F469850

General Info

Members Datasets Scaffolds Average Seq Length
619 283 532 238

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0000347|Ga0495634_0000347_40505_41311
Length 268
Sequence MQHIKLMNFYYWNVWRSLISGHGVRTWRTALKISSLNAAEKFDTSRANEYGRQSRIALAGYDACQDLAACMLAASLGPADSAKILVVGAGGTAQEIIAMAKLEPAWRFTAVDPSEPMLEAAKQQLEANNLLERTTLHLGHVEDLAADESYDAATLIGVLHHLEGDDAKRHILRSIRAHLKPDAPLIVAGNQYAYASQPLLLAAWGQRWRQHGASPDEVKAKLGKILQGADPPHSEAAVQKLLHDAGFGDATRFFSSLFWGAWLTCKVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231021 Pseudomonas sp. GM78 Isolate Nodule
3 2511231023 Pseudomonas sp. GM80 Isolate Nodule
4 2511231031 Pseudomonas sp. GM16 Isolate Nodule
5 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
6 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
7 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
8 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
9 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
10 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
11 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
12 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
13 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
14 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
15 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
16 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
17 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
18 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
19 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
20 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
21 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
22 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
23 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
24 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
25 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
26 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
27 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
28 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
29 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
30 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
31 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
32 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
33 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
34 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
35 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
36 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
37 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
38 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
39 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
40 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
41 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
42 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
43 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
44 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
45 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
46 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
47 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
48 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
49 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
50 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
51 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
52 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
53 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
54 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
55 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
56 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
57 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
58 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
59 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
60 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
61 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
62 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
63 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
64 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
65 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
66 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
67 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
68 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
69 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
70 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
71 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
72 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
73 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
74 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
75 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
76 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
77 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
78 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
79 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
80 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
81 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
82 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
83 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
84 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
85 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
86 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
87 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
88 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
89 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
90 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
91 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
92 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
93 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
94 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
95 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
96 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
145 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
146 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
150 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
151 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
152 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
153 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
154 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
155 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
156 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
157 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
158 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
159 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
160 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
161 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
162 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
165 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
170 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
171 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
266 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
273 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
276 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
277 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
278 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
279 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
280 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
281 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
282 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
283 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.95
Metatranscriptomes 0
Isolates 14.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0.48
Rhizoplane 6.79
Rhizosphere 78.19
Stem 0
Stem Tuber 0
Unclassified 9.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2776230 2162886007 Bacteria 11503
2 JGI25162J39368_1000004 3300002737 Bacteria 441040
3 JGI25154J39366_1008120 3300002738 Bacteria 1377
4 JGI25163J39215_1000104 3300002771 Bacteria 35186
5 JGI25164J39214_1000026 3300002772 Bacteria 156863
6 JGI25165J46597_1000011 3300003214 Bacteria 441040
7 JGI25160J50197_1002991 3300003354 Bacteria 7710
8 Ga0055538_1000097 3300003751 Bacteria 72022
9 Ga0055539_1000143 3300003752 Bacteria 72022
10 Ga0055533_1000148 3300003756 Bacteria 72022
11 Ga0055532_1000135 3300003758 Bacteria 72223
12 Ga0055525_1000194 3300003759 Bacteria 72022
13 Ga0055535_1019526 3300003761 Bacteria 858
14 Ga0055541_1000097 3300003841 Bacteria 72022
15 Ga0065714_10003142 3300005288 Bacteria 9879
16 Ga0065714_10005120 3300005288 Bacteria 4919
17 Ga0065714_10006773 3300005288 Bacteria 4505
18 Ga0065704_10070510 3300005289 Bacteria 22133
19 Ga0070661_100000310 3300005344 Bacteria 39292
20 Ga0068853_100572561 3300005539 Bacteria 1071
21 Ga0070664_100000241 3300005564 Bacteria 39292
22 Ga0075432_10000614 3300006058 Bacteria 10830
23 Ga0075432_10044520 3300006058 Bacteria 1556
24 Ga0105251_10024970 3300009011 Bacteria 3062
25 Ga0105251_10188291 3300009011 Bacteria 929
26 Ga0105244_10000577 3300009036 Bacteria 32855
27 Ga0105244_10007939 3300009036 Bacteria 6685
28 Ga0105244_10009290 3300009036 Bacteria 6059
29 Ga0105244_10198943 3300009036 Bacteria 945
30 Ga0105250_10002321 3300009092 Bacteria 9647
31 Ga0105243_10000060 3300009148 Bacteria 128124
32 Ga0105237_10002377 3300009545 Bacteria 23363
33 Ga0105246_10000723 3300011119 Bacteria 18714
34 Ga0157373_10000030 3300013100 Bacteria 127414
35 Ga0157373_10002048 3300013100 Bacteria 15266
36 Ga0157373_10127944 3300013100 Bacteria 1786
37 Ga0157371_10002236 3300013102 Bacteria 18713
38 Ga0157371_10002815 3300013102 Bacteria 16287
39 Ga0157370_10041007 3300013104 Bacteria 4469
40 Ga0157370_10539208 3300013104 Bacteria 1070
41 Ga0157369_10000236 3300013105 Bacteria 76415
42 Ga0157369_10253589 3300013105 Bacteria 1836
43 Ga0163162_10000081 3300013306 Bacteria 87357
44 Ga0157375_10001025 3300013308 Bacteria 24117
45 Ga0157375_10007217 3300013308 Bacteria 9718
46 Ga0182008_10001789 3300014497 Bacteria 14059
47 Ga0182006_1070967 3300015261 Bacteria 1292
48 Ga0182005_1010167 3300015265 Bacteria 2712
49 Ga0209435_100808 3300025206 Bacteria 5001
50 Ga0209760_100096 3300025207 Bacteria 68022
