F469811

General Info

Members Datasets Scaffolds Average Seq Length
619 322 1238 117

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10005220|Ga0111539_1000522012
Length 131
Sequence LTVDIHFHIRWILDRLDAVAAQAALAQEHRLEVYRRLVQAGPEGMAAGEIASALGIAPNTLSFHFDRLRHAGLVSVARKGRSLIYAARYETMSNLLGYLTQNCCGGRPELCAPAVCKPTKPARKRQKENVG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
107 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
314 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
315 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
316 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
321 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
322 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 9.85
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 8.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10005220 3300009094 Bacteria 16820
2 JGI24748J21848_1045426 3300002074 Bacteria 566
3 JGI25405J52794_10021659 3300003911 Unclassified 1300
4 Ga0070658_10261343 3300005327 Bacteria 1470
5 Ga0070683_100252476 3300005329 Bacteria 1677
6 Ga0070683_100588421 3300005329 Bacteria 1065
7 Ga0070670_100170974 3300005331 Unclassified 1885
8 Ga0068869_100016829 3300005334 Bacteria 4941
9 Ga0068869_100259500 3300005334 Bacteria 1391
10 Ga0068869_100497304 3300005334 Bacteria 1017
11 Ga0070666_10100945 3300005335 Bacteria 1989
12 Ga0070680_100003110 3300005336 Bacteria 12319
13 Ga0070680_100039541 3300005336 Bacteria 3816
14 Ga0070682_100054580 3300005337 Bacteria 2508
15 Ga0068868_100026636 3300005338 Bacteria 4409
16 Ga0068868_100139434 3300005338 Bacteria 1989
17 Ga0070660_100325169 3300005339 Bacteria 1264
18 Ga0070689_100088494 3300005340 Unclassified 2438
19 Ga0070689_100140747 3300005340 Bacteria 1940
20 Ga0070691_10013180 3300005341 Bacteria 3787
21 Ga0070661_100036009 3300005344 Bacteria 3597
22 Ga0070661_100208919 3300005344 Bacteria 1494
23 Ga0070668_100533374 3300005347 Bacteria 1020
24 Ga0070675_100174542 3300005354 Bacteria 1855
25 Ga0070675_101908870 3300005354 Unclassified 548
26 Ga0070671_100340405 3300005355 Bacteria 1279
27 Ga0070671_100481437 3300005355 Bacteria 1066
28 Ga0070674_100100727 3300005356 Bacteria 2104
29 Ga0070674_100891389 3300005356 Bacteria 774
30 Ga0070673_100596891 3300005364 Bacteria 1007
31 Ga0070688_100051564 3300005365 Bacteria 2567
32 Ga0070667_100137887 3300005367 Bacteria 2134
33 Ga0070709_10570873 3300005434 Bacteria 868
34 Ga0070714_100021302 3300005435 Bacteria 5303
35 Ga0070714_100446726 3300005435 Bacteria 1228
36 Ga0070714_101833277 3300005435 Bacteria 592
37 Ga0070713_100823952 3300005436 Bacteria 890
38 Ga0070710_10027268 3300005437 Bacteria 3044
39 Ga0070711_100011070 3300005439 Bacteria 5597
40 Ga0070705_100000904 3300005440 Bacteria 16573
41 Ga0070700_100347996 3300005441 Unclassified 1098
42 Ga0070694_100984840 3300005444 Bacteria 699
43 Ga0070663_100039645 3300005455 Bacteria 3293
44 Ga0070678_100065354 3300005456 Bacteria 2700
45 Ga0070678_100224002 3300005456 Bacteria 1564
46 Ga0070662_100026506 3300005457 Bacteria 4015
47 Ga0070662_100758876 3300005457 Bacteria 823
48 Ga0070662_101707668 3300005457 Unclassified 544
49 Ga0070681_10050777 3300005458 Bacteria 4138
50 Ga0070681_10071674 3300005458 Unclassified 3430
51 Ga0068867_100225200 3300005459 Unclassified 1513
52 Ga0068867_101989500 3300005459 Bacteria 549
53 Ga0070685_10745808 3300005466 Unclassified 717
54 Ga0070706_100171917 3300005467 Bacteria 2023
55 Ga0070707_100046453 3300005468 Bacteria 4156
56 Ga0070707_100157873 3300005468 Bacteria 2209
57 Ga0070698_100315686 3300005471 Bacteria 1493
58 Ga0070699_100000310 3300005518 Bacteria 47250
59 Ga0070699_100226053 3300005518 Bacteria 1668
60 Ga0070699_101380742 3300005518 Unclassified 646
61 Ga0070679_100581469 3300005530 Bacteria 1063
62 Ga0070684_100096208 3300005535 Bacteria 2639
63 Ga0070684_100756305 3300005535 Bacteria 907
64 Ga0070697_100007493 3300005536 Bacteria 8496
65 Ga0070697_100052563 3300005536 Bacteria 3310
66 Ga0068853_100349222 3300005539 Unclassified 1376
67 Ga0070672_101881883 3300005543 Bacteria 538
68 Ga0070686_100104157 3300005544 Bacteria 1922
69 Ga0070686_100455901 3300005544 Bacteria 984
70 Ga0070695_100000252 3300005545 Bacteria 26824
71 Ga0070695_100000919 3300005545 Bacteria 15860
72 Ga0070696_100000291 3300005546 Bacteria 30308
73 Ga0070696_100840407 3300005546 Bacteria 758
74 Ga0070693_100053361 3300005547 Bacteria 2321
75 Ga0070693_100722369 3300005547 Unclassified 731
76 Ga0070693_100817199 3300005547 Bacteria 692
77 Ga0070665_100064056 3300005548 Bacteria 3686
78 Ga0070665_100289052 3300005548 Bacteria 1642
79 Ga0070665_101000132 3300005548 Bacteria 848
80 Ga0068855_102084395 3300005563 Unclassified 571
81 Ga0070664_100155230 3300005564 Bacteria 2022
82 Ga0070664_100289002 3300005564 Bacteria 1480
83 Ga0068857_100005207 3300005577 Bacteria 11067
84 Ga0070702_100003770 3300005615 Bacteria 6843
85 Ga0070702_100064622 3300005615 Bacteria 2141
86 Ga0068852_101778833 3300005616 Bacteria 639
87 Ga0068859_100005637 3300005617 Bacteria 12763
88 Ga0068859_100812138 3300005617 Bacteria 1022
89 Ga0068864_100310296 3300005618 Bacteria 1479
90 Ga0068864_100362143 3300005618 Bacteria 1371
91 Ga0068864_100425889 3300005618 Bacteria 1265
92 Ga0068864_100492282 3300005618 Bacteria 1178
93 Ga0068861_100066801 3300005719 Bacteria 2773
94 Ga0068851_10078157 3300005834 Bacteria 1724
95 Ga0068863_100241558 3300005841 Bacteria 1743
96 Ga0068863_101029970 3300005841 Bacteria 826
97 Ga0068858_100054706 3300005842 Bacteria 3690
98 Ga0068858_100172955 3300005842 Bacteria 2037
99 Ga0068858_100703132 3300005842 Bacteria 984
100 Ga0068860_100005359 3300005843 Bacteria 13015
101 Ga0068860_100230046 3300005843 Bacteria 1802
102 Ga0068862_100001312 3300005844 Bacteria 23151
103 Ga0068862_100644728 3300005844 Bacteria 1021
104 Ga0081455_10000122 3300005937 Bacteria 89500
