496107_0062337
1187 Ga0496107_0298230
1188 Ga0496108_0000330
1189 Ga0496108_0013654
1190 Ga0496108_0083633
1191 Ga0496108_0163546
1192 Ga0496108_0771976
1193 Ga0496109_0006552
1194 Ga0496109_0027073
1195 Ga0496109_0031787
1196 Ga0496109_0113143
1197 Ga0496109_0196414
1198 Ga0496109_0869955
1199 Ga0496110_0024814
1200 Ga0496110_0425643
1201 Ga0496111_0031140
1202 Ga0496111_0038134
1203 Ga0496111_0150926
1204 Ga0496112_0053654
1205 Ga0496112_0081670
1206 Ga0496112_0189090
1207 Ga0496113_0021914
1208 Ga0496113_0101332
1209 Ga0496114_0001806
1210 Ga0496114_0349134
1211 Ga0496114_0456133
1212 Ga0496114_0479556
1213 Ga0496115_0000858
1214 Ga0496115_0072330
1215 Ga0496116_0000238
1216 Ga0496117_0000019
1217 Ga0496118_0000020
1218 Ga0496119_0031338
1219 Ga0496119_0098543
1220 Ga0496120_0028226
1221 Ga0496120_0245121
1222 Ga0496121_0000064
1223 Ga0496126_0000668
1224 Ga0496126_0009011
1225 Ga0501047_0048200
1226 Ga0501047_0129498
1227 Ga0501047_0668571
1228 Ga0501070_0448743
1229 nmdc:mga06z11_85887_c1
1230 nmdc:mga07m45_313550_c1
1231 nmdc:mga07m45_42413_c1
1232 nmdc:mga08y16_435764_c1
1233 nmdc:mga0n895_1051443_c1
1234 nmdc:mga0n895_137700_c1
1235 nmdc:mga08x19_29120_c1
1236 nmdc:mga0a205_46240_c1
1237 nmdc:mga0a205_694462_c1
1238 nmdc:mga0sz30_42448_c2
1239 Ga0495612_0100276
1240 2643765338
1241 2644462591
1242 2676473164
1243 2819693441
1244 2827633345
1245 2862579736
1246 2974318394
1247 2984526604
1248 8053954029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

45

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9401 11 101
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9314 39 81
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9307 38 83
7bzg-assembly3.cif.gz_J structure of bacillus subtilis hxlr, wild type in complex with formaldehyde and dna 0.921 11 101
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9117 39 82
ID Description Score Start End Superfamily
af_P47050_600_749_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9508 39 83 3.30.230.130
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9472 15 103 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9314 39 81 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9307 38 83 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9267 15 103 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1X3E7T8-F1-model_v4 HTH hxlR-type domain-containing protein 0.9652 11 102 GO:0003677
AF-A0A1Y0I292-F1-model_v4 HxlR family transcriptional regulator 0.9638 11 102 GO:0003677
AF-A0A7Y2W9W9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9633 12 100 GO:0003677
AF-A0A1E3SZK0-F1-model_v4 ArsR family transcriptional regulator 0.9616 1 170 GO:0003677
AF-A0A1X0Y4G8-F1-model_v4 ArsR family transcriptional regulator 0.9603 1 170 GO:0003677

Map