51 Ga0209784_100017 3300025224 Bacteria 472003
52 Ga0209566_100014 3300025225 Bacteria 472003
53 Ga0209674_100028 3300025226 Bacteria 472003
54 Ga0209147_100105 3300025229 Bacteria 157437
55 Ga0209563_100032 3300025230 Bacteria 472003
56 Ga0209563_100445 3300025230 Bacteria 14323
57 Ga0207427_100003 3300025231 Bacteria 1035004
58 Ga0209437_100002 3300025233 Bacteria 1574801
59 Ga0209258_100558 3300025242 Bacteria 32759
60 Ga0209646_1000704 3300025246 Bacteria 11986
61 Ga0209677_100018 3300025253 Bacteria 472003
62 Ga0209759_1003602 3300025256 Bacteria 6109
63 Ga0209759_1011748 3300025256 Bacteria 2468
64 Ga0209233_1000004 3300025261 Bacteria 1574798
65 Ga0209130_1000126 3300025284 Bacteria 123694
66 Ga0207426_1000046 3300025302 Bacteria 422271
67 Ga0207696_1001477 3300025711 Bacteria 12721
68 Ga0207655_1000076 3300025728 Bacteria 226359
69 Ga0207655_1000176 3300025728 Bacteria 115120
70 Ga0207655_1000203 3300025728 Bacteria 103900
71 Ga0207655_1015117 3300025728 Bacteria 4313
72 Ga0207655_1064462 3300025728 Bacteria 1397
73 Ga0207655_1075971 3300025728 Bacteria 1230
74 Ga0207713_1001910 3300025735 Bacteria 15777
75 Ga0207671_10002355 3300025914 Bacteria 20338
76 Ga0207649_10000289 3300025920 Bacteria 39217
77 Ga0207709_10000004 3300025935 Bacteria 825156
78 Ga0207679_10000037 3300025945 Bacteria 133550
79 Ga0207428_10001873 3300027907 Bacteria 21422
80 Ga0207428_10063907 3300027907 Bacteria 2907
81 Ga0307408_100006402 3300031548 Bacteria 7811
82 Ga0307414_10283828 3300032004 Bacteria 1392
83 Ga0400483_163093 3300039062 Bacteria 4902
84 Ga0436363_0624574 3300039450 Bacteria 15230
85 Ga0439438_004671 3300041405 Bacteria 5203
86 Ga0439438_006657 3300041405 Bacteria 4043
87 Ga0439438_008323 3300041405 Bacteria 3450
88 Ga0439438_012209 3300041405 Bacteria 2640
89 Ga0439447_015544 3300041407 Bacteria 2109
90 Ga0439447_034375 3300041407 Bacteria 1260
91 Ga0439466_0000188 3300041411 Bacteria 24642
92 Ga0439466_0011882 3300041411 Bacteria 3215
93 Ga0439466_0067657 3300041411 Bacteria 1142
94 Ga0439465_0003854 3300041413 Bacteria 4893
95 Ga0439432_004203 3300042006 Bacteria 5268
96 Ga0439432_010426 3300042006 Bacteria 3215
97 Ga0439451_000279 3300042009 Bacteria 9890
98 Ga0439451_001668 3300042009 Bacteria 4412
99 Ga0439452_000081 3300042010 Bacteria 82231
100 Ga0439452_000178 3300042010 Bacteria 47782
101 Ga0439452_010807 3300042010 Bacteria 2641
102 Ga0439456_002793 3300042013 Bacteria 3521
103 Ga0439456_008493 3300042013 Bacteria 2122
104 Ga0439456_010915 3300042013 Bacteria 1878
105 Ga0439456_027769 3300042013 Bacteria 1206
106 Ga0439463_063938 3300042016 Bacteria 940
107 Ga0450911_000010 3300042115 Bacteria 149605
108 Ga0450911_001529 3300042115 Bacteria 5250
109 Ga0450911_001687 3300042115 Bacteria 4875
110 Ga0450911_002974 3300042115 Bacteria 3126
111 Ga0450919_001725 3300042121 Bacteria 2854
112 Ga0450922_002338 3300042124 Bacteria 1791
113 Ga0450890_000727 3300042127 Bacteria 4778
114 Ga0450902_002415 3300042137 Bacteria 2647
115 Ga0450902_004784 3300042137 Bacteria 2024
116 Ga0450903_003961 3300042138 Bacteria 2544
117 Ga0450905_001900 3300042142 Bacteria 2673
118 Ga0450905_002805 3300042142 Bacteria 2261
119 Ga0450906_000018 3300042145 Bacteria 31270
120 Ga0450906_007276 3300042145 Bacteria 2190
121 Ga0450907_004447 3300042146 Bacteria 2417
122 Ga0450910_004813 3300042147 Bacteria 1832
123 Ga0439446_0006844 3300042156 Bacteria 2985
124 Ga0450908_004299 3300042184 Bacteria 2747
125 Ga0450909_000509 3300042185 Bacteria 5080
126 Ga0439434_0047280 3300042435 Bacteria 1329
127 Ga0439464_0050877 3300042439 Bacteria 1198
128 Ga0439460_0014693 3300042461 Bacteria 2059
129 Ga0450918_004617 3300042531 Bacteria 2503
130 Ga0450893_0013891 3300042532 Bacteria 1346
131 Ga0439440_0000370 3300042993 Bacteria 7468
132 Ga0439440_0000967 3300042993 Bacteria 5059
133 Ga0495617_000501 3300046452 Bacteria 20480
134 Ga0495617_001525 3300046452 Bacteria 10057
135 Ga0495617_004975 3300046452 Bacteria 4778
136 Ga0495617_006287 3300046452 Bacteria 4173
137 Ga0495617_008985 3300046452 Bacteria 3438
138 Ga0495617_024155 3300046452 Bacteria 2051
139 Ga0495617_024923 3300046452 Bacteria 2017
140 Ga0495617_095350 3300046452 Bacteria 969
141 Ga0495627_000389 3300046453 Bacteria 39926
142 Ga0495627_001078 3300046453 Bacteria 17940
143 Ga0495627_001437 3300046453 Bacteria 13980
144 Ga0495627_027879 3300046453 Bacteria 1807
145 Ga0495627_027882 3300046453 Bacteria 1807
146 Ga0495603_0000256 3300046455 Bacteria 27948
147 Ga0495590_0000306 3300046457 Bacteria 25686
148 Ga0495590_0000625 3300046457 Bacteria 16468
149 Ga0495590_0001098 3300046457 Bacteria 11905
150 Ga0495590_0017557 3300046457 Bacteria 2573
151 Ga0495591_000005 3300046458 Bacteria 394092
152 Ga0495591_000032 3300046458 Bacteria 176337
153 Ga0495591_000158 3300046458 Bacteria 72313
154 Ga0495591_000258 3300046458 Bacteria 50553
155 Ga0495591_000303 3300046458 Bacteria 45116
156 Ga0495591_000317 3300046458 Bacteria 43744
157 Ga0495591_013039 3300046458 Bacteria 3063
158 Ga0495591_015783 3300046458 Bacteria 2655
159 Ga0495591_020316 3300046458 Bacteria 2196
160 Ga0495591_039827 3300046458 Bacteria 1343
161 Ga0495591_063588 3300046458 Bacteria 974
162 Ga0495638_0001514 3300046460 Bacteria 20907
163 Ga0495638_0003727 3300046460 Bacteria 11863
164 Ga0495638_0004055 3300046460 Bacteria 11231
165 Ga0495638_0009504 3300046460 Bacteria 6818
166 Ga0495653_0010716 3300046463 Bacteria 7506
167 Ga0495650_0001378 3300046471 Bacteria 23968
168 Ga0495650_0001690 3300046471 Bacteria 20336
169 Ga0495650_0029618 3300046471 Bacteria 2492
170 Ga0495650_0085284 3300046471 Bacteria 1210
171 Ga0495650_0088536 3300046471 Bacteria 1181
172 Ga0495605_0000078 3300046474 Bacteria 127220
173 Ga0495605_0001405 3300046474 Bacteria 15829
174 Ga0495605_0002604 3300046474 Bacteria 11085
175 Ga0495605_0002983 3300046474 Bacteria 10230
176 Ga0495605_0003287 3300046474 Bacteria 9690
177 Ga0495605_0008595 3300046474 Bacteria 5768
178 Ga0495605_0014030 3300046474 Bacteria 4396
179 Ga0495605_0015675 3300046474 Bacteria 4119
180 Ga0495605_0032123 3300046474 Bacteria 2676
181 Ga0495605_0222000 3300046474 Bacteria 816
182 Ga0495639_0000002 3300046475 Bacteria 192403
183 Ga0495584_0000532 3300046491 Bacteria 25787
184 Ga0495584_0000803 3300046491 Bacteria 20648
185 Ga0495584_0007155 3300046491 Bacteria 5829
186 Ga0495584_0010387 3300046491 Bacteria 4785
187 Ga0495584_0012650 3300046491 Bacteria 4307
188 Ga0495584_0034865 3300046491 Bacteria 2544
189 Ga0495584_0091905 3300046491 Bacteria 1530
190 Ga0495584_0195400 3300046491 Bacteria 1028
191 Ga0495585_0000204 3300046492 Bacteria 61912
192 Ga0495585_0001191 3300046492 Bacteria 21142
193 Ga0495585_0001439 3300046492 Bacteria 18676
194 Ga0495585_0083494 3300046492 Bacteria 1728
195 Ga0495585_0147400 3300046492 Bacteria 1229
196 Ga0495585_0243799 3300046492 Bacteria 899
197 Ga0495594_0002278 3300046499 Bacteria 9999
198 Ga0495596_0000010 3300046500 Bacteria 145028
199 Ga0495596_0002175 3300046500 Bacteria 10693
200 Ga0495607_0000191 3300046501 Bacteria 65146
201 Ga0495607_0000601 3300046501 Bacteria 35014
202 Ga0495607_0000609 3300046501 Bacteria 34781
203 Ga0495607_0001779 3300046501 Bacteria 18412
204 Ga0495607_0003465 3300046501 Bacteria 12082
205 Ga0495607_0006011 3300046501 Bacteria 8606
206 Ga0495607_0014003 3300046501 Bacteria 5236
207 Ga0495607_0024407 3300046501 Bacteria 3770
208 Ga0495607_0040560 3300046501 Bacteria 2771
209 Ga0495607_0046902 3300046501 Bacteria 2534
210 Ga0495607_0066186 3300046501 Bacteria 2034
211 Ga0495583_0004673 3300046506 Bacteria 9653
212 Ga0495583_0006147 3300046506 Bacteria 7911
213 Ga0495606_0000182 3300046507 Bacteria 111236
214 Ga0495606_0000491 3300046507 Bacteria 64709
215 Ga0495606_0000875 3300046507 Bacteria 45063
216 Ga0495606_0005455 3300046507 Bacteria 12177
217 Ga0495606_0006296 3300046507 Bacteria 10999
218 Ga0495606_0006733 3300046507 Bacteria 10520
219 Ga0495606_0007096 3300046507 Bacteria 10132
220 Ga0495606_0007257 3300046507 Bacteria 9987
221 Ga0495610_0000159 3300046512 Bacteria 75002
222 Ga0495610_0000603 3300046512 Bacteria 35567
223 Ga0495610_0005796 3300046512 Bacteria 8688
224 Ga0495610_0010993 3300046512 Bacteria 5570
225 Ga0495610_0034936 3300046512 Bacteria 2585
226 Ga0495610_0051431 3300046512 Bacteria 2005
227 Ga0495610_0054817 3300046512 Bacteria 1924
228 Ga0495616_0000029 3300046513 Bacteria 133328
229 Ga0495616_0000219 3300046513 Bacteria 47096
230 Ga0495616_0000312 3300046513 Bacteria 38835
231 Ga0495616_0017457 3300046513 Bacteria 3958
232 Ga0495616_0027704 3300046513 Bacteria 3004
233 Ga0495616_0038302 3300046513 Bacteria 2462
234 Ga0495620_0000021 3300046515 Bacteria 139145
235 Ga0495620_0000843 3300046515 Bacteria 18930
236 Ga0495620_0001362 3300046515 Bacteria 14777
237 Ga0495620_0005104 3300046515 Bacteria 7352
238 Ga0495620_0009928 3300046515 Bacteria 5038
239 Ga0495620_0012888 3300046515 Bacteria 4297
240 Ga0495620_0036244 3300046515 Bacteria 2208
241 Ga0495628_0305698 3300046516 Bacteria 1176
242 Ga0495630_0311838 3300046517 Bacteria 1202
243 Ga0495631_0000106 3300046518 Bacteria 55219
244 Ga0495631_0000391 3300046518 Bacteria 30231
245 Ga0495631_0002367 3300046518 Bacteria 10725
246 Ga0495631_0003876 3300046518 Bacteria 8099
247 Ga0495631_0007649 3300046518 Bacteria 5488
248 Ga0495632_0000434 3300046519 Bacteria 39843
249 Ga0495632_0000889 3300046519 Bacteria 26229
250 Ga0495632_0016472 3300046519 Bacteria 4110
251 Ga0495632_0018229 3300046519 Bacteria 3856
252 Ga0495632_0020098 3300046519 Bacteria 3624
253 Ga0495632_0025029 3300046519 Bacteria 3161
254 Ga0495632_0039973 3300046519 Bacteria 2364
255 Ga0495632_0055077 3300046519 Bacteria 1947
256 Ga0495632_0167475 3300046519 Bacteria 1010
257 Ga0495637_0000261 3300046520 Bacteria 41729
258 Ga0495637_0000380 3300046520 Bacteria 33272
259 Ga0495637_0000923 3300046520 Bacteria 18831
260 Ga0495637_0001316 3300046520 Bacteria 14896
261 Ga0495637_0001338 3300046520 Bacteria 14790
262 Ga0495637_0002114 3300046520 Bacteria 11160
263 Ga0495637_0010042 3300046520 Bacteria 4597
264 Ga0495637_0010968 3300046520 Bacteria 4367