105 Ga0081455_10001659 3300005937 Bacteria 26976
106 Ga0081538_10145366 3300005981 Bacteria 1085
107 Ga0081540_1000021 3300005983 Bacteria 161624
108 Ga0070717_10051099 3300006028 Bacteria 3401
109 Ga0070717_10219848 3300006028 Bacteria 1669
110 Ga0070717_10448252 3300006028 Bacteria 1163
111 Ga0070717_10596687 3300006028 Bacteria 1002
112 Ga0075365_10151345 3300006038 Bacteria 1614
113 Ga0075368_10036901 3300006042 Bacteria 1911
114 Ga0075368_10049297 3300006042 Bacteria 1670
115 Ga0075368_10135353 3300006042 Bacteria 1025
116 Ga0075363_100126516 3300006048 Bacteria 1431
117 Ga0075363_100169133 3300006048 Bacteria 1240
118 Ga0075364_10039104 3300006051 Bacteria 3074
119 Ga0075364_10122724 3300006051 Bacteria 1740
120 Ga0075364_10274878 3300006051 Bacteria 1146
121 Ga0070715_10002518 3300006163 Bacteria 5646
122 Ga0070716_100004152 3300006173 Bacteria 6879
123 Ga0070716_100214739 3300006173 Unclassified 1288
124 Ga0070712_100087703 3300006175 Bacteria 2271
125 Ga0070712_100100241 3300006175 Bacteria 2139
126 Ga0075362_10043387 3300006177 Bacteria 1991
127 Ga0075367_10051581 3300006178 Bacteria 2432
128 Ga0075367_10057712 3300006178 Bacteria 2308
129 Ga0075367_10101171 3300006178 Bacteria 1762
130 Ga0075367_10557716 3300006178 Bacteria 727
131 Ga0075369_10013588 3300006186 Bacteria 3236
132 Ga0075427_10001142 3300006194 Bacteria 3360
133 Ga0097621_100006628 3300006237 Bacteria 8228
134 Ga0075370_10130632 3300006353 Bacteria 1465
135 Ga0075370_10841458 3300006353 Bacteria 560
136 Ga0068871_100006454 3300006358 Bacteria 8299
137 Ga0068871_100174634 3300006358 Bacteria 1844
138 Ga0075428_100090413 3300006844 Bacteria 3339
139 Ga0075428_100245493 3300006844 Bacteria 1931
140 Ga0075428_100633094 3300006844 Bacteria 1141
141 Ga0075428_102377531 3300006844 Unclassified 544
142 Ga0075430_100009755 3300006846 Bacteria 8118
143 Ga0075430_100091847 3300006846 Bacteria 2538
144 Ga0075430_100671888 3300006846 Bacteria 854
145 Ga0075430_100821682 3300006846 Bacteria 766
146 Ga0075431_100081591 3300006847 Bacteria 3339
147 Ga0075431_100410154 3300006847 Bacteria 1355
148 Ga0075433_10004805 3300006852 Bacteria 10546
149 Ga0075433_10042115 3300006852 Bacteria 3960
150 Ga0075433_10181668 3300006852 Bacteria 1872
151 Ga0075434_100001712 3300006871 Bacteria 18787
152 Ga0075434_100001952 3300006871 Bacteria 17878
153 Ga0075434_100130823 3300006871 Unclassified 2528
154 Ga0075434_100141659 3300006871 Bacteria 2425
155 Ga0075434_100438428 3300006871 Bacteria 1327
156 Ga0075434_100461826 3300006871 Bacteria 1291
157 Ga0075429_100658896 3300006880 Bacteria 917
158 Ga0068865_100092177 3300006881 Bacteria 2201
159 Ga0068865_100107686 3300006881 Bacteria 2050
160 Ga0068865_100717110 3300006881 Bacteria 856
161 Ga0075436_100002694 3300006914 Bacteria 12222
162 Ga0075436_100094393 3300006914 Bacteria 2080
163 Ga0075436_100098122 3300006914 Bacteria 2039
164 Ga0097620_100005637 3300006931 Bacteria 12763
165 Ga0097620_100812177 3300006931 Bacteria 1022
166 Ga0097620_101688536 3300006931 Bacteria 699
167 Ga0075435_100010234 3300007076 Bacteria 6852
168 Ga0075435_100020399 3300007076 Bacteria 5078
169 Ga0075435_100030393 3300007076 Bacteria 4247
170 Ga0075435_100037053 3300007076 Bacteria 3881
171 Ga0075435_100087654 3300007076 Bacteria 2565
172 Ga0075435_100139195 3300007076 Unclassified 2035
173 Ga0075435_101513246 3300007076 Unclassified 588
174 Ga0105251_10084715 3300009011 Bacteria 1462
175 Ga0105250_10062415 3300009092 Bacteria 1499
176 Ga0111539_10017284 3300009094 Bacteria 8926
177 Ga0111539_10024554 3300009094 Bacteria 7393
178 Ga0111539_10049793 3300009094 Bacteria 4993
179 Ga0111539_10998349 3300009094 Bacteria 973
180 Ga0111539_11496409 3300009094 Bacteria 783
181 Ga0111539_11952434 3300009094 Bacteria 681
182 Ga0105245_10284713 3300009098 Bacteria 1617
183 Ga0105245_10665969 3300009098 Bacteria 1072
184 Ga0105247_10108248 3300009101 Bacteria 1785
185 Ga0105247_10110121 3300009101 Bacteria 1771
186 Ga0105247_11476941 3300009101 Bacteria 553
187 Ga0114129_10011621 3300009147 Bacteria 12534
188 Ga0114129_10028481 3300009147 Bacteria 7915
189 Ga0114129_10106962 3300009147 Bacteria 3864
190 Ga0114129_10465334 3300009147 Bacteria 1657
191 Ga0114129_10505011 3300009147 Bacteria 1579
192 Ga0114129_11662493 3300009147 Bacteria 780
193 Ga0105243_10401694 3300009148 Bacteria 1273
194 Ga0105243_10869637 3300009148 Unclassified 894
195 Ga0105241_10135986 3300009174 Bacteria 1996
196 Ga0105241_10633691 3300009174 Bacteria 969
197 Ga0105241_12404700 3300009174 Bacteria 526
198 Ga0105242_10182118 3300009176 Bacteria 1854
199 Ga0105242_10354469 3300009176 Bacteria 1356
200 Ga0105248_10102303 3300009177 Bacteria 3229
201 Ga0105248_10408963 3300009177 Unclassified 1528
202 Ga0105248_11682010 3300009177 Bacteria 719
203 Ga0105237_10275885 3300009545 Unclassified 1684
204 Ga0105238_10154592 3300009551 Bacteria 2269
205 Ga0105249_10131172 3300009553 Bacteria 2393
206 Ga0105239_10083116 3300010375 Bacteria 3526
207 Ga0105239_10431264 3300010375 Bacteria 1494
208 Ga0105246_10019389 3300011119 Bacteria 4345
209 Ga0105246_10176382 3300011119 Bacteria 1641
210 Ga0105246_10287386 3300011119 Bacteria 1322
211 Ga0105246_11722668 3300011119 Bacteria 596
212 Ga0157339_1005452 3300012505 Bacteria 1004
213 Ga0157338_1026534 3300012515 Bacteria 712
214 Ga0157369_12060170 3300013105 Bacteria 579
215 Ga0157374_10255606 3300013296 Unclassified 1724
216 Ga0157374_10312167 3300013296 Bacteria 1557
217 Ga0157374_10605090 3300013296 Bacteria 1106
218 Ga0157374_11343801 3300013296 Bacteria 737
219 Ga0157378_10019818 3300013297 Bacteria 5914
220 Ga0157378_10104571 3300013297 Bacteria 2588
221 Ga0157378_12191581 3300013297 Unclassified 604
222 Ga0163162_10019721 3300013306 Bacteria 6621
223 Ga0163162_10632203 3300013306 Bacteria 1195
224 Ga0163162_11743529 3300013306 Unclassified 711