265 Ga0495637_0018156 3300046520 Bacteria 3267
266 Ga0495637_0050825 3300046520 Bacteria 1737
267 Ga0495637_0068727 3300046520 Bacteria 1434
268 Ga0495643_0000523 3300046522 Bacteria 47863
269 Ga0495643_0001622 3300046522 Bacteria 19878
270 Ga0495643_0163920 3300046522 Bacteria 1092
271 Ga0495643_0208945 3300046522 Bacteria 932
272 Ga0495644_0000104 3300046523 Bacteria 40103
273 Ga0495644_0010411 3300046523 Bacteria 3584
274 Ga0495648_0000042 3300046524 Bacteria 179918
275 Ga0495648_0000237 3300046524 Bacteria 63132
276 Ga0495648_0000285 3300046524 Bacteria 57435
277 Ga0495648_0000638 3300046524 Bacteria 37358
278 Ga0495648_0002420 3300046524 Bacteria 17298
279 Ga0495648_0005265 3300046524 Bacteria 10800
280 Ga0495648_0008944 3300046524 Bacteria 7828
281 Ga0495648_0009719 3300046524 Bacteria 7409
282 Ga0495648_0012647 3300046524 Bacteria 6275
283 Ga0495648_0019744 3300046524 Bacteria 4724
284 Ga0495648_0088345 3300046524 Bacteria 1742
285 Ga0495648_0217921 3300046524 Bacteria 943
286 Ga0495666_0003780 3300046526 Bacteria 7655
287 Ga0495642_0000620 3300046528 Bacteria 17886
288 Ga0495652_0099313 3300046529 Bacteria 2364
289 Ga0495654_0000050 3300046530 Bacteria 146814
290 Ga0495654_0000290 3300046530 Bacteria 45364
291 Ga0495654_0001443 3300046530 Bacteria 16315
292 Ga0495654_0007684 3300046530 Bacteria 5999
293 Ga0495654_0010314 3300046530 Bacteria 5084
294 Ga0495654_0010634 3300046530 Bacteria 5000
295 Ga0495654_0014175 3300046530 Bacteria 4249
296 Ga0495654_0014695 3300046530 Bacteria 4163
297 Ga0495654_0017602 3300046530 Bacteria 3752
298 Ga0495654_0025453 3300046530 Bacteria 3047
299 Ga0495654_0028829 3300046530 Bacteria 2835
300 Ga0495654_0059022 3300046530 Bacteria 1849
301 Ga0495654_0063343 3300046530 Bacteria 1770
302 Ga0495587_0003714 3300046536 Bacteria 10133
303 Ga0495609_0000093 3300046538 Bacteria 106232
304 Ga0495609_0000819 3300046538 Bacteria 23180
305 Ga0495609_0001559 3300046538 Bacteria 15011
306 Ga0495609_0016450 3300046538 Bacteria 3446
307 Ga0495609_0066248 3300046538 Bacteria 1591
308 Ga0495609_0141094 3300046538 Bacteria 1028
309 Ga0495597_0000197 3300046542 Bacteria 55298
310 Ga0495597_0001466 3300046542 Bacteria 16920
311 Ga0495597_0020411 3300046542 Bacteria 3087
312 Ga0495597_0039901 3300046542 Bacteria 2099
313 Ga0495597_0125460 3300046542 Bacteria 1067
314 Ga0495622_0000264 3300046557 Bacteria 40025
315 Ga0495622_0000493 3300046557 Bacteria 24765
316 Ga0495622_0091852 3300046557 Bacteria 1394
317 Ga0495622_0133018 3300046557 Bacteria 1132
318 Ga0495622_0170514 3300046557 Bacteria 979
319 Ga0495633_0000493 3300046558 Bacteria 39886
320 Ga0495633_0009586 3300046558 Bacteria 5336
321 Ga0495633_0027141 3300046558 Bacteria 2801
322 Ga0495633_0097094 3300046558 Bacteria 1368
323 Ga0495656_0195093 3300046615 Bacteria 1002
324 Ga0495668_0000238 3300046616 Bacteria 78527
325 Ga0495668_0000244 3300046616 Bacteria 77764
326 Ga0495668_0009279 3300046616 Bacteria 6049
327 Ga0495634_0000347 3300046642 Bacteria 44864
328 Ga0495611_0000832 3300046648 Bacteria 16996
329 Ga0495611_0002396 3300046648 Bacteria 8627
330 Ga0495625_0000387 3300046660 Bacteria 67320
331 Ga0495625_0002844 3300046660 Bacteria 18183
332 Ga0495625_0003394 3300046660 Bacteria 15945
333 Ga0495625_0003843 3300046660 Bacteria 14519
334 Ga0495625_0006965 3300046660 Bacteria 9969
335 Ga0495625_0019128 3300046660 Bacteria 5326
336 Ga0495625_0053825 3300046660 Bacteria 2876
337 Ga0495625_0068414 3300046660 Bacteria 2496
338 Ga0495635_0000210 3300046663 Bacteria 37002
339 Ga0495659_0119214 3300046664 Bacteria 1037
340 Ga0495661_0000293 3300046665 Bacteria 56702
341 Ga0495661_0003883 3300046665 Bacteria 10930
342 Ga0495661_0004848 3300046665 Bacteria 9637
343 Ga0495661_0009909 3300046665 Bacteria 6518
344 Ga0495661_0019783 3300046665 Bacteria 4406
345 Ga0495661_0031980 3300046665 Bacteria 3330
346 Ga0495661_0035455 3300046665 Bacteria 3130
347 Ga0495661_0045804 3300046665 Bacteria 2672
348 Ga0495661_0109183 3300046665 Bacteria 1544
349 Ga0495588_0063249 3300046674 Bacteria 1918
350 Ga0495657_0052857 3300046675 Bacteria 2721
351 Ga0495623_0002642 3300046679 Bacteria 11823
352 Ga0495646_0001737 3300046680 Bacteria 13069
353 Ga0495613_0004016 3300046689 Bacteria 11014
354 Ga0495624_0089925 3300046690 Bacteria 1894
355 Ga0495670_0000131 3300046691 Bacteria 32446
356 Ga0495670_0033333 3300046691 Bacteria 2562
357 Ga0495670_0121024 3300046691 Bacteria 1359
358 Ga0495670_0291568 3300046691 Bacteria 873
359 Ga0495671_0000297 3300046692 Bacteria 41725
360 Ga0495671_0007779 3300046692 Bacteria 6069
361 Ga0495671_0043396 3300046692 Bacteria 2256
362 Ga0495671_0112657 3300046692 Bacteria 1328
363 Ga0495649_0000042 3300046694 Bacteria 123006
364 Ga0495649_0000754 3300046694 Bacteria 26023
365 Ga0495649_0001155 3300046694 Bacteria 20515
366 Ga0495649_0001987 3300046694 Bacteria 14828
367 Ga0495649_0008879 3300046694 Bacteria 6016
368 Ga0495649_0009343 3300046694 Bacteria 5833
369 Ga0495649_0010331 3300046694 Bacteria 5513
370 Ga0495649_0011806 3300046694 Bacteria 5109
371 Ga0495649_0014112 3300046694 Bacteria 4587
372 Ga0495649_0040520 3300046694 Bacteria 2550
373 Ga0495649_0044860 3300046694 Bacteria 2412
374 Ga0495649_0128517 3300046694 Bacteria 1337
375 Ga0495589_0000011 3300046794 Bacteria 250370
376 Ga0495589_0000957 3300046794 Bacteria 17657
377 Ga0495589_0001055 3300046794 Bacteria 16589
378 Ga0495589_0001213 3300046794 Bacteria 15327
379 Ga0495589_0013111 3300046794 Bacteria 4280
380 Ga0495589_0013351 3300046794 Bacteria 4237
381 Ga0495589_0015797 3300046794 Bacteria 3881
382 Ga0495589_0029515 3300046794 Bacteria 2764
383 Ga0495660_0000136 3300046810 Bacteria 79750
384 Ga0495660_0000281 3300046810 Bacteria 47510
385 Ga0495660_0000527 3300046810 Bacteria 31291
386 Ga0495660_0000834 3300046810 Bacteria 22880
387 Ga0495660_0003745 3300046810 Bacteria 9337
388 Ga0495660_0004261 3300046810 Bacteria 8675
389 Ga0495660_0016865 3300046810 Bacteria 4208
390 Ga0495660_0040077 3300046810 Bacteria 2597
391 Ga0495660_0068949 3300046810 Bacteria 1880
392 Ga0495660_0076145 3300046810 Bacteria 1768
393 Ga0495660_0096421 3300046810 Bacteria 1528
394 Ga0495581_0008250 3300047315 Bacteria 6038
395 Ga0495604_0012504 3300047317 Bacteria 6752
396 Ga0495604_0015203 3300047317 Bacteria 6144
397 Ga0495674_0013674 3300047319 Bacteria 7625
398 Ga0495672_0003049 3300047320 Bacteria 14688
399 Ga0495672_0004011 3300047320 Bacteria 12312
400 Ga0495672_0004106 3300047320 Bacteria 12133
401 Ga0495672_0004293 3300047320 Bacteria 11753
402 Ga0495672_0010097 3300047320 Bacteria 6756
403 Ga0495672_0044612 3300047320 Bacteria 2659
404 Ga0495672_0049069 3300047320 Bacteria 2500
405 Ga0495672_0084473 3300047320 Bacteria 1760
406 Ga0495676_0000050 3300047321 Bacteria 97800
407 Ga0495680_0007325 3300047322 Bacteria 10148
408 Ga0495680_0067180 3300047322 Bacteria 2741
409 Ga0495680_0136175 3300047322 Bacteria 1800
410 Ga0495680_0332392 3300047322 Bacteria 1061
411 Ga0495683_0000205 3300047323 Bacteria 56156
412 Ga0495683_0000710 3300047323 Bacteria 24349
413 Ga0495683_0001985 3300047323 Bacteria 12747
414 Ga0495683_0005002 3300047323 Bacteria 7423
415 Ga0495683_0005170 3300047323 Bacteria 7268
416 Ga0495683_0007107 3300047323 Bacteria 6076
417 Ga0495683_0009387 3300047323 Bacteria 5213
418 Ga0495683_0067340 3300047323 Bacteria 1763
419 Ga0495687_003110 3300047443 Bacteria 12406
420 Ga0495687_014060 3300047443 Bacteria 4140
421 Ga0495675_0121090 3300047444 Bacteria 1629
422 Ga0495679_000220 3300047446 Bacteria 48253
423 Ga0495679_000294 3300047446 Bacteria 40762
424 Ga0495679_000628 3300047446 Bacteria 23791
425 Ga0495679_002370 3300047446 Bacteria 9660
426 Ga0495679_008596 3300047446 Bacteria 4138
427 Ga0495685_032565 3300047447 Bacteria 1791
428 Ga0495673_0000177 3300047469 Bacteria 102979
429 Ga0495673_0001122 3300047469 Bacteria 22944
430 Ga0495673_0003822 3300047469 Bacteria 9724
431 Ga0495673_0009031 3300047469 Bacteria 5541
432 Ga0495673_0010167 3300047469 Bacteria 5139
433 Ga0495673_0044882 3300047469 Bacteria 1969
434 Ga0495681_0000086 3300047470 Bacteria 81824
435 Ga0495681_0000529 3300047470 Bacteria 29192
436 Ga0495681_0000547 3300047470 Bacteria 28724
437 Ga0495681_0001683 3300047470 Bacteria 16382
438 Ga0495681_0003872 3300047470 Bacteria 10334
439 Ga0495681_0015491 3300047470 Bacteria 4310
440 Ga0495681_0016879 3300047470 Bacteria 4072
441 Ga0495681_0024597 3300047470 Bacteria 3168
442 Ga0495681_0049429 3300047470 Bacteria 1987
443 Ga0495681_0082412 3300047470 Bacteria 1433
444 Ga0495684_0005888 3300047471 Bacteria 9525
445 Ga0495686_0000704 3300047472 Bacteria 45014
446 Ga0495686_0003648 3300047472 Bacteria 13173
447 Ga0495686_0014966 3300047472 Bacteria 5319
448 Ga0495686_0023337 3300047472 Bacteria 4081
449 Ga0495593_0000026 3300047673 Bacteria 62356
450 Ga0495593_0206577 3300047673 Bacteria 986
451 Ga0495602_0067067 3300048088 Bacteria 3089
452 Ga0495626_0000073 3300048091 Bacteria 133813
453 Ga0495626_0000277 3300048091 Bacteria 56289
454 Ga0495626_0000806 3300048091 Bacteria 28353
455 Ga0495626_0001789 3300048091 Bacteria 16252
456 Ga0495626_0002281 3300048091 Bacteria 13645
457 Ga0495626_0003407 3300048091 Bacteria 10223
458 Ga0495626_0004477 3300048091 Bacteria 8563
459 Ga0495626_0008279 3300048091 Bacteria 5720
460 Ga0495626_0008498 3300048091 Bacteria 5622
461 Ga0495626_0022669 3300048091 Bacteria 3099
462 Ga0496101_0381213 3300048904 Bacteria 1109
463 Ga0496102_0000444 3300048905 Bacteria 47025
464 Ga0496103_0000290 3300048906 Bacteria 47006
465 Ga0496104_0007566 3300048907 Bacteria 9610
466 Ga0496106_0580899 3300048909 Bacteria 898
467 Ga0496107_0047569 3300048910 Bacteria 3089
468 Ga0496110_0098162 3300048913 Bacteria 2624
469 Ga0496111_0201849 3300048914 Unclassified 1478
470 Ga0496114_0082985 3300048917 Bacteria 2710
471 Ga0496115_0159327 3300048918 Bacteria 1865
472 Ga0496115_0492492 3300048918 Bacteria 986
473 Ga0496116_0000038 3300048919 Bacteria 370217
474 Ga0496116_0000410 3300048919 Bacteria 61350
475 Ga0496116_0002015 3300048919 Bacteria 21833
476 Ga0496116_0073134 3300048919 Bacteria 2163
477 Ga0496116_0088203 3300048919 Bacteria 1896
478 Ga0496117_0000475 3300048920 Bacteria 66690
479 Ga0496117_0001030 3300048920 Bacteria 42551
480 Ga0496117_0002386 3300048920 Bacteria 23895
481 Ga0496117_0090489 3300048920 Bacteria 1971
482 Ga0496117_0135846 3300048920 Bacteria 1481
483 Ga0496118_0000482 3300048921 Bacteria 66218
484 Ga0496118_0034385 3300048921 Bacteria 4136
485 Ga0496118_0145598 3300048921 Bacteria 1493
486 Ga0496121_0000377 3300048924 Bacteria 91399
487 Ga0496121_0033101 3300048924 Bacteria 4684
488 Ga0496121_0043275 3300048924 Bacteria 3903
489 Ga0496121_0361520 3300048924 Bacteria 963
490 Ga0496122_0004726 3300048925 Bacteria 16713
491 Ga0496122_0017040 3300048925 Bacteria 6820
492 Ga0496122_0058445 3300048925 Bacteria 2854
493 Ga0496123_0000713 3300048926 Bacteria 54331
494 Ga0496123_0001027 3300048926 Bacteria 42422
495 Ga0496123_0048532 3300048926 Bacteria 2855
496 Ga0496124_0020915 3300048927 Bacteria 6036
497 Ga0496124_0066334 3300048927 Bacteria 3006
498 Ga0496124_0096684 3300048927 Bacteria 2399
499 Ga0496125_0001073 3300048928 Bacteria 42119
500 Ga0496125_0310713 3300048928 Bacteria 961
501 Ga0496126_0079671 3300048929 Bacteria 2899
502 Ga0496126_0083853 3300048929 Bacteria 2812
503 Ga0496126_0285301 3300048929 Bacteria 1366
504 Ga0495678_000148 3300049459 Bacteria 84758
505 Ga0495678_000704 3300049459 Bacteria 30394
506 Ga0495678_000908 3300049459 Bacteria 26012
507 Ga0495678_000951 3300049459 Bacteria 25107
508 Ga0495678_001566 3300049459 Bacteria 17568
509 Ga0495678_003302 3300049459 Bacteria 10068
510 Ga0495678_003448 3300049459 Bacteria 9795
511 Ga0495678_011300 3300049459 Bacteria 4281
512 Ga0495678_021499 3300049459 Bacteria 2840
513 Ga0495678_038535 3300049459 Bacteria 1933
514 Ga0495678_041028 3300049459 Bacteria 1855
515 Ga0495678_052667 3300049459 Bacteria 1566
516 Ga0495678_082613 3300049459 Bacteria 1149
517 Ga0495682_0000168 3300049460 Bacteria 55323
518 Ga0495682_0000753 3300049460 Bacteria 20892
519 Ga0495682_0007407 3300049460 Bacteria 4366
520 Ga0495682_0091186 3300049460 Bacteria 1094
521 Ga0495682_0139634 3300049460 Bacteria 865
522 Ga0501038_0306439 3300049574 Bacteria 1245
523 Ga0501035_0340226 3300049822 Bacteria 1257
524 Ga0501044_0000213 3300049823 Bacteria 73593
525 nmdc:mga03683_179489_c1 3300050489 Bacteria 965
526 nmdc:mga00v17_285396_c1 3300050491 Bacteria 1072
527 nmdc:mga00v17_66610_c1 3300050491 Bacteria 2224
528 Ga0500572_000069 3300053111 Bacteria 32291
529 Ga0500621_062816 3300053126 Bacteria 1500
530 Ga0500559_0245021 3300053136 Bacteria 845
531 Ga0500586_000090 3300053145 Bacteria 15652
532 Ga0500649_059761 3300053722 Bacteria 1591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0040560 Ga0495607_0040560_1323_1976 215
2 3300053136 Ga0500559_0245021 Ga0500559_0245021_91_828 217
3 3300048904 Ga0496101_0381213 Ga0496101_0381213_179_889 218
4 3300048907 Ga0496104_0007566 Ga0496104_0007566_2810_3520 218
5 3300048910 Ga0496107_0047569 Ga0496107_0047569_1869_2579 218
6 3300048914 Ga0496111_0201849 Ga0496111_0201849_592_1302 218
7 3300048917 Ga0496114_0082985 Ga0496114_0082985_432_1142 218
8 3300048918 Ga0496115_0159327 Ga0496115_0159327_97_807 218
9 3300005539 Ga0068853_100572561 Ga0068853_1005725612 222
10 3300046491 Ga0495584_0195400 Ga0495584_0195400_149_865 222
11 3300003354 JGI25160J50197_1002991 JGI25160J50197_10029913 223
12 3300025284 Ga0209130_1000126 Ga0209130_10001261 223
13 3300025302 Ga0207426_1000046 Ga0207426_100004673 223
14 3300046512 Ga0495610_0051431 Ga0495610_0051431_910_1620 223
15 iso_pu_bacteria 2511231031 2511414538 228
16 3300046810 Ga0495660_0016865 Ga0495660_0016865_235_939 230
17 iso_pu_bacteria 2565956521 2566038107 230
18 iso_pu_bacteria 2738543025 2739313268 230
19 3300048929 Ga0496126_0079671 Ga0496126_0079671_2186_2881 231
20 iso_pu_bacteria 2511231023 2511371169 231
21 iso_pu_bacteria 2600255318 2601799401 231
22 iso_pu_bacteria 2603880185 2606078366 231
23 iso_pu_bacteria 2603880199 2606130474 231
24 iso_pu_bacteria 2623620443 2624480371 231
25 iso_pu_bacteria 2713897149 2715760082 231
26 iso_pu_bacteria 2878029506 2878032297 231
27 3300009036 Ga0105244_10007939 Ga0105244_1000793911 232
28 3300009036 Ga0105244_10009290 Ga0105244_100092907 232
29 3300013306 Ga0163162_10000081 Ga0163162_1000008186 232
30 3300013308 Ga0157375_10007217 Ga0157375_100072173 232
31 3300025728 Ga0207655_1015117 Ga0207655_10151173 232
32 3300039062 Ga0400483_163093 Ga0400483_163093_1620_2342 232
33 3300039450 Ga0436363_0624574 Ga0436363_0624574_14026_14760 232
34 3300046452 Ga0495617_008985 Ga0495617_008985_950_1660 232
35 3300046452 Ga0495617_024923 Ga0495617_024923_478_1224 232
36 3300046452 Ga0495617_095350 Ga0495617_095350_57_761 232
37 3300046453 Ga0495627_027879 Ga0495627_027879_15_761 232
38 3300046453 Ga0495627_027882 Ga0495627_027882_1047_1793 232
39 3300046458 Ga0495591_000317 Ga0495591_000317_16055_16801 232
40 3300046471 Ga0495650_0029618 Ga0495650_0029618_828_1574 232
41 3300046474 Ga0495605_0002983 Ga0495605_0002983_5808_6554 232
42 3300046491 Ga0495584_0007155 Ga0495584_0007155_3878_4588 232
43 3300046501 Ga0495607_0003465 Ga0495607_0003465_1015_1719 232
44 3300046501 Ga0495607_0014003 Ga0495607_0014003_3512_4222 232
45 3300046506 Ga0495583_0004673 Ga0495583_0004673_8015_8719 232
46 3300046506 Ga0495583_0006147 Ga0495583_0006147_893_1639 232
47 3300046507 Ga0495606_0000491 Ga0495606_0000491_2459_3205 232
48 3300046507 Ga0495606_0000875 Ga0495606_0000875_17151_17897 232
49 3300046507 Ga0495606_0006733 Ga0495606_0006733_6989_7735 232
50 3300046512 Ga0495610_0000603 Ga0495610_0000603_4745_5449 232
51 3300046513 Ga0495616_0000219 Ga0495616_0000219_40751_41497 232
52 3300046513 Ga0495616_0000312 Ga0495616_0000312_26599_27345 232
53 3300046513 Ga0495616_0038302 Ga0495616_0038302_1474_2220 232
54 3300046515 Ga0495620_0000021 Ga0495620_0000021_60294_61040 232
55 3300046515 Ga0495620_0036244 Ga0495620_0036244_84_830 232
56 3300046518 Ga0495631_0000106 Ga0495631_0000106_27463_28209 232
57 3300046518 Ga0495631_0003876 Ga0495631_0003876_4037_4783 232
58 3300046519 Ga0495632_0016472 Ga0495632_0016472_782_1528 232
59 3300046519 Ga0495632_0020098 Ga0495632_0020098_2483_3187 232
60 3300046519 Ga0495632_0055077 Ga0495632_0055077_428_1174 232
61 3300046520 Ga0495637_0000261 Ga0495637_0000261_21840_22586 232
62 3300046520 Ga0495637_0000923 Ga0495637_0000923_2192_2938 232
63 3300046520 Ga0495637_0001338 Ga0495637_0001338_4491_5237 232
64 3300046522 Ga0495643_0000523 Ga0495643_0000523_20905_21651 232
65 3300046524 Ga0495648_0000638 Ga0495648_0000638_20569_21315 232
66 3300046524 Ga0495648_0009719 Ga0495648_0009719_1018_1764 232
67 3300046530 Ga0495654_0001443 Ga0495654_0001443_9577_10323 232
68 3300046538 Ga0495609_0000093 Ga0495609_0000093_88280_89026 232
69 3300046538 Ga0495609_0000819 Ga0495609_0000819_4458_5204 232
70 3300046538 Ga0495609_0016450 Ga0495609_0016450_1123_1833 232
71 3300046542 Ga0495597_0000197 Ga0495597_0000197_27127_27873 232
72 3300046557 Ga0495622_0000264 Ga0495622_0000264_11831_12577 232
73 3300046558 Ga0495633_0000493 Ga0495633_0000493_27401_28147 232
74 3300046616 Ga0495668_0009279 Ga0495668_0009279_4108_4854 232
75 3300046660 Ga0495625_0002844 Ga0495625_0002844_1987_2733 232
76 3300046660 Ga0495625_0006965 Ga0495625_0006965_4239_4985 232
77 3300046665 Ga0495661_0003883 Ga0495661_0003883_7478_8182 232
78 3300046665 Ga0495661_0109183 Ga0495661_0109183_117_863 232
79 3300046690 Ga0495624_0089925 Ga0495624_0089925_64_810 232
80 3300046694 Ga0495649_0008879 Ga0495649_0008879_4328_5074 232
81 3300046694 Ga0495649_0011806 Ga0495649_0011806_3095_3841 232
82 3300046794 Ga0495589_0000011 Ga0495589_0000011_58615_59361 232
83 3300046810 Ga0495660_0000527 Ga0495660_0000527_3961_4707 232
84 3300046810 Ga0495660_0003745 Ga0495660_0003745_7841_8587 232
85 3300047320 Ga0495672_0003049 Ga0495672_0003049_7473_8219 232
86 3300047320 Ga0495672_0004106 Ga0495672_0004106_2190_2936 232
87 3300047323 Ga0495683_0005002 Ga0495683_0005002_5383_6087 232
88 3300047323 Ga0495683_0067340 Ga0495683_0067340_374_1120 232
89 3300047446 Ga0495679_008596 Ga0495679_008596_310_1020 232
90 3300047469 Ga0495673_0001122 Ga0495673_0001122_19213_19959 232
91 3300047469 Ga0495673_0044882 Ga0495673_0044882_486_1190 232
92 3300047470 Ga0495681_0000086 Ga0495681_0000086_11252_11998 232
93 3300048091 Ga0495626_0000806 Ga0495626_0000806_10935_11681 232
94 3300048919 Ga0496116_0000410 Ga0496116_0000410_37668_38378 232
95 3300049459 Ga0495678_000704 Ga0495678_000704_23910_24656 232
96 3300049459 Ga0495678_011300 Ga0495678_011300_2785_3531 232
97 3300049460 Ga0495682_0000168 Ga0495682_0000168_27143_27889 232
98 3300049460 Ga0495682_0007407 Ga0495682_0007407_2147_2857 232
99 3300053111 Ga0500572_000069 Ga0500572_000069_25569_26315 232
100 3300053126 Ga0500621_062816 Ga0500621_062816_731_1477 232
101 iso_pu_bacteria 2713897148 2715752652 232
102 iso_pu_bacteria 2718217725 2718634474 232
103 iso_pu_bacteria 2818991456 2819656899 232
104 iso_pu_bacteria 2821443989 2821447117 232
105 iso_pu_bacteria 2842843487 2842847015 232
106 iso_pu_bacteria 2919487758 2919492744 232
107 iso_pu_bacteria 2998139840 2998142267 232
108 iso_pu_bacteria 3007855910 3007856469 232
109 iso_pu_bacteria 8029995093 8029998443 232
110 iso_pu_bacteria 8056166840 8056168805 232
111 3300009011 Ga0105251_10024970 Ga0105251_100249703 233
112 3300009011 Ga0105251_10188291 Ga0105251_101882911 233
113 3300009092 Ga0105250_10002321 Ga0105250_100023212 233
114 3300009148 Ga0105243_10000060 Ga0105243_1000006079 233
115 3300013100 Ga0157373_10000030 Ga0157373_1000003045 233
116 3300013105 Ga0157369_10000236 Ga0157369_1000023652 233
117 3300015265 Ga0182005_1010167 Ga0182005_10101672 233
118 3300025711 Ga0207696_1001477 Ga0207696_10014779 233
119 3300025728 Ga0207655_1000076 Ga0207655_1000076126 233
120 3300025735 Ga0207713_1001910 Ga0207713_10019108 233
121 3300025935 Ga0207709_10000004 Ga0207709_1000000477 233
122 3300042013 Ga0439456_027769 Ga0439456_027769_335_1042 233
123 3300042142 Ga0450905_001900 Ga0450905_001900_1743_2450 233
124 3300046452 Ga0495617_001525 Ga0495617_001525_4443_5159 233
125 3300046452 Ga0495617_024155 Ga0495617_024155_1293_2000 233