225 Ga0157372_11157436 3300013307 Bacteria 894
226 Ga0157375_10166503 3300013308 Bacteria 2349
227 Ga0157375_10190306 3300013308 Bacteria 2206
228 Ga0157375_11020929 3300013308 Bacteria 966
229 Ga0157375_11061617 3300013308 Bacteria 947
230 Ga0163163_10014823 3300014325 Bacteria 7178
231 Ga0163163_10027628 3300014325 Bacteria 5438
232 Ga0163163_10129576 3300014325 Bacteria 2562
233 Ga0163163_10181214 3300014325 Bacteria 2154
234 Ga0163163_11602357 3300014325 Bacteria 712
235 Ga0157377_10080211 3300014745 Bacteria 1906
236 Ga0157377_11227974 3300014745 Bacteria 582
237 Ga0157379_10100154 3300014968 Bacteria 2601
238 Ga0157379_10156614 3300014968 Bacteria 2055
239 Ga0157379_10302692 3300014968 Unclassified 1457
240 Ga0157376_10161001 3300014969 Bacteria 2034
241 Ga0157376_11677866 3300014969 Bacteria 670
242 Ga0157376_12696939 3300014969 Bacteria 537
243 Ga0182005_1042936 3300015265 Unclassified 1229
244 Ga0163161_10057061 3300017792 Bacteria 2837
245 Ga0213875_10000045 3300021388 Bacteria 150013
246 Ga0207713_1107827 3300025735 Bacteria 951
247 Ga0207653_10003583 3300025885 Bacteria 4889
248 Ga0207692_10001856 3300025898 Bacteria 8035
249 Ga0207710_10032194 3300025900 Bacteria 2297
250 Ga0207688_10072569 3300025901 Bacteria 1955
251 Ga0207685_10000848 3300025905 Bacteria 5735
252 Ga0207699_10054464 3300025906 Bacteria 2376
253 Ga0207684_10034479 3300025910 Bacteria 4300
254 Ga0207654_10095853 3300025911 Unclassified 1818
255 Ga0207707_10317340 3300025912 Bacteria 1346
256 Ga0207707_10339551 3300025912 Bacteria 1295
257 Ga0207671_10164494 3300025914 Bacteria 1719
258 Ga0207693_10006806 3300025915 Bacteria 9440
259 Ga0207693_10012093 3300025915 Bacteria 6978
260 Ga0207663_10489260 3300025916 Bacteria 954
261 Ga0207660_10003462 3300025917 Bacteria 10286
262 Ga0207662_10227568 3300025918 Bacteria 1216
263 Ga0207657_10293814 3300025919 Bacteria 1288
264 Ga0207649_10593274 3300025920 Bacteria 851
265 Ga0207646_10108998 3300025922 Bacteria 2485
266 Ga0207646_10198228 3300025922 Bacteria 1813
267 Ga0207650_10119823 3300025925 Unclassified 2047
268 Ga0207659_10530552 3300025926 Bacteria 999
269 Ga0207687_10028259 3300025927 Bacteria 3768
270 Ga0207700_10002289 3300025928 Bacteria 10987
271 Ga0207700_11401690 3300025928 Unclassified 621
272 Ga0207664_10405085 3300025929 Bacteria 1214
273 Ga0207644_10023350 3300025931 Bacteria 4235
274 Ga0207644_10971711 3300025931 Bacteria 712
275 Ga0207690_11736413 3300025932 Bacteria 521
276 Ga0207706_10059761 3300025933 Bacteria 3357
277 Ga0207706_10357250 3300025933 Bacteria 1270
278 Ga0207686_10846793 3300025934 Unclassified 735
279 Ga0207686_10862480 3300025934 Bacteria 729
280 Ga0207670_10124328 3300025936 Bacteria 1880
281 Ga0207669_10720865 3300025937 Unclassified 821
282 Ga0207704_10018360 3300025938 Bacteria 3649
283 Ga0207704_10128783 3300025938 Bacteria 1748
284 Ga0207665_10000223 3300025939 Bacteria 38647
285 Ga0207665_10174321 3300025939 Unclassified 1555
286 Ga0207691_11013377 3300025940 Unclassified 693
287 Ga0207711_10103574 3300025941 Bacteria 2520
288 Ga0207711_10558879 3300025941 Bacteria 1067
289 Ga0207711_11062021 3300025941 Bacteria 750
290 Ga0207711_11487980 3300025941 Bacteria 620
291 Ga0207689_10026331 3300025942 Bacteria 4869
292 Ga0207689_10081901 3300025942 Bacteria 2653
293 Ga0207661_10331763 3300025944 Bacteria 1369
294 Ga0207679_10162348 3300025945 Bacteria 1830
295 Ga0207679_10182287 3300025945 Bacteria 1738
296 Ga0207679_10221172 3300025945 Bacteria 1593
297 Ga0207651_10165698 3300025960 Bacteria 1737
298 Ga0207651_11914331 3300025960 Bacteria 533
299 Ga0207712_10010862 3300025961 Bacteria 5793
300 Ga0207712_10162946 3300025961 Bacteria 1735
301 Ga0207668_10218089 3300025972 Bacteria 1530
302 Ga0207640_10460117 3300025981 Bacteria 1050
303 Ga0207658_10146686 3300025986 Bacteria 1917
304 Ga0207658_12006603 3300025986 Bacteria 526
305 Ga0207677_10091784 3300026023 Bacteria 2210
306 Ga0207677_10781873 3300026023 Bacteria 853
307 Ga0207703_10124111 3300026035 Bacteria 2220
308 Ga0207703_10362564 3300026035 Bacteria 1337
309 Ga0207703_10825503 3300026035 Unclassified 886
310 Ga0207703_11076705 3300026035 Bacteria 772
311 Ga0207678_10019073 3300026067 Bacteria 6021
312 Ga0207678_10034006 3300026067 Bacteria 4440
313 Ga0207678_10077002 3300026067 Bacteria 2857
314 Ga0207708_10014408 3300026075 Bacteria 5917
315 Ga0207708_10058997 3300026075 Bacteria 2928
316 Ga0207702_10947744 3300026078 Bacteria 853
317 Ga0207641_10160495 3300026088 Bacteria 2044
318 Ga0207641_11115898 3300026088 Unclassified 787
319 Ga0207648_11149632 3300026089 Bacteria 729
320 Ga0207676_10108602 3300026095 Unclassified 2316
321 Ga0207676_10286414 3300026095 Bacteria 1498
322 Ga0207676_10771605 3300026095 Unclassified 936
323 Ga0207674_10013673 3300026116 Bacteria 8991
324 Ga0207675_100075711 3300026118 Bacteria 3151
325 Ga0207675_100399438 3300026118 Unclassified 1354
326 Ga0207683_10015344 3300026121 Bacteria 6524
327 Ga0207698_11573606 3300026142 Bacteria 673
328 Ga0209813_10029887 3300027866 Bacteria 1598
329 Ga0209813_10156053 3300027866 Bacteria 821
330 Ga0207428_10129637 3300027907 Bacteria 1931
331 Ga0207428_10363993 3300027907 Bacteria 1063
332 Ga0207428_10364806 3300027907 Bacteria 1061
333 Ga0268266_10008517 3300028379 Bacteria 9112
334 Ga0268266_10208949 3300028379 Bacteria 1790
335 Ga0268265_10001160 3300028380 Bacteria 23168
336 Ga0268264_10168940 3300028381 Bacteria 1976
337 Ga0268264_10183041 3300028381 Bacteria 1904
338 Ga0265330_10088352 3300031235 Bacteria 1332
339 Ga0265325_10008767 3300031241 Bacteria 5947
340 Ga0265325_10009859 3300031241 Bacteria 5561
341 Ga0265329_10293222 3300031242 Bacteria 549
342 Ga0265340_10008636 3300031247 Bacteria 5491
343 Ga0265340_10045015 3300031247 Bacteria 2157
344 Ga0265340_10081243 3300031247 Bacteria 1526
345 Ga0265339_10002697 3300031249 Bacteria 12627