126 3300046453 Ga0495627_000389 Ga0495627_000389_15868_16575 233
127 3300046457 Ga0495590_0017557 Ga0495590_0017557_1334_2050 233
128 3300046458 Ga0495591_000032 Ga0495591_000032_110629_111336 233
129 3300046458 Ga0495591_000158 Ga0495591_000158_36502_37209 233
130 3300046458 Ga0495591_000258 Ga0495591_000258_41513_42229 233
131 3300046458 Ga0495591_000303 Ga0495591_000303_41383_42090 233
132 3300046458 Ga0495591_039827 Ga0495591_039827_234_941 233
133 3300046460 Ga0495638_0001514 Ga0495638_0001514_1616_2323 233
134 3300046463 Ga0495653_0010716 Ga0495653_0010716_6732_7448 233
135 3300046474 Ga0495605_0000078 Ga0495605_0000078_91205_91912 233
136 3300046474 Ga0495605_0008595 Ga0495605_0008595_4264_4971 233
137 3300046491 Ga0495584_0012650 Ga0495584_0012650_1999_2706 233
138 3300046492 Ga0495585_0000204 Ga0495585_0000204_11594_12310 233
139 3300046492 Ga0495585_0001191 Ga0495585_0001191_1605_2312 233
140 3300046500 Ga0495596_0002175 Ga0495596_0002175_2097_2804 233
141 3300046501 Ga0495607_0000191 Ga0495607_0000191_52843_53559 233
142 3300046507 Ga0495606_0000182 Ga0495606_0000182_31562_32269 233
143 3300046507 Ga0495606_0007096 Ga0495606_0007096_6720_7436 233
144 3300046512 Ga0495610_0000159 Ga0495610_0000159_10353_11060 233
145 3300046513 Ga0495616_0000029 Ga0495616_0000029_96573_97280 233
146 3300046515 Ga0495620_0000843 Ga0495620_0000843_15821_16528 233
147 3300046519 Ga0495632_0000434 Ga0495632_0000434_15791_16498 233
148 3300046519 Ga0495632_0018229 Ga0495632_0018229_2275_2991 233
149 3300046520 Ga0495637_0001316 Ga0495637_0001316_950_1657 233
150 3300046520 Ga0495637_0010968 Ga0495637_0010968_1400_2107 233
151 3300046520 Ga0495637_0018156 Ga0495637_0018156_1137_1853 233
152 3300046522 Ga0495643_0001622 Ga0495643_0001622_14786_15502 233
153 3300046524 Ga0495648_0000237 Ga0495648_0000237_1625_2368 233
154 3300046524 Ga0495648_0000285 Ga0495648_0000285_46751_47458 233
155 3300046524 Ga0495648_0005265 Ga0495648_0005265_1460_2167 233
156 3300046524 Ga0495648_0012647 Ga0495648_0012647_1645_2352 233
157 3300046530 Ga0495654_0000050 Ga0495654_0000050_66991_67698 233
158 3300046530 Ga0495654_0014695 Ga0495654_0014695_1966_2682 233
159 3300046530 Ga0495654_0025453 Ga0495654_0025453_1339_2046 233
160 3300046530 Ga0495654_0028829 Ga0495654_0028829_177_920 233
161 3300046530 Ga0495654_0063343 Ga0495654_0063343_637_1344 233
162 3300046557 Ga0495622_0133018 Ga0495622_0133018_147_854 233
163 3300046616 Ga0495668_0000244 Ga0495668_0000244_24538_25245 233
164 3300046648 Ga0495611_0000832 Ga0495611_0000832_15873_16580 233
165 3300046660 Ga0495625_0000387 Ga0495625_0000387_30922_31629 233
166 3300046660 Ga0495625_0053825 Ga0495625_0053825_905_1612 233
167 3300046665 Ga0495661_0000293 Ga0495661_0000293_47786_48502 233
168 3300046692 Ga0495671_0000297 Ga0495671_0000297_5601_6308 233
169 3300046694 Ga0495649_0000042 Ga0495649_0000042_100787_101494 233
170 3300046694 Ga0495649_0001987 Ga0495649_0001987_13599_14336 233
171 3300046794 Ga0495589_0000957 Ga0495589_0000957_16813_17520 233
172 3300046810 Ga0495660_0000136 Ga0495660_0000136_66301_67008 233
173 3300046810 Ga0495660_0000281 Ga0495660_0000281_9781_10488 233
174 3300046810 Ga0495660_0000834 Ga0495660_0000834_10572_11288 233
175 3300046810 Ga0495660_0068949 Ga0495660_0068949_937_1644 233
176 3300046810 Ga0495660_0076145 Ga0495660_0076145_894_1643 233
177 3300047321 Ga0495676_0000050 Ga0495676_0000050_82808_83524 233
178 3300047323 Ga0495683_0001985 Ga0495683_0001985_1436_2152 233
179 3300047323 Ga0495683_0007107 Ga0495683_0007107_4973_5680 233
180 3300047446 Ga0495679_000220 Ga0495679_000220_4142_4849 233
181 3300047446 Ga0495679_000294 Ga0495679_000294_38700_39407 233
182 3300047446 Ga0495679_000628 Ga0495679_000628_17280_18029 233
183 3300047469 Ga0495673_0000177 Ga0495673_0000177_80629_81336 233
184 3300047469 Ga0495673_0009031 Ga0495673_0009031_3758_4465 233
185 3300047470 Ga0495681_0024597 Ga0495681_0024597_847_1563 233
186 3300047472 Ga0495686_0000704 Ga0495686_0000704_22492_23208 233
187 3300048091 Ga0495626_0000073 Ga0495626_0000073_35741_36448 233
188 3300048091 Ga0495626_0001789 Ga0495626_0001789_893_1600 233
189 3300048091 Ga0495626_0003407 Ga0495626_0003407_737_1444 233
190 3300048091 Ga0495626_0008279 Ga0495626_0008279_3676_4392 233
191 3300048091 Ga0495626_0022669 Ga0495626_0022669_1725_2432 233
192 3300048913 Ga0496110_0098162 Ga0496110_0098162_47_754 233
193 3300048919 Ga0496116_0073134 Ga0496116_0073134_1282_1989 233
194 3300048920 Ga0496117_0135846 Ga0496117_0135846_178_885 233
195 3300048921 Ga0496118_0145598 Ga0496118_0145598_559_1266 233
196 3300048924 Ga0496121_0033101 Ga0496121_0033101_534_1241 233
197 3300048924 Ga0496121_0361520 Ga0496121_0361520_134_841 233
198 3300048925 Ga0496122_0058445 Ga0496122_0058445_1972_2679 233
199 3300048926 Ga0496123_0048532 Ga0496123_0048532_1970_2677 233
200 3300048927 Ga0496124_0020915 Ga0496124_0020915_2087_2794 233
201 3300048928 Ga0496125_0310713 Ga0496125_0310713_139_846 233
202 3300049459 Ga0495678_000148 Ga0495678_000148_21403_22110 233
203 3300049459 Ga0495678_000951 Ga0495678_000951_19796_20512 233
204 3300049459 Ga0495678_001566 Ga0495678_001566_2522_3229 233
205 3300049459 Ga0495678_003448 Ga0495678_003448_8390_9097 233
206 3300049459 Ga0495678_021499 Ga0495678_021499_217_924 233
207 3300049459 Ga0495678_052667 Ga0495678_052667_501_1244 233
208 3300049574 Ga0501038_0306439 Ga0501038_0306439_19_744 233
209 3300049822 Ga0501035_0340226 Ga0501035_0340226_395_1120 233
210 3300049823 Ga0501044_0000213 Ga0501044_0000213_28429_29154 233
211 3300053145 Ga0500586_000090 Ga0500586_000090_201_944 233
212 iso_pu_bacteria 2623620446 2624492114 233
213 iso_pu_bacteria 2852612431 2852613383 233
214 iso_pu_bacteria 2852667396 2852668881 233
215 iso_pu_bacteria 2919456309 2919460315 233
216 iso_pu_bacteria 2919697872 2919698298 233
217 iso_pu_bacteria 2988728565 2988731658 233
218 iso_pu_bacteria 8019775933 8019779273 233
219 iso_pu_bacteria 8056177738 8056177768 233
220 iso_pu_bacteria 2511231021 2511354570 234
221 iso_pu_bacteria 2554235341 2555669763 234
222 iso_pu_bacteria 2597489888 2597864949 234
223 iso_pu_bacteria 2599185160 2599353227 234
224 iso_pu_bacteria 2599185161 2599359564 234
225 iso_pu_bacteria 2599185162 2599364915 234
226 iso_pu_bacteria 2599185163 2599372258 234
227 iso_pu_bacteria 2599185164 2599378335 234
228 iso_pu_bacteria 2599185165 2599384288 234
229 iso_pu_bacteria 2599185166 2599391116 234
230 iso_pu_bacteria 2599185168 2599403301 234
231 iso_pu_bacteria 2599185181 2599460061 234
232 iso_pu_bacteria 2599185182 2599465601 234
233 iso_pu_bacteria 2599185186 2599489082 234
234 iso_pu_bacteria 2599185189 2599509293 234
235 iso_pu_bacteria 2599185248 2599768964 234
236 iso_pu_bacteria 2599185289 2599884759 234
237 iso_pu_bacteria 2599185291 2599896062 234
238 iso_pu_bacteria 2599185305 2599957948 234
239 iso_pu_bacteria 2599185306 2599968657 234
240 iso_pu_bacteria 2599185308 2599979849 234
241 iso_pu_bacteria 2599185313 2600003953 234
242 iso_pu_bacteria 2599185314 2600013661 234
243 iso_pu_bacteria 2599185315 2600015671 234
244 iso_pu_bacteria 2599185321 2600050878 234
245 iso_pu_bacteria 2599185324 2600068959 234
246 iso_pu_bacteria 2599185356 2600212668 234
247 iso_pu_bacteria 2600255296 2601689792 234
248 iso_pu_bacteria 2600255313 2601772836 234
249 iso_pu_bacteria 2643221571 2643874456 234
250 iso_pu_bacteria 2643221650 2644281262 234
251 iso_pu_bacteria 2667528170 2671088755 234
252 iso_pu_bacteria 2667528171 2671095197 234
253 iso_pu_bacteria 2675903420 2677899203 234
254 iso_pu_bacteria 2721755607 2723249685 234
255 iso_pu_bacteria 2738543004 2739201836 234
256 iso_pu_bacteria 2808606361 2808856682 234
257 iso_pu_bacteria 2808606376 2808925785 234
258 iso_pu_bacteria 2808606378 2808936648 234
259 iso_pu_bacteria 2808606380 2808947974 234
260 iso_pu_bacteria 2808606383 2808965059 234
261 iso_pu_bacteria 2808606389 2808999951 234
262 iso_pu_bacteria 2818991464 2819701322 234
263 iso_pu_bacteria 2825651385 2825652074 234
264 iso_pu_bacteria 2842826826 2842829568 234
265 iso_pu_bacteria 2842837860 2842840861 234
266 iso_pu_bacteria 2844665904 2844670876 234
267 iso_pu_bacteria 2860339153 2860345366 234
268 iso_pu_bacteria 2913036834 2913042706 234
269 iso_pu_bacteria 2917070673 2917073581 234
270 iso_pu_bacteria 2919481497 2919487738 234
271 iso_pu_bacteria 2931396565 2931401229 234
272 iso_pu_bacteria 2935353572 2935357407 234
273 iso_pu_bacteria 2946027586 2946031805 234
274 iso_pu_bacteria 2947233263 2947238775 234
275 iso_pu_bacteria 8054347763 8054350915 234
276 iso_pu_bacteria 8056148874 8056153006 234
277 iso_pu_bacteria 8056155041 8056160186 234
278 3300009036 Ga0105244_10198943 Ga0105244_101989431 235
279 3300013104 Ga0157370_10539208 Ga0157370_105392082 235
280 3300025728 Ga0207655_1075971 Ga0207655_10759712 235
281 3300013100 Ga0157373_10002048 Ga0157373_100020486 236
282 3300013100 Ga0157373_10127944 Ga0157373_101279443 236
283 3300013105 Ga0157369_10253589 Ga0157369_102535892 236
284 3300025230 Ga0209563_100445 Ga0209563_10044516 236
285 3300031548 Ga0307408_100006402 Ga0307408_1000064024 236
286 3300032004 Ga0307414_10283828 Ga0307414_102838282 236
287 3300041405 Ga0439438_006657 Ga0439438_006657_1090_1824 236
288 3300042006 Ga0439432_004203 Ga0439432_004203_3157_3891 236
289 3300042009 Ga0439451_001668 Ga0439451_001668_2750_3484 236
290 3300042010 Ga0439452_000081 Ga0439452_000081_31377_32111 236
291 3300042013 Ga0439456_008493 Ga0439456_008493_918_1652 236
292 3300042115 Ga0450911_000010 Ga0450911_000010_112617_113351 236
293 3300042137 Ga0450902_002415 Ga0450902_002415_330_1064 236
294 3300042142 Ga0450905_002805 Ga0450905_002805_542_1276 236
295 3300042145 Ga0450906_000018 Ga0450906_000018_1309_2043 236
296 3300042146 Ga0450907_004447 Ga0450907_004447_361_1095 236
297 3300042531 Ga0450918_004617 Ga0450918_004617_1350_2084 236
298 3300046458 Ga0495591_015783 Ga0495591_015783_277_993 236
299 3300046458 Ga0495591_020316 Ga0495591_020316_1004_1720 236
300 3300046460 Ga0495638_0009504 Ga0495638_0009504_2793_3509 236
301 3300046474 Ga0495605_0015675 Ga0495605_0015675_1980_2696 236
302 3300046491 Ga0495584_0000803 Ga0495584_0000803_10441_11157 236
303 3300046507 Ga0495606_0005455 Ga0495606_0005455_3018_3734 236
304 3300046512 Ga0495610_0010993 Ga0495610_0010993_2051_2767 236
305 3300046515 Ga0495620_0001362 Ga0495620_0001362_3363_4079 236
306 3300046518 Ga0495631_0002367 Ga0495631_0002367_7860_8576 236
307 3300046524 Ga0495648_0002420 Ga0495648_0002420_5796_6512 236
308 3300046524 Ga0495648_0217921 Ga0495648_0217921_186_902 236
309 3300046530 Ga0495654_0007684 Ga0495654_0007684_830_1546 236
310 3300046530 Ga0495654_0010314 Ga0495654_0010314_2309_3025 236
311 3300046542 Ga0495597_0020411 Ga0495597_0020411_592_1308 236
312 3300046557 Ga0495622_0091852 Ga0495622_0091852_482_1198 236
313 3300046558 Ga0495633_0027141 Ga0495633_0027141_37_753 236
314 3300046558 Ga0495633_0097094 Ga0495633_0097094_579_1310 236
315 3300046660 Ga0495625_0003394 Ga0495625_0003394_9722_10438 236
316 3300046665 Ga0495661_0004848 Ga0495661_0004848_5681_6397 236
317 3300046674 Ga0495588_0063249 Ga0495588_0063249_297_1013 236
318 3300046692 Ga0495671_0007779 Ga0495671_0007779_58_774 236
319 3300046694 Ga0495649_0009343 Ga0495649_0009343_4219_4935 236
320 3300046694 Ga0495649_0128517 Ga0495649_0128517_227_943 236
321 3300046794 Ga0495589_0001055 Ga0495589_0001055_6520_7236 236
322 3300047320 Ga0495672_0010097 Ga0495672_0010097_5497_6228 236
323 3300047320 Ga0495672_0049069 Ga0495672_0049069_90_806 236
324 3300047320 Ga0495672_0084473 Ga0495672_0084473_578_1294 236
325 3300047323 Ga0495683_0000205 Ga0495683_0000205_43073_43789 236
326 3300047470 Ga0495681_0003872 Ga0495681_0003872_5351_6067 236
327 3300047472 Ga0495686_0014966 Ga0495686_0014966_2393_3109 236
328 3300048927 Ga0496124_0096684 Ga0496124_0096684_237_971 236
329 3300049459 Ga0495678_041028 Ga0495678_041028_286_1002 236
330 iso_pu_bacteria 2857576091 2857580149 236
331 3300005288 Ga0065714_10005120 Ga0065714_100051202 237
332 3300005288 Ga0065714_10006773 Ga0065714_100067732 237
333 3300005344 Ga0070661_100000310 Ga0070661_10000031034 237
334 3300005564 Ga0070664_100000241 Ga0070664_1000002419 237
335 3300009036 Ga0105244_10000577 Ga0105244_1000057712 237
336 3300009545 Ga0105237_10002377 Ga0105237_1000237719 237
337 3300013308 Ga0157375_10001025 Ga0157375_1000102513 237
338 3300025728 Ga0207655_1000176 Ga0207655_100017611 237
339 3300025728 Ga0207655_1000203 Ga0207655_100020370 237
340 3300025914 Ga0207671_10002355 Ga0207671_1000235515 237
341 3300025920 Ga0207649_10000289 Ga0207649_1000028910 237
342 3300025945 Ga0207679_10000037 Ga0207679_1000003734 237
343 3300042115 Ga0450911_002974 Ga0450911_002974_31_744 237
344 3300046452 Ga0495617_004975 Ga0495617_004975_1526_2239 237
345 3300046452 Ga0495617_006287 Ga0495617_006287_156_869 237
346 3300046453 Ga0495627_001078 Ga0495627_001078_1394_2107 237
347 3300046453 Ga0495627_001437 Ga0495627_001437_13175_13888 237
348 3300046457 Ga0495590_0000306 Ga0495590_0000306_18191_18910 237
349 3300046457 Ga0495590_0000625 Ga0495590_0000625_190_903 237
350 3300046458 Ga0495591_000005 Ga0495591_000005_299759_300472 237
351 3300046458 Ga0495591_013039 Ga0495591_013039_64_777 237
352 3300046458 Ga0495591_063588 Ga0495591_063588_61_774 237
353 3300046460 Ga0495638_0004055 Ga0495638_0004055_7090_7809 237
354 3300046471 Ga0495650_0001378 Ga0495650_0001378_4869_5588 237
355 3300046474 Ga0495605_0003287 Ga0495605_0003287_6623_7336 237
356 3300046474 Ga0495605_0014030 Ga0495605_0014030_761_1474 237
357 3300046475 Ga0495639_0000002 Ga0495639_0000002_165203_165916 237
358 3300046491 Ga0495584_0010387 Ga0495584_0010387_1124_1837 237
359 3300046491 Ga0495584_0034865 Ga0495584_0034865_864_1577 237
360 3300046492 Ga0495585_0083494 Ga0495585_0083494_213_926 237
361 3300046492 Ga0495585_0243799 Ga0495585_0243799_47_760 237
362 3300046499 Ga0495594_0002278 Ga0495594_0002278_7264_7977 237
363 3300046500 Ga0495596_0000010 Ga0495596_0000010_51201_51914 237
364 3300046501 Ga0495607_0000609 Ga0495607_0000609_22556_23275 237
365 3300046501 Ga0495607_0024407 Ga0495607_0024407_208_921 237
366 3300046501 Ga0495607_0066186 Ga0495607_0066186_197_910 237
367 3300046507 Ga0495606_0007257 Ga0495606_0007257_1653_2366 237
368 3300046512 Ga0495610_0005796 Ga0495610_0005796_5424_6137 237
369 3300046512 Ga0495610_0034936 Ga0495610_0034936_674_1387 237
370 3300046513 Ga0495616_0017457 Ga0495616_0017457_1547_2260 237
371 3300046513 Ga0495616_0027704 Ga0495616_0027704_69_782 237
372 3300046515 Ga0495620_0005104 Ga0495620_0005104_178_891 237
373 3300046515 Ga0495620_0012888 Ga0495620_0012888_2559_3272 237
374 3300046518 Ga0495631_0000391 Ga0495631_0000391_837_1550 237
375 3300046518 Ga0495631_0007649 Ga0495631_0007649_3771_4484 237
376 3300046519 Ga0495632_0039973 Ga0495632_0039973_415_1128 237
377 3300046520 Ga0495637_0000380 Ga0495637_0000380_27680_28393 237
378 3300046520 Ga0495637_0002114 Ga0495637_0002114_6117_6830 237
379 3300046520 Ga0495637_0050825 Ga0495637_0050825_837_1550 237
380 3300046522 Ga0495643_0163920 Ga0495643_0163920_343_1056 237
381 3300046522 Ga0495643_0208945 Ga0495643_0208945_113_826 237
382 3300046523 Ga0495644_0000104 Ga0495644_0000104_26684_27397 237
383 3300046524 Ga0495648_0008944 Ga0495648_0008944_4111_4824 237
384 3300046530 Ga0495654_0000290 Ga0495654_0000290_40681_41394 237
385 3300046530 Ga0495654_0014175 Ga0495654_0014175_2890_3603 237
386 3300046530 Ga0495654_0059022 Ga0495654_0059022_102_815 237
387 3300046542 Ga0495597_0039901 Ga0495597_0039901_1262_1975 237
388 3300046542 Ga0495597_0125460 Ga0495597_0125460_340_1053 237
389 3300046557 Ga0495622_0000493 Ga0495622_0000493_9047_9760 237
390 3300046558 Ga0495633_0009586 Ga0495633_0009586_3073_3786 237
391 3300046615 Ga0495656_0195093 Ga0495656_0195093_250_963 237
392 3300046616 Ga0495668_0000238 Ga0495668_0000238_33544_34257 237
393 3300046660 Ga0495625_0003843 Ga0495625_0003843_3511_4224 237
394 3300046660 Ga0495625_0019128 Ga0495625_0019128_2975_3688 237
395 3300046665 Ga0495661_0009909 Ga0495661_0009909_3314_4027 237
396 3300046665 Ga0495661_0019783 Ga0495661_0019783_2902_3615 237
397 3300046665 Ga0495661_0031980 Ga0495661_0031980_1506_2219 237
398 3300046665 Ga0495661_0035455 Ga0495661_0035455_772_1485 237
399 3300046691 Ga0495670_0033333 Ga0495670_0033333_1556_2269 237
400 3300046691 Ga0495670_0291568 Ga0495670_0291568_148_861 237
401 3300046692 Ga0495671_0043396 Ga0495671_0043396_48_761 237
402 3300046694 Ga0495649_0001155 Ga0495649_0001155_257_970 237
403 3300046694 Ga0495649_0010331 Ga0495649_0010331_3177_3890 237
404 3300046694 Ga0495649_0040520 Ga0495649_0040520_1211_1924 237
405 3300046794 Ga0495589_0013111 Ga0495589_0013111_132_845 237
406 3300046794 Ga0495589_0013351 Ga0495589_0013351_2954_3667 237
407 3300046794 Ga0495589_0015797 Ga0495589_0015797_23_736 237
408 3300046794 Ga0495589_0029515 Ga0495589_0029515_373_1086 237
409 3300046810 Ga0495660_0040077 Ga0495660_0040077_1731_2444 237
410 3300047315 Ga0495581_0008250 Ga0495581_0008250_2683_3396 237
411 3300047320 Ga0495672_0004293 Ga0495672_0004293_9228_9941 237
412 3300047323 Ga0495683_0000710 Ga0495683_0000710_14273_14986 237
413 3300047323 Ga0495683_0005170 Ga0495683_0005170_4937_5650 237
414 3300047323 Ga0495683_0009387 Ga0495683_0009387_2266_2979 237
415 3300047470 Ga0495681_0000529 Ga0495681_0000529_9668_10387 237
416 3300047470 Ga0495681_0000547 Ga0495681_0000547_13771_14484 237
417 3300047470 Ga0495681_0001683 Ga0495681_0001683_11440_12153 237
418 3300047470 Ga0495681_0015491 Ga0495681_0015491_780_1493 237
419 3300047470 Ga0495681_0049429 Ga0495681_0049429_597_1310 237
420 3300047472 Ga0495686_0003648 Ga0495686_0003648_7126_7839 237
421 3300047472 Ga0495686_0023337 Ga0495686_0023337_2245_2958 237
422 3300048091 Ga0495626_0000277 Ga0495626_0000277_26376_27089 237
423 3300048091 Ga0495626_0008498 Ga0495626_0008498_29_742 237
424 3300048924 Ga0496121_0043275 Ga0496121_0043275_295_1008 237
425 3300048927 Ga0496124_0066334 Ga0496124_0066334_882_1595 237
426 3300048928 Ga0496125_0001073 Ga0496125_0001073_10215_10928 237
427 3300049459 Ga0495678_082613 Ga0495678_082613_181_894 237
428 3300049460 Ga0495682_0000753 Ga0495682_0000753_3645_4364 237
429 3300049460 Ga0495682_0139634 Ga0495682_0139634_45_758 237
430 3300053722 Ga0500649_059761 Ga0500649_059761_214_960 237
431 2162886007 SwRhRL2b_contig_2776230 SwRhRL2b_0217.00002110 238
432 3300002737 JGI25162J39368_1000004 JGI25162J39368_1000004357 238
433 3300002738 JGI25154J39366_1008120 JGI25154J39366_10081201 238
434 3300002771 JGI25163J39215_1000104 JGI25163J39215_100010423 238
435 3300002772 JGI25164J39214_1000026 JGI25164J39214_100002625 238
436 3300003214 JGI25165J46597_1000011 JGI25165J46597_1000011357 238
437 3300003751 Ga0055538_1000097 Ga0055538_100009779 238
438 3300003752 Ga0055539_1000143 Ga0055539_100014379 238
439 3300003756 Ga0055533_1000148 Ga0055533_100014879 238
440 3300003758 Ga0055532_1000135 Ga0055532_100013580 238
441 3300003759 Ga0055525_1000194 Ga0055525_100019479 238
442 3300003761 Ga0055535_1019526 Ga0055535_10195261 238
443 3300003841 Ga0055541_1000097 Ga0055541_100009779 238
444 3300005288 Ga0065714_10003142 Ga0065714_1000314212 238
445 3300005289 Ga0065704_10070510 Ga0065704_100705109 238
446 3300006058 Ga0075432_10000614 Ga0075432_1000061413 238
447 3300006058 Ga0075432_10044520 Ga0075432_100445202 238
448 3300011119 Ga0105246_10000723 Ga0105246_100007238 238
449 3300013102 Ga0157371_10002236 Ga0157371_100022362 238
450 3300013102 Ga0157371_10002815 Ga0157371_1000281514 238
451 3300013104 Ga0157370_10041007 Ga0157370_100410076 238
452 3300014497 Ga0182008_10001789 Ga0182008_1000178911 238
453 3300015261 Ga0182006_1070967 Ga0182006_10709672 238
454 3300025206 Ga0209435_100808 Ga0209435_1008085 238
455 3300025207 Ga0209760_100096 Ga0209760_10009633 238
456 3300025224 Ga0209784_100017 Ga0209784_1000173 238
457 3300025225 Ga0209566_100014 Ga0209566_1000143 238
458 3300025226 Ga0209674_100028 Ga0209674_1000283 238
459 3300025229 Ga0209147_100105 Ga0209147_1001053 238
460 3300025230 Ga0209563_100032 Ga0209563_1000323 238
461 3300025231 Ga0207427_100003 Ga0207427_100003355 238
462 3300025233 Ga0209437_100002 Ga0209437_100002658 238