346 Ga0265339_10195971 3300031249 Bacteria 999
347 Ga0265331_10081271 3300031250 Bacteria 1505
348 Ga0265316_10095708 3300031344 Bacteria 2261
349 Ga0265313_10000216 3300031595 Bacteria 62003
350 Ga0265313_10003192 3300031595 Bacteria 13508
351 Ga0265313_10005467 3300031595 Bacteria 9335
352 Ga0265313_10022682 3300031595 Bacteria 3399
353 Ga0265313_10287950 3300031595 Bacteria 662
354 Ga0265314_10043915 3300031711 Bacteria 3172
355 Ga0265342_10010206 3300031712 Bacteria 6538
356 Ga0265342_10143862 3300031712 Bacteria 1328
357 Ga0265342_10344224 3300031712 Bacteria 778
358 Ga0373948_0012134 3300034817 Bacteria 1535
359 Ga0373948_0013076 3300034817 Bacteria 1493
360 Ga0373950_0004250 3300034818 Bacteria 2089
361 Ga0373958_0057737 3300034819 Unclassified 834
362 Ga0373959_0117587 3300034820 Bacteria 647
363 Ga0373938_0000729 3300034957 Bacteria 5316
364 Ga0373938_0002329 3300034957 Bacteria 3059
365 Ga0373926_0038634 3300035083 Bacteria 1701
366 Ga0373928_0075786 3300035084 Bacteria 840
367 Ga0373940_0021180 3300035088 Bacteria 1659
368 Ga0373944_0207072 3300035089 Unclassified 712
369 Ga0373951_0031009 3300035091 Bacteria 1260
370 Ga0373951_0159749 3300035091 Unclassified 637
371 Ga0373952_0003927 3300035092 Bacteria 2691
372 Ga0373952_0066200 3300035092 Bacteria 894
373 Ga0373932_0002557 3300035112 Bacteria 4556
374 Ga0373932_0016482 3300035112 Bacteria 1886
375 Ga0373932_0237933 3300035112 Bacteria 660
376 Ga0373936_0128117 3300035113 Bacteria 1089
377 Ga0373936_0281463 3300035113 Bacteria 748
378 Ga0373939_0030497 3300035114 Bacteria 1551
379 Ga0373939_0110509 3300035114 Bacteria 956
380 Ga0373941_0027048 3300035115 Bacteria 1671
381 Ga0373941_0078159 3300035115 Bacteria 1112
382 Ga0373945_0208133 3300035116 Unclassified 814
383 Ga0373953_0085447 3300035117 Bacteria 1316
384 Ga0373954_0253232 3300035118 Bacteria 867
385 Ga0373960_0033193 3300035121 Bacteria 1454
386 Ga0373960_0050156 3300035121 Bacteria 1236
387 Ga0373943_0149338 3300035170 Bacteria 1265
388 Ga0373942_0058892 3300035207 Bacteria 1096
389 Ga0373961_0002558 3300035241 Bacteria 4687
390 Ga0373961_0141819 3300035241 Bacteria 812
391 Ga0373962_0011279 3300035242 Bacteria 2239
392 Ga0373962_0062054 3300035242 Bacteria 1100
393 Ga0373931_0020608 3300035691 Bacteria 3300
394 Ga0373931_0040601 3300035691 Bacteria 2442
395 Ga0373931_0091440 3300035691 Bacteria 1696
396 Ga0373931_0403341 3300035691 Bacteria 866
397 Ga0373935_0018686 3300035692 Bacteria 4222
398 Ga0373935_0377430 3300035692 Bacteria 1015
399 Ga0373927_0021772 3300035695 Bacteria 4201
400 Ga0373927_0204938 3300035695 Bacteria 1295
401 Ga0373947_0022220 3300035725 Bacteria 3676
402 Ga0373947_0112611 3300035725 Unclassified 1721
403 Ga0373937_0106417 3300036401 Bacteria 2607
404 Ga0373937_2091424 3300036401 Unclassified 512
405 Ga0373925_0127787 3300037068 Bacteria 1979
406 Ga0373925_0272987 3300037068 Bacteria 1360
407 Ga0373925_0667238 3300037068 Bacteria 857
408 Ga0436364_1201349 3300037853 Bacteria 37373
409 Ga0436365_0751667 3300039437 Bacteria 657
410 Ga0451807_2331688 3300041486 Bacteria 1591
411 Ga0451853_2897262 3300041512 Bacteria 1040
412 Ga0451853_3156529 3300041512 Bacteria 565
413 Ga0439434_0195373 3300042435 Bacteria 681
414 Ga0439440_0010060 3300042993 Bacteria 1969
415 Ga0495592_0327720 3300046454 Bacteria 988
416 Ga0495603_0021037 3300046455 Bacteria 3950
417 Ga0495629_0011277 3300046459 Bacteria 6492
418 Ga0495629_0028439 3300046459 Bacteria 3969
419 Ga0495641_0025903 3300046461 Bacteria 2872
420 Ga0495651_0655900 3300046462 Bacteria 657
421 Ga0495582_0002101 3300046473 Bacteria 11145
422 Ga0495639_0125324 3300046475 Bacteria 1227
423 Ga0495639_0321238 3300046475 Unclassified 774
424 Ga0495662_0007134 3300046476 Bacteria 5538
425 Ga0495585_0484547 3300046492 Bacteria 589
426 Ga0495594_0007555 3300046499 Bacteria 5593
427 Ga0495606_0281536 3300046507 Bacteria 909
428 Ga0495608_0049810 3300046511 Bacteria 2780
429 Ga0495608_0450556 3300046511 Bacteria 783
430 Ga0495618_0005719 3300046514 Bacteria 7555
431 Ga0495618_0370962 3300046514 Bacteria 879
432 Ga0495628_0995436 3300046516 Bacteria 577
433 Ga0495630_0066795 3300046517 Bacteria 2703
434 Ga0495631_0415299 3300046518 Bacteria 573
435 Ga0495652_0012755 3300046529 Bacteria 7571
436 Ga0495665_0056239 3300046531 Bacteria 2077
437 Ga0495665_0106198 3300046531 Bacteria 1473
438 Ga0495640_0000544 3300046533 Bacteria 27687
439 Ga0495586_0052078 3300046535 Bacteria 2216
440 Ga0495667_0538981 3300046559 Bacteria 729
441 Ga0495668_0275177 3300046616 Bacteria 922
442 Ga0495634_0016289 3300046642 Bacteria 5318
443 Ga0495634_0027528 3300046642 Bacteria 3954
444 Ga0495625_0829199 3300046660 Bacteria 536
445 Ga0495635_0300126 3300046663 Bacteria 1077
446 Ga0495599_0038248 3300046678 Bacteria 3015
447 Ga0495646_0077198 3300046680 Bacteria 1949
448 Ga0495658_0002761 3300046683 Bacteria 8820
449 Ga0495613_0048627 3300046689 Bacteria 3132
450 Ga0495613_0239247 3300046689 Bacteria 1270
451 Ga0495624_0091523 3300046690 Bacteria 1876
452 Ga0495600_0781812 3300046809 Bacteria 570
453 Ga0495581_0070403 3300047315 Bacteria 2023
454 Ga0495581_0256289 3300047315 Bacteria 1023
455 Ga0495581_0664280 3300047315 Bacteria 602
456 Ga0495604_0818899 3300047317 Bacteria 585
457 Ga0495680_0057647 3300047322 Bacteria 3003
458 Ga0495677_0062076 3300047445 Bacteria 1387
459 Ga0495684_0036691 3300047471 Bacteria 3757
460 Ga0495684_0037554 3300047471 Bacteria 3715
461 Ga0495593_0015968 3300047673 Bacteria 4241
462 Ga0495602_0177385 3300048088 Bacteria 1647
463 Ga0495614_0057035 3300048089 Bacteria 1677
464 Ga0496100_0010789 3300048903 Bacteria 5183
465 Ga0496100_0046055 3300048903 Bacteria 2802
466 Ga0496100_0065452 3300048903 Bacteria 2408
467 Ga0496100_0099854 3300048903 Bacteria 1998
468 Ga0496101_0018951 3300048904 Bacteria 4688
469 Ga0496101_0474678 3300048904 Bacteria 987
470 Ga0496101_0490696 3300048904 Unclassified 970
471 Ga0496102_0049386 3300048905 Bacteria 3828
472 Ga0496102_0174043 3300048905 Bacteria 2026
473 Ga0496103_0034064 3300048906 Bacteria 3113
474 Ga0496103_0073470 3300048906 Bacteria 2142
475 Ga0496103_0162173 3300048906 Bacteria 1434
476 Ga0496104_0000306 3300048907 Bacteria 43669
477 Ga0496104_0051756 3300048907 Bacteria 3877
478 Ga0496104_0278599 3300048907 Unclassified 1585
479 Ga0496104_0621928 3300048907 Bacteria 989
480 Ga0496104_0881209 3300048907 Bacteria 800
481 Ga0496104_1315208 3300048907 Bacteria 626
482 Ga0496105_0018693 3300048908 Bacteria 5578
483 Ga0496105_0108169 3300048908 Bacteria 2295
484 Ga0496105_0212931 3300048908 Bacteria 1574
485 Ga0496105_0511433 3300048908 Bacteria 941
486 Ga0496105_1049808 3300048908 Bacteria 607
487 Ga0496106_0010963 3300048909 Bacteria 6702
488 Ga0496106_0022446 3300048909 Bacteria 4688
489 Ga0496106_0055858 3300048909 Bacteria 2985
490 Ga0496107_0003431 3300048910 Bacteria 10597
491 Ga0496107_0019248 3300048910 Bacteria 4816
492 Ga0496107_0703660 3300048910 Unclassified 743
493 Ga0496108_0133352 3300048911 Bacteria 2135
494 Ga0496108_0364178 3300048911 Bacteria 1262
495 Ga0496108_1023598 3300048911 Unclassified 704
496 Ga0496109_0109212 3300048912 Bacteria 2571
497 Ga0496109_0286659 3300048912 Bacteria 1552
498 Ga0496109_1160502 3300048912 Bacteria 709
499 Ga0496110_0172520 3300048913 Bacteria 1962
500 Ga0496110_0207965 3300048913 Bacteria 1778
501 Ga0496110_0552943 3300048913 Bacteria 1046
502 Ga0496111_0251239 3300048914 Unclassified 1312
503 Ga0496111_0446407 3300048914 Bacteria 954
504 Ga0496111_0464358 3300048914 Bacteria 933
505 Ga0496111_0753620 3300048914 Bacteria 706
506 Ga0496112_0271424 3300048915 Bacteria 1644
507 Ga0496112_0399495 3300048915 Bacteria 1314
508 Ga0496112_0577535 3300048915 Bacteria 1057
509 Ga0496112_0669805 3300048915 Bacteria 966
510 Ga0496112_0699472 3300048915 Unclassified 941
511 Ga0496112_0835704 3300048915 Unclassified 845
512 Ga0496112_1369981 3300048915 Bacteria 622
513 Ga0496113_0039401 3300048916 Bacteria 3478
514 Ga0496113_0102034 3300048916 Bacteria 2224
515 Ga0496114_0014702 3300048917 Bacteria 6289
516 Ga0496114_0051097 3300048917 Bacteria 3441
517 Ga0496115_0009006 3300048918 Bacteria 7404
518 Ga0496115_0023427 3300048918 Bacteria 4792
519 Ga0496115_0032828 3300048918 Bacteria 4097
520 Ga0496115_0256632 3300048918 Bacteria 1438
521 Ga0496115_0311279 3300048918 Bacteria 1289
522 Ga0496115_0342605 3300048918 Bacteria 1220
523 Ga0496115_0985527 3300048918 Bacteria 645
524 Ga0501036_0079417 3300049572 Bacteria 2775
525 Ga0501036_1465283 3300049572 Bacteria 553
526 Ga0501039_0162261 3300049575 Bacteria 1757
527 Ga0501040_1281645 3300049576 Bacteria 532
528 Ga0501041_0725017 3300049577 Bacteria 637
529 Ga0501048_0175647 3300049582 Bacteria 1518
530 Ga0501072_0022621 3300049588 Bacteria 4876
531 Ga0501073_0102455 3300049589 Bacteria 1988
532 Ga0501073_0252723 3300049589 Bacteria 1217
533 Ga0501073_0377592 3300049589 Bacteria 979
534 Ga0501073_0633908 3300049589 Bacteria 738
535 Ga0501074_0021453 3300049590 Bacteria 4690
536 Ga0501076_0004471 3300049592 Bacteria 9951
537 Ga0501079_0019843 3300049741 Bacteria 5135
538 Ga0501079_0470135 3300049741 Bacteria 988
539 Ga0501080_0162387 3300049742 Bacteria 2063
540 Ga0501083_0125954 3300049744 Bacteria 1679
541 Ga0501083_0407313 3300049744 Bacteria 885
542 Ga0501083_1055670 3300049744 Bacteria 529
543 nmdc:mga03n38_283050_c1 3300050490 Bacteria 886
544 nmdc:mga03n38_366225_c1 3300050490 Bacteria 787
545 nmdc:mga03n38_642319_c1 3300050490 Bacteria 608
546 nmdc:mga00v17_100998_c1 3300050491 Bacteria 1821
547 nmdc:mga00v17_236709_c1 3300050491 Bacteria 1183
548 nmdc:mga00v17_335588_c1 3300050491 Bacteria 983
549 nmdc:mga00v17_991133_c1 3300050491 Bacteria 529
550 nmdc:mga0yw44_135580_c1 3300050492 Bacteria 1597
551 nmdc:mga0yw44_39481_c1 3300050492 Bacteria 2800
552 nmdc:mga0k408_133198_c1 3300050493 Bacteria 1476
553 nmdc:mga06z11_294991_c1 3300050494 Bacteria 963
554 nmdc:mga06z11_619281_c1 3300050494 Bacteria 659
555 nmdc:mga06z11_62340_c1 3300050494 Bacteria 1948
556 nmdc:mga06z11_73310_c1 3300050494 Bacteria 1818
557 nmdc:mga06z11_79232_c1 3300050494 Bacteria 1758
558 nmdc:mga06z11_93485_c1 3300050494 Bacteria 1637
559 nmdc:mga04h51_20723_c1 3300050495 Bacteria 1968
560 nmdc:mga04h51_32943_c1 3300050495 Bacteria 1647
561 nmdc:mga07m45_220270_c1 3300050496 Bacteria 1104
562 nmdc:mga07m45_297533_c1 3300050496 Bacteria 939
563 nmdc:mga05p37_196771_c1 3300050507 Bacteria 2444
564 nmdc:mga05p37_403277_c1 3300050507 Bacteria 1596
565 nmdc:mga05p37_7467_c1 3300050507 Bacteria 12892
566 nmdc:mga09592_5038_c1 3300050508 Bacteria 10718
567 nmdc:mga0qj67_1265651_c1 3300050509 Bacteria 572
568 nmdc:mga0qj67_4800_c1 3300050509 Bacteria 9832
569 nmdc:mga06r32_622935_c1 3300050510 Bacteria 1049
570 nmdc:mga06r32_7361_c1 3300050510 Bacteria 9907
571 nmdc:mga08y16_1038624_c1 3300050511 Bacteria 798
572 nmdc:mga08y16_334417_c1 3300050511 Bacteria 1557
573 nmdc:mga08y16_3375_c1 3300050511 Bacteria 16554
574 nmdc:mga08y16_565298_c1 3300050511 Bacteria 1150
575 nmdc:mga0n895_106740_c1 3300050512 Bacteria 2813
576 nmdc:mga0n895_14300_c1 3300050512 Bacteria 7202
577 nmdc:mga0n895_1518_c1 3300050512 Bacteria 17419
578 nmdc:mga0n895_254070_c1 3300050512 Bacteria 1784
579 nmdc:mga0n895_601575_c1 3300050512 Bacteria 1102
580 nmdc:mga0n895_602554_c1 3300050512 Bacteria 1101
581 nmdc:mga0n895_93467_c1 3300050512 Bacteria 3011
582 nmdc:mga0rr50_1400224_c1 3300050513 Unclassified 592
583 nmdc:mga0rr50_189059_c1 3300050513 Bacteria 1687
584 nmdc:mga0rr50_35832_c1 3300050513 Bacteria 3567
585 nmdc:mga0rr50_407655_c1 3300050513 Bacteria 1149
586 nmdc:mga0rr50_7122_c1 3300050513 Bacteria 6868
587 nmdc:mga0rr50_71673_c2 3300050513 Unclassified 2092