463 3300025242 Ga0209258_100558 Ga0209258_1005583 238
464 3300025246 Ga0209646_1000704 Ga0209646_100070411 238
465 3300025253 Ga0209677_100018 Ga0209677_1000183 238
466 3300025256 Ga0209759_1003602 Ga0209759_10036026 238
467 3300025256 Ga0209759_1011748 Ga0209759_10117482 238
468 3300025261 Ga0209233_1000004 Ga0209233_1000004767 238
469 3300025728 Ga0207655_1064462 Ga0207655_10644622 238
470 3300027907 Ga0207428_10001873 Ga0207428_1000187322 238
471 3300027907 Ga0207428_10063907 Ga0207428_100639072 238
472 3300041405 Ga0439438_004671 Ga0439438_004671_922_1638 238
473 3300041405 Ga0439438_008323 Ga0439438_008323_1566_2282 238
474 3300041405 Ga0439438_012209 Ga0439438_012209_1469_2185 238
475 3300041407 Ga0439447_015544 Ga0439447_015544_537_1253 238
476 3300041407 Ga0439447_034375 Ga0439447_034375_403_1119 238
477 3300041411 Ga0439466_0000188 Ga0439466_0000188_13819_14535 238
478 3300041411 Ga0439466_0011882 Ga0439466_0011882_1030_1746 238
479 3300041411 Ga0439466_0067657 Ga0439466_0067657_297_1013 238
480 3300041413 Ga0439465_0003854 Ga0439465_0003854_1397_2113 238
481 3300042006 Ga0439432_010426 Ga0439432_010426_1470_2186 238
482 3300042009 Ga0439451_000279 Ga0439451_000279_4367_5083 238
483 3300042010 Ga0439452_000178 Ga0439452_000178_25163_25879 238
484 3300042010 Ga0439452_010807 Ga0439452_010807_456_1172 238
485 3300042013 Ga0439456_002793 Ga0439456_002793_2669_3385 238
486 3300042013 Ga0439456_010915 Ga0439456_010915_1000_1716 238
487 3300042016 Ga0439463_063938 Ga0439463_063938_59_775 238
488 3300042115 Ga0450911_001529 Ga0450911_001529_2373_3089 238
489 3300042115 Ga0450911_001687 Ga0450911_001687_923_1639 238
490 3300042121 Ga0450919_001725 Ga0450919_001725_570_1286 238
491 3300042124 Ga0450922_002338 Ga0450922_002338_610_1326 238
492 3300042127 Ga0450890_000727 Ga0450890_000727_1679_2395 238
493 3300042137 Ga0450902_004784 Ga0450902_004784_991_1785 238
494 3300042138 Ga0450903_003961 Ga0450903_003961_359_1075 238
495 3300042145 Ga0450906_007276 Ga0450906_007276_660_1376 238
496 3300042147 Ga0450910_004813 Ga0450910_004813_1066_1782 238
497 3300042156 Ga0439446_0006844 Ga0439446_0006844_637_1353 238
498 3300042184 Ga0450908_004299 Ga0450908_004299_1668_2384 238
499 3300042185 Ga0450909_000509 Ga0450909_000509_3074_3790 238
500 3300042435 Ga0439434_0047280 Ga0439434_0047280_293_1009 238
501 3300042439 Ga0439464_0050877 Ga0439464_0050877_132_848 238
502 3300042461 Ga0439460_0014693 Ga0439460_0014693_1000_1716 238
503 3300042532 Ga0450893_0013891 Ga0450893_0013891_195_911 238
504 3300042993 Ga0439440_0000370 Ga0439440_0000370_5009_5725 238
505 3300042993 Ga0439440_0000967 Ga0439440_0000967_897_1613 238
506 3300046452 Ga0495617_000501 Ga0495617_000501_8997_9713 238
507 3300046455 Ga0495603_0000256 Ga0495603_0000256_22143_22859 238
508 3300046457 Ga0495590_0001098 Ga0495590_0001098_4624_5340 238
509 3300046460 Ga0495638_0003727 Ga0495638_0003727_11118_11834 238
510 3300046471 Ga0495650_0001690 Ga0495650_0001690_8967_9683 238
511 3300046471 Ga0495650_0085284 Ga0495650_0085284_465_1181 238
512 3300046471 Ga0495650_0088536 Ga0495650_0088536_307_1023 238
513 3300046474 Ga0495605_0001405 Ga0495605_0001405_6116_6832 238
514 3300046474 Ga0495605_0002604 Ga0495605_0002604_10329_11045 238
515 3300046474 Ga0495605_0032123 Ga0495605_0032123_293_1009 238
516 3300046474 Ga0495605_0222000 Ga0495605_0222000_60_776 238
517 3300046491 Ga0495584_0000532 Ga0495584_0000532_15490_16206 238
518 3300046491 Ga0495584_0091905 Ga0495584_0091905_542_1258 238
519 3300046492 Ga0495585_0001439 Ga0495585_0001439_6810_7526 238
520 3300046492 Ga0495585_0147400 Ga0495585_0147400_297_1013 238
521 3300046501 Ga0495607_0000601 Ga0495607_0000601_6172_6888 238
522 3300046501 Ga0495607_0001779 Ga0495607_0001779_9001_9717 238
523 3300046501 Ga0495607_0006011 Ga0495607_0006011_472_1188 238
524 3300046501 Ga0495607_0046902 Ga0495607_0046902_1436_2152 238
525 3300046507 Ga0495606_0006296 Ga0495606_0006296_666_1382 238
526 3300046512 Ga0495610_0054817 Ga0495610_0054817_446_1162 238
527 3300046515 Ga0495620_0009928 Ga0495620_0009928_3655_4371 238
528 3300046516 Ga0495628_0305698 Ga0495628_0305698_440_1156 238
529 3300046517 Ga0495630_0311838 Ga0495630_0311838_467_1183 238
530 3300046519 Ga0495632_0000889 Ga0495632_0000889_15480_16196 238
531 3300046519 Ga0495632_0025029 Ga0495632_0025029_577_1293 238
532 3300046519 Ga0495632_0167475 Ga0495632_0167475_259_975 238
533 3300046520 Ga0495637_0010042 Ga0495637_0010042_1956_2672 238
534 3300046520 Ga0495637_0068727 Ga0495637_0068727_330_1046 238
535 3300046523 Ga0495644_0010411 Ga0495644_0010411_352_1068 238
536 3300046524 Ga0495648_0000042 Ga0495648_0000042_44955_45671 238
537 3300046524 Ga0495648_0019744 Ga0495648_0019744_1496_2212 238
538 3300046524 Ga0495648_0088345 Ga0495648_0088345_295_1011 238
539 3300046526 Ga0495666_0003780 Ga0495666_0003780_1912_2628 238
540 3300046528 Ga0495642_0000620 Ga0495642_0000620_15437_16153 238
541 3300046529 Ga0495652_0099313 Ga0495652_0099313_711_1427 238
542 3300046530 Ga0495654_0010634 Ga0495654_0010634_1012_1728 238
543 3300046530 Ga0495654_0017602 Ga0495654_0017602_912_1628 238
544 3300046536 Ga0495587_0003714 Ga0495587_0003714_270_986 238
545 3300046538 Ga0495609_0001559 Ga0495609_0001559_5448_6164 238
546 3300046538 Ga0495609_0066248 Ga0495609_0066248_616_1332 238
547 3300046538 Ga0495609_0141094 Ga0495609_0141094_38_754 238
548 3300046542 Ga0495597_0001466 Ga0495597_0001466_5352_6068 238
549 3300046557 Ga0495622_0170514 Ga0495622_0170514_137_853 238
550 3300046642 Ga0495634_0000347 Ga0495634_0000347_40505_41311 238
551 3300046648 Ga0495611_0002396 Ga0495611_0002396_1342_2058 238
552 3300046660 Ga0495625_0068414 Ga0495625_0068414_692_1408 238
553 3300046663 Ga0495635_0000210 Ga0495635_0000210_23813_24529 238
554 3300046664 Ga0495659_0119214 Ga0495659_0119214_282_998 238
555 3300046665 Ga0495661_0045804 Ga0495661_0045804_904_1620 238
556 3300046675 Ga0495657_0052857 Ga0495657_0052857_112_828 238
557 3300046679 Ga0495623_0002642 Ga0495623_0002642_7064_7780 238
558 3300046680 Ga0495646_0001737 Ga0495646_0001737_10608_11414 238
559 3300046689 Ga0495613_0004016 Ga0495613_0004016_425_1141 238
560 3300046691 Ga0495670_0000131 Ga0495670_0000131_594_1310 238
561 3300046691 Ga0495670_0121024 Ga0495670_0121024_62_778 238
562 3300046692 Ga0495671_0112657 Ga0495671_0112657_70_786 238
563 3300046694 Ga0495649_0000754 Ga0495649_0000754_15489_16205 238
564 3300046694 Ga0495649_0014112 Ga0495649_0014112_349_1065 238
565 3300046694 Ga0495649_0044860 Ga0495649_0044860_504_1220 238
566 3300046794 Ga0495589_0001213 Ga0495589_0001213_4868_5584 238
567 3300046810 Ga0495660_0004261 Ga0495660_0004261_2018_2734 238
568 3300046810 Ga0495660_0096421 Ga0495660_0096421_543_1259 238
569 3300047317 Ga0495604_0012504 Ga0495604_0012504_3043_3759 238
570 3300047317 Ga0495604_0015203 Ga0495604_0015203_5300_6016 238
571 3300047319 Ga0495674_0013674 Ga0495674_0013674_6069_6785 238
572 3300047320 Ga0495672_0004011 Ga0495672_0004011_2581_3297 238
573 3300047320 Ga0495672_0044612 Ga0495672_0044612_984_1700 238
574 3300047322 Ga0495680_0007325 Ga0495680_0007325_628_1344 238
575 3300047322 Ga0495680_0067180 Ga0495680_0067180_506_1222 238
576 3300047322 Ga0495680_0136175 Ga0495680_0136175_323_1039 238
577 3300047322 Ga0495680_0332392 Ga0495680_0332392_226_1011 238
578 3300047443 Ga0495687_003110 Ga0495687_003110_9088_9804 238
579 3300047443 Ga0495687_014060 Ga0495687_014060_1500_2216 238
580 3300047444 Ga0495675_0121090 Ga0495675_0121090_306_1022 238
581 3300047446 Ga0495679_002370 Ga0495679_002370_392_1108 238
582 3300047447 Ga0495685_032565 Ga0495685_032565_814_1530 238
583 3300047469 Ga0495673_0003822 Ga0495673_0003822_6016_6732 238
584 3300047469 Ga0495673_0010167 Ga0495673_0010167_2247_2963 238
585 3300047470 Ga0495681_0016879 Ga0495681_0016879_2518_3234 238
586 3300047470 Ga0495681_0082412 Ga0495681_0082412_256_972 238
587 3300047471 Ga0495684_0005888 Ga0495684_0005888_7594_8310 238
588 3300047673 Ga0495593_0000026 Ga0495593_0000026_38481_39197 238
589 3300047673 Ga0495593_0206577 Ga0495593_0206577_243_959 238
590 3300048088 Ga0495602_0067067 Ga0495602_0067067_2085_2801 238
591 3300048091 Ga0495626_0002281 Ga0495626_0002281_1124_1840 238
592 3300048091 Ga0495626_0004477 Ga0495626_0004477_5700_6416 238
593 3300048905 Ga0496102_0000444 Ga0496102_0000444_40192_40908 238
594 3300048906 Ga0496103_0000290 Ga0496103_0000290_39696_40412 238
595 3300048909 Ga0496106_0580899 Ga0496106_0580899_109_825 238
596 3300048918 Ga0496115_0492492 Ga0496115_0492492_82_798 238
597 3300048919 Ga0496116_0000038 Ga0496116_0000038_33423_34139 238
598 3300048919 Ga0496116_0002015 Ga0496116_0002015_13088_13807 238
599 3300048919 Ga0496116_0088203 Ga0496116_0088203_267_983 238
600 3300048920 Ga0496117_0000475 Ga0496117_0000475_13091_13810 238
601 3300048920 Ga0496117_0001030 Ga0496117_0001030_18253_18969 238
602 3300048920 Ga0496117_0002386 Ga0496117_0002386_17040_17756 238
603 3300048920 Ga0496117_0090489 Ga0496117_0090489_1069_1803 238
604 3300048921 Ga0496118_0000482 Ga0496118_0000482_13155_13874 238
605 3300048921 Ga0496118_0034385 Ga0496118_0034385_2062_2778 238
606 3300048924 Ga0496121_0000377 Ga0496121_0000377_33473_34189 238
607 3300048925 Ga0496122_0004726 Ga0496122_0004726_3887_4603 238
608 3300048925 Ga0496122_0017040 Ga0496122_0017040_315_1034 238
609 3300048926 Ga0496123_0000713 Ga0496123_0000713_20106_20822 238
610 3300048926 Ga0496123_0001027 Ga0496123_0001027_29815_30534 238
611 3300048929 Ga0496126_0083853 Ga0496126_0083853_1932_2648 238
612 3300048929 Ga0496126_0285301 Ga0496126_0285301_315_1031 238
613 3300049459 Ga0495678_000908 Ga0495678_000908_9817_10533 238
614 3300049459 Ga0495678_003302 Ga0495678_003302_608_1324 238
615 3300049459 Ga0495678_038535 Ga0495678_038535_825_1541 238
616 3300049460 Ga0495682_0091186 Ga0495682_0091186_278_994 238
617 3300050489 nmdc:mga03683_179489_c1 nmdc:mga03683_179489_c1_142_858 238
618 3300050491 nmdc:mga00v17_285396_c1 nmdc:mga00v17_285396_c1_108_824 238
619 3300050491 nmdc:mga00v17_66610_c1 nmdc:mga00v17_66610_c1_396_1112 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