588 nmdc:mga08x19_184_c1 3300050514 Bacteria 50071
589 nmdc:mga0a205_100_c1 3300050515 Bacteria 49122
590 nmdc:mga0a205_153333_c1 3300050515 Bacteria 2203
591 nmdc:mga0a205_472788_c1 3300050515 Bacteria 1112
592 nmdc:mga0a205_48940_c1 3300050515 Bacteria 4080
593 nmdc:mga0sz30_27287_c1 3300050516 Bacteria 2345
594 Ga0495601_0008764 3300053077 Bacteria 5965
595 Ga0495601_0506296 3300053077 Unclassified 779
596 Ga0495612_0028918 3300053078 Bacteria 2231
597 Ga0495612_0093567 3300053078 Bacteria 1275
598 Ga0495595_0020042 3300053084 Bacteria 2907
599 Ga0495619_0005220 3300053085 Bacteria 8234
600 Ga0495619_0013258 3300053085 Bacteria 5194
601 Ga0495619_0046399 3300053085 Bacteria 2856
602 Ga0495619_0550619 3300053085 Bacteria 791
603 Ga0495619_0744358 3300053085 Bacteria 665
604 Ga0500644_0000531 3300053088 Bacteria 15833
605 Ga0500562_014689 3300053108 Bacteria 2007
606 Ga0500642_0000316 3300053130 Bacteria 16897
607 Ga0500652_013068 3300053131 Bacteria 2931
608 Ga0500611_006618 3300053727 Bacteria 1697
609 Ga0501084_0008473 3300054114 Bacteria 8504
610 Ga0501084_1092257 3300054114 Bacteria 670
611 Ga0501082_0024930 3300060353 Bacteria 5153
612 Ga0501082_0440603 3300060353 Bacteria 1138
613 Ga0501082_1068997 3300060353 Bacteria 706
614 Ga0501082_1171790 3300060353 Bacteria 672
615 Ga0501082_1691775 3300060353 Bacteria 552
616 Ga0530510_1234281 3300061734 Bacteria 573
617 2824673397 2824671348 Bacteria 8369588
618 2824689561 2824687955 Bacteria 8360029
619 2885414170 2885409591 Bacteria 9235467
620 Ga0111539_10005220
621 JGI24748J21848_1045426
622 JGI25405J52794_10021659
623 Ga0070658_10261343
624 Ga0070683_100252476
625 Ga0070683_100588421
626 Ga0070670_100170974
627 Ga0068869_100016829
628 Ga0068869_100259500
629 Ga0068869_100497304
630 Ga0070666_10100945
631 Ga0070680_100003110
632 Ga0070680_100039541
633 Ga0070682_100054580
634 Ga0068868_100026636
635 Ga0068868_100139434
636 Ga0070660_100325169
637 Ga0070689_100088494
638 Ga0070689_100140747
639 Ga0070691_10013180
640 Ga0070661_100036009
641 Ga0070661_100208919
642 Ga0070668_100533374
643 Ga0070675_100174542
644 Ga0070675_101908870
645 Ga0070671_100340405
646 Ga0070671_100481437
647 Ga0070674_100100727
648 Ga0070674_100891389
649 Ga0070673_100596891
650 Ga0070688_100051564
651 Ga0070667_100137887
652 Ga0070709_10570873
653 Ga0070714_100021302
654 Ga0070714_100446726
655 Ga0070714_101833277
656 Ga0070713_100823952
657 Ga0070710_10027268
658 Ga0070711_100011070
659 Ga0070705_100000904
660 Ga0070700_100347996
661 Ga0070694_100984840
662 Ga0070663_100039645
663 Ga0070678_100065354
664 Ga0070678_100224002
665 Ga0070662_100026506
666 Ga0070662_100758876
667 Ga0070662_101707668
668 Ga0070681_10050777
669 Ga0070681_10071674
670 Ga0068867_100225200
671 Ga0068867_101989500
672 Ga0070685_10745808
673 Ga0070706_100171917
674 Ga0070707_100046453
675 Ga0070707_100157873
676 Ga0070698_100315686
677 Ga0070699_100000310
678 Ga0070699_100226053
679 Ga0070699_101380742
680 Ga0070679_100581469
681 Ga0070684_100096208
682 Ga0070684_100756305
683 Ga0070697_100007493
684 Ga0070697_100052563
685 Ga0068853_100349222
686 Ga0070672_101881883
687 Ga0070686_100104157
688 Ga0070686_100455901
689 Ga0070695_100000252
690 Ga0070695_100000919
691 Ga0070696_100000291
692 Ga0070696_100840407
693 Ga0070693_100053361
694 Ga0070693_100722369
695 Ga0070693_100817199
696 Ga0070665_100064056
697 Ga0070665_100289052
698 Ga0070665_101000132
699 Ga0068855_102084395
700 Ga0070664_100155230
701 Ga0070664_100289002
702 Ga0068857_100005207
703 Ga0070702_100003770
704 Ga0070702_100064622
705 Ga0068852_101778833
706 Ga0068859_100005637
707 Ga0068859_100812138
708 Ga0068864_100310296
709 Ga0068864_100362143
710 Ga0068864_100425889
711 Ga0068864_100492282
712 Ga0068861_100066801
713 Ga0068851_10078157
714 Ga0068863_100241558
715 Ga0068863_101029970
716 Ga0068858_100054706
717 Ga0068858_100172955
718 Ga0068858_100703132
719 Ga0068860_100005359
720 Ga0068860_100230046
721 Ga0068862_100001312
722 Ga0068862_100644728
723 Ga0081455_10000122
724 Ga0081455_10001659
725 Ga0081538_10145366
726 Ga0081540_1000021
727 Ga0070717_10051099
728 Ga0070717_10219848
729 Ga0070717_10448252
730 Ga0070717_10596687
731 Ga0075365_10151345
732 Ga0075368_10036901
733 Ga0075368_10049297
734 Ga0075368_10135353
735 Ga0075363_100126516
736 Ga0075363_100169133
737 Ga0075364_10039104
738 Ga0075364_10122724
739 Ga0075364_10274878
740 Ga0070715_10002518
741 Ga0070716_100004152
742 Ga0070716_100214739
743 Ga0070712_100087703
744 Ga0070712_100100241
745 Ga0075362_10043387
746 Ga0075367_10051581
747 Ga0075367_10057712
748 Ga0075367_10101171
749 Ga0075367_10557716
750 Ga0075369_10013588
751 Ga0075427_10001142
752 Ga0097621_100006628
753 Ga0075370_10130632
754 Ga0075370_10841458
755 Ga0068871_100006454
756 Ga0068871_100174634
757 Ga0075428_100090413
758 Ga0075428_100245493
759 Ga0075428_100633094
760 Ga0075428_102377531
761 Ga0075430_100009755
762 Ga0075430_100091847
763 Ga0075430_100671888
764 Ga0075430_100821682
765 Ga0075431_100081591
766 Ga0075431_100410154
767 Ga0075433_10004805
768 Ga0075433_10042115
769 Ga0075433_10181668
770 Ga0075434_100001712
771 Ga0075434_100001952
772 Ga0075434_100130823
773 Ga0075434_100141659
774 Ga0075434_100438428
775 Ga0075434_100461826
776 Ga0075429_100658896
777 Ga0068865_100092177
778 Ga0068865_100107686
779 Ga0068865_100717110
780 Ga0075436_100002694
781 Ga0075436_100094393
782 Ga0075436_100098122
783 Ga0097620_100005637
784 Ga0097620_100812177
785 Ga0097620_101688536
786 Ga0075435_100010234
787 Ga0075435_100020399
788 Ga0075435_100030393
789 Ga0075435_100037053
790 Ga0075435_100087654
791 Ga0075435_100139195
792 Ga0075435_101513246
793 Ga0105251_10084715
794 Ga0105250_10062415
795 Ga0111539_10017284
796 Ga0111539_10024554
797 Ga0111539_10049793
798 Ga0111539_10998349
799 Ga0111539_11496409
800 Ga0111539_11952434
801 Ga0105245_10284713
802 Ga0105245_10665969
803 Ga0105247_10108248
804 Ga0105247_10110121
805 Ga0105247_11476941
806 Ga0114129_10011621
807 Ga0114129_10028481
808 Ga0114129_10106962
809 Ga0114129_10465334
810 Ga0114129_10505011
811 Ga0114129_11662493
812 Ga0105243_10401694
813 Ga0105243_10869637
814 Ga0105241_10135986
815 Ga0105241_10633691
816 Ga0105241_12404700
817 Ga0105242_10182118
818 Ga0105242_10354469
819 Ga0105248_10102303
820 Ga0105248_10408963
821 Ga0105248_11682010
822 Ga0105237_10275885
823 Ga0105238_10154592
824 Ga0105249_10131172
825 Ga0105239_10083116
826 Ga0105239_10431264
827 Ga0105246_10019389
828 Ga0105246_10176382
829 Ga0105246_10287386
830 Ga0105246_11722668
831 Ga0157339_1005452
832 Ga0157338_1026534
833 Ga0157369_12060170
834 Ga0157374_10255606
835 Ga0157374_10312167
836 Ga0157374_10605090
837 Ga0157374_11343801
838 Ga0157378_10019818
839 Ga0157378_10104571
840 Ga0157378_12191581
841 Ga0163162_10019721
842 Ga0163162_10632203
843 Ga0163162_11743529
844 Ga0157372_11157436
845 Ga0157375_10166503
846 Ga0157375_10190306
847 Ga0157375_11020929
848 Ga0157375_11061617
849 Ga0163163_10014823
850 Ga0163163_10027628
851 Ga0163163_10129576
852 Ga0163163_10181214
853 Ga0163163_11602357
854 Ga0157377_10080211
855 Ga0157377_11227974
856 Ga0157379_10100154
857 Ga0157379_10156614
858 Ga0157379_10302692
859 Ga0157376_10161001
860 Ga0157376_11677866
861 Ga0157376_12696939
862 Ga0182005_1042936
863 Ga0163161_10057061
864 Ga0213875_10000045
865 Ga0207713_1107827
866 Ga0207653_10003583
867 Ga0207692_10001856
868 Ga0207710_10032194
869 Ga0207688_10072569
870 Ga0207685_10000848
871 Ga0207699_10054464
872 Ga0207684_10034479
873 Ga0207654_10095853
874 Ga0207707_10317340
875 Ga0207707_10339551
876 Ga0207671_10164494
877 Ga0207693_10006806
878 Ga0207693_10012093
879 Ga0207663_10489260
880 Ga0207660_10003462
881 Ga0207662_10227568
882 Ga0207657_10293814
883 Ga0207649_10593274
884 Ga0207646_10108998
885 Ga0207646_10198228
886 Ga0207650_10119823
887 Ga0207659_10530552
888 Ga0207687_10028259
889 Ga0207700_10002289
890 Ga0207700_11401690
891 Ga0207664_10405085
892 Ga0207644_10023350
893 Ga0207644_10971711
894 Ga0207690_11736413
895 Ga0207706_10059761
896 Ga0207706_10357250
897 Ga0207686_10846793
898 Ga0207686_10862480
899 Ga0207670_10124328
900 Ga0207669_10720865
901 Ga0207704_10018360
902 Ga0207704_10128783
903 Ga0207665_10000223
904 Ga0207665_10174321
905 Ga0207691_11013377
906 Ga0207711_10103574
907 Ga0207711_10558879
908 Ga0207711_11062021
909 Ga0207711_11487980
910 Ga0207689_10026331
911 Ga0207689_10081901
912 Ga0207661_10331763
913 Ga0207679_10162348
914 Ga0207679_10182287
915 Ga0207679_10221172
916 Ga0207651_10165698
917 Ga0207651_11914331
918 Ga0207712_10010862
919 Ga0207712_10162946
920 Ga0207668_10218089
921 Ga0207640_10460117
922 Ga0207658_10146686
923 Ga0207658_12006603
924 Ga0207677_10091784
925 Ga0207677_10781873
926 Ga0207703_10124111
927 Ga0207703_10362564
928 Ga0207703_10825503
929 Ga0207703_11076705
930 Ga0207678_10019073
931 Ga0207678_10034006
932 Ga0207678_10077002
933 Ga0207708_10014408
934 Ga0207708_10058997
935 Ga0207702_10947744
936 Ga0207641_10160495
937 Ga0207641_11115898
938 Ga0207648_11149632
939 Ga0207676_10108602
940 Ga0207676_10286414
941 Ga0207676_10771605
942 Ga0207674_10013673
943 Ga0207675_100075711
944 Ga0207675_100399438
945 Ga0207683_10015344
946 Ga0207698_11573606
947 Ga0209813_10029887
948 Ga0209813_10156053
949 Ga0207428_10129637
950 Ga0207428_10363993
951 Ga0207428_10364806
952 Ga0268266_10008517
953 Ga0268266_10208949
954 Ga0268265_10001160
955 Ga0268264_10168940
956 Ga0268264_10183041
957 Ga0265330_10088352
958 Ga0265325_10008767
959 Ga0265325_10009859
960 Ga0265329_10293222
961 Ga0265340_10008636
962 Ga0265340_10045015
963 Ga0265340_10081243
964 Ga0265339_10002697
965 Ga0265339_10195971
966 Ga0265331_10081271
967 Ga0265316_10095708
968 Ga0265313_10000216
969 Ga0265313_10003192
970 Ga0265313_10005467
971 Ga0265313_10022682
972 Ga0265313_10287950
973 Ga0265314_10043915
974 Ga0265342_10010206
975 Ga0265342_10143862
976 Ga0265342_10344224
977 Ga0373948_0012134
978 Ga0373948_0013076
979 Ga0373950_0004250
980 Ga0373958_0057737
981 Ga0373959_0117587
982 Ga0373938_0000729
983 Ga0373938_0002329
984 Ga0373926_0038634
985 Ga0373928_0075786
986 Ga0373940_0021180
987 Ga0373944_0207072
988 Ga0373951_0031009
989 Ga0373951_0159749
990 Ga0373952_0003927
991 Ga0373952_0066200
992 Ga0373932_0002557
993 Ga0373932_0016482
994 Ga0373932_0237933
995 Ga0373936_0128117
996 Ga0373936_0281463
997 Ga0373939_0030497
998 Ga0373939_0110509
999 Ga0373941_0027048
1000 Ga0373941_0078159
1001 Ga0373945_0208133
1002 Ga0373953_0085447
1003 Ga0373954_0253232
1004 Ga0373960_0033193
1005 Ga0373960_0050156
1006 Ga0373943_0149338
1007 Ga0373942_0058892
1008 Ga0373961_0002558
1009 Ga0373961_0141819
1010 Ga0373962_0011279
1011 Ga0373962_0062054
1012 Ga0373931_0020608
1013 Ga0373931_0040601
1014 Ga0373931_0091440
1015 Ga0373931_0403341
1016 Ga0373935_0018686
1017 Ga0373935_0377430
1018 Ga0373927_0021772
1019 Ga0373927_0204938
1020 Ga0373947_0022220
1021 Ga0373947_0112611
1022 Ga0373937_0106417
1023 Ga0373937_2091424
1024 Ga0373925_0127787
1025 Ga0373925_0272987
1026 Ga0373925_0667238
1027 Ga0436364_1201349
1028 Ga0436365_0751667
1029 Ga0451807_2331688
1030 Ga0451853_2897262
1031 Ga0451853_3156529
1032 Ga0439434_0195373
1033 Ga0439440_0010060
1034 Ga0495592_0327720
1035 Ga0495603_0021037
1036 Ga0495629_0011277
1037 Ga0495629_0028439
1038 Ga0495641_0025903
1039 Ga0495651_0655900
1040 Ga0495582_0002101
1041 Ga0495639_0125324
1042 Ga0495639_0321238
1043 Ga0495662_0007134
1044 Ga0495585_0484547
1045 Ga0495594_0007555
1046 Ga0495606_0281536
1047 Ga0495608_0049810
1048 Ga0495608_0450556
1049 Ga0495618_0005719
1050 Ga0495618_0370962
1051 Ga0495628_0995436
1052 Ga0495630_0066795
1053 Ga0495631_0415299
1054 Ga0495652_0012755
1055 Ga0495665_0056239
1056 Ga0495665_0106198