85

187

0.88

PF08242

Methyltransf_12

Methyltransferase domain

85

185

0.88

PF13649

Methyltransf_25

Methyltransferase domain

84

182

0.86

PF13847

Methyltransf_31

Methyltransferase domain

79

241

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dcm-assembly1.cif.gz_A crystal structure of methyltransferase rlmg modifying g1835 of 23s rrna in escherichia coli 0.8358 51 238
3dtn-assembly1.cif.gz_B crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.827 18 237
8k5l-assembly2.cif.gz_C structure of trna (cmo5u34)-methyltransferase from fusobacterium nucleatum 0.8266 25 236
3dtn-assembly1.cif.gz_A crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8242 12 237
3dtn-assembly1.cif.gz_B crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.82 18 237
ID Description Score Start End Superfamily
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9048 52 109 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8472 18 237 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8428 40 157 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8384 18 237 3.40.50.150
5bxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8298 52 158 3.40.50.150
ID Description Score Start End GO Terms
AF-B7X0J5-F1-model_v4 Methyltransferase type 11 0.953 1 238 GO:0008168
GO:0032259
AF-B7X0J5-F1-model_v4 Methyltransferase type 11 0.9453 1 238 GO:0008168
GO:0032259
AF-G9ZGR4-F1-model_v4 Methyltransferase domain protein 0.9231 12 238 GO:0008168
GO:0032259
AF-A0A1H3QAJ5-F1-model_v4 tRNA (Cmo5U34)-methyltransferase 0.9198 17 237 GO:0008168
GO:0032259
AF-A0A0C2LUT3-F1-model_v4 deleted 0.9197 11 238

Feature Viewer

pLDDT pTM Quality
87.61 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map