1057 Ga0495640_0000544
1058 Ga0495586_0052078
1059 Ga0495667_0538981
1060 Ga0495668_0275177
1061 Ga0495634_0016289
1062 Ga0495634_0027528
1063 Ga0495625_0829199
1064 Ga0495635_0300126
1065 Ga0495599_0038248
1066 Ga0495646_0077198
1067 Ga0495658_0002761
1068 Ga0495613_0048627
1069 Ga0495613_0239247
1070 Ga0495624_0091523
1071 Ga0495600_0781812
1072 Ga0495581_0070403
1073 Ga0495581_0256289
1074 Ga0495581_0664280
1075 Ga0495604_0818899
1076 Ga0495680_0057647
1077 Ga0495677_0062076
1078 Ga0495684_0036691
1079 Ga0495684_0037554
1080 Ga0495593_0015968
1081 Ga0495602_0177385
1082 Ga0495614_0057035
1083 Ga0496100_0010789
1084 Ga0496100_0046055
1085 Ga0496100_0065452
1086 Ga0496100_0099854
1087 Ga0496101_0018951
1088 Ga0496101_0474678
1089 Ga0496101_0490696
1090 Ga0496102_0049386
1091 Ga0496102_0174043
1092 Ga0496103_0034064
1093 Ga0496103_0073470
1094 Ga0496103_0162173
1095 Ga0496104_0000306
1096 Ga0496104_0051756
1097 Ga0496104_0278599
1098 Ga0496104_0621928
1099 Ga0496104_0881209
1100 Ga0496104_1315208
1101 Ga0496105_0018693
1102 Ga0496105_0108169
1103 Ga0496105_0212931
1104 Ga0496105_0511433
1105 Ga0496105_1049808
1106 Ga0496106_0010963
1107 Ga0496106_0022446
1108 Ga0496106_0055858
1109 Ga0496107_0003431
1110 Ga0496107_0019248
1111 Ga0496107_0703660
1112 Ga0496108_0133352
1113 Ga0496108_0364178
1114 Ga0496108_1023598
1115 Ga0496109_0109212
1116 Ga0496109_0286659
1117 Ga0496109_1160502
1118 Ga0496110_0172520
1119 Ga0496110_0207965
1120 Ga0496110_0552943
1121 Ga0496111_0251239
1122 Ga0496111_0446407
1123 Ga0496111_0464358
1124 Ga0496111_0753620
1125 Ga0496112_0271424
1126 Ga0496112_0399495
1127 Ga0496112_0577535
1128 Ga0496112_0669805
1129 Ga0496112_0699472
1130 Ga0496112_0835704
1131 Ga0496112_1369981
1132 Ga0496113_0039401
1133 Ga0496113_0102034
1134 Ga0496114_0014702
1135 Ga0496114_0051097
1136 Ga0496115_0009006
1137 Ga0496115_0023427
1138 Ga0496115_0032828
1139 Ga0496115_0256632
1140 Ga0496115_0311279
1141 Ga0496115_0342605
1142 Ga0496115_0985527
1143 Ga0501036_0079417
1144 Ga0501036_1465283
1145 Ga0501039_0162261
1146 Ga0501040_1281645
1147 Ga0501041_0725017
1148 Ga0501048_0175647
1149 Ga0501072_0022621
1150 Ga0501073_0102455
1151 Ga0501073_0252723
1152 Ga0501073_0377592
1153 Ga0501073_0633908
1154 Ga0501074_0021453
1155 Ga0501076_0004471
1156 Ga0501079_0019843
1157 Ga0501079_0470135
1158 Ga0501080_0162387
1159 Ga0501083_0125954
1160 Ga0501083_0407313
1161 Ga0501083_1055670
1162 nmdc:mga03n38_283050_c1
1163 nmdc:mga03n38_366225_c1
1164 nmdc:mga03n38_642319_c1
1165 nmdc:mga00v17_100998_c1
1166 nmdc:mga00v17_236709_c1
1167 nmdc:mga00v17_335588_c1
1168 nmdc:mga00v17_991133_c1
1169 nmdc:mga0yw44_135580_c1
1170 nmdc:mga0yw44_39481_c1
1171 nmdc:mga0k408_133198_c1
1172 nmdc:mga06z11_294991_c1
1173 nmdc:mga06z11_619281_c1
1174 nmdc:mga06z11_62340_c1
1175 nmdc:mga06z11_73310_c1
1176 nmdc:mga06z11_79232_c1
1177 nmdc:mga06z11_93485_c1
1178 nmdc:mga04h51_20723_c1
1179 nmdc:mga04h51_32943_c1
1180 nmdc:mga07m45_220270_c1
1181 nmdc:mga07m45_297533_c1
1182 nmdc:mga05p37_196771_c1
1183 nmdc:mga05p37_403277_c1
1184 nmdc:mga05p37_7467_c1
1185 nmdc:mga09592_5038_c1
1186 nmdc:mga0qj67_1265651_c1
1187 nmdc:mga0qj67_4800_c1
1188 nmdc:mga06r32_622935_c1
1189 nmdc:mga06r32_7361_c1
1190 nmdc:mga08y16_1038624_c1
1191 nmdc:mga08y16_334417_c1
1192 nmdc:mga08y16_3375_c1
1193 nmdc:mga08y16_565298_c1
1194 nmdc:mga0n895_106740_c1
1195 nmdc:mga0n895_14300_c1
1196 nmdc:mga0n895_1518_c1
1197 nmdc:mga0n895_254070_c1
1198 nmdc:mga0n895_601575_c1
1199 nmdc:mga0n895_602554_c1
1200 nmdc:mga0n895_93467_c1
1201 nmdc:mga0rr50_1400224_c1
1202 nmdc:mga0rr50_189059_c1
1203 nmdc:mga0rr50_35832_c1
1204 nmdc:mga0rr50_407655_c1
1205 nmdc:mga0rr50_7122_c1
1206 nmdc:mga0rr50_71673_c2
1207 nmdc:mga08x19_184_c1
1208 nmdc:mga0a205_100_c1
1209 nmdc:mga0a205_153333_c1
1210 nmdc:mga0a205_472788_c1
1211 nmdc:mga0a205_48940_c1
1212 nmdc:mga0sz30_27287_c1
1213 Ga0495601_0008764
1214 Ga0495601_0506296
1215 Ga0495612_0028918
1216 Ga0495612_0093567
1217 Ga0495595_0020042
1218 Ga0495619_0005220
1219 Ga0495619_0013258
1220 Ga0495619_0046399
1221 Ga0495619_0550619
1222 Ga0495619_0744358
1223 Ga0500644_0000531
1224 Ga0500562_014689
1225 Ga0500642_0000316
1226 Ga0500652_013068
1227 Ga0500611_006618
1228 Ga0501084_0008473
1229 Ga0501084_1092257
1230 Ga0501082_0024930
1231 Ga0501082_0440603
1232 Ga0501082_1068997
1233 Ga0501082_1171790
1234 Ga0501082_1691775
1235 Ga0530510_1234281
1236 2824673397
1237 2824689561
1238 2885414170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

25

77

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

29

76

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9364 1 88
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9215 18 76
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9204 16 76
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9125 15 75
2lnb-assembly1.cif.gz_A solution nmr structure of n-terminal domain (6-74) of human zbp1 protein, northeast structural genomics consortium target hr8174a. 0.9097 17 75
ID Description Score Start End Superfamily
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9437 15 75 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9408 1 89 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9397 15 75 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9387 17 75 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9336 15 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1U9JMC1-F1-model_v4 HTH arsR-type domain-containing protein 0.9848 1 89 GO:0003700
AF-A0A1E3LYT8-F1-model_v4 HTH arsR-type domain-containing protein 0.9796 1 93 GO:0003700
AF-A0A031HKQ3-F1-model_v4 Transcriptional regulator, ArsR family 0.9763 1 90 GO:0003700
AF-A0A2Z5UC94-F1-model_v4 ArsR family transcriptional regulator 0.9763 1 89 GO:0003700
AF-A0A3D5DNM8-F1-model_v4 Transcriptional regulator 0.9751 1 92 GO:0003700

Map