F469697

General Info

Members Datasets Scaffolds Average Seq Length
618 277 512 281

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000041|JGI25162J39368_1000041141
Length 292
Sequence MSSALVLCRFLHFIVVLMLFGAXLFRPLLLRHEPLTQALATLDQRLAKLSRLLAGFALFTGVCWLLLITASMAGSLSAAFDWPTVQLVLSNTFFGQVWRWHLLFNGLLVVCLLSPLSNSFALRMLLSSLLLMTLAPVGHGAMLDGLSGQLLILNQVIHLTCVGAWLGGLMLLMMILLRPTTHAVEPILQRFSGIGYGLVAGLLVTGLINVRVLTGAFWPTPLLSGFALILLIKVLLVSAMLGLALFNRLKIKHCEQRLSTLRTSVMLEWLLGIAAVAAVSLLGTLPPMVAGN

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231012 Pseudomonas sp. GM33 Isolate Nodule
5 2511231014 Pseudomonas sp. GM48 Isolate Nodule
6 2511231015 Pseudomonas sp. GM49 Isolate Nodule
7 2511231017 Pseudomonas sp. GM55 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231019 Pseudomonas sp. GM67 Isolate Nodule
10 2511231020 Pseudomonas sp. GM74 Isolate Nodule
11 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
12 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
13 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
14 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
15 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
16 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
17 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
18 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
19 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
20 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
21 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
22 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
23 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
24 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
25 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
26 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
27 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
28 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
29 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
30 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
31 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
32 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
33 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
34 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
35 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
36 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
37 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
38 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
39 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
40 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
41 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
42 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
43 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
44 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
45 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
46 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
47 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
48 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
49 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
50 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
51 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
52 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
53 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
54 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
55 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
56 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
57 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
58 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
59 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
60 2784132063 Pseudomonas sp. 424 Isolate Unclassified
61 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
62 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
63 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
64 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
65 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
66 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
67 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
68 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
69 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
70 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
71 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
72 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
73 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
74 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
75 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
76 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
77 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
78 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
79 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
80 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
81 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
82 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
83 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
84 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
85 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
86 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
87 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
88 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
89 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
90 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
91 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
92 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
93 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
94 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
95 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
96 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
97 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
98 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
99 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
100 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
101 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
102 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
103 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
104 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
105 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
106 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
161 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
267 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
268 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
269 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
270 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
271 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
272 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
273 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
274 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
275 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
276 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
277 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.85
Metatranscriptomes 0
Isolates 17.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 1.78
Rhizoplane 5.83
Rhizosphere 74.92
Stem 0
Stem Tuber 0
Unclassified 13.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000014 3300002737 Bacteria 328873
2 JGI25162J39368_1000041 3300002737 Bacteria 174952
3 JGI25163J39215_1000165 3300002771 Bacteria 26186
4 JGI25163J39215_1000405 3300002771 Bacteria 13638
5 JGI25164J39214_1000021 3300002772 Bacteria 174952
6 JGI25164J39214_1000059 3300002772 Bacteria 111483
7 JGI25165J46597_1000027 3300003214 Bacteria 328873
8 JGI25165J46597_1000081 3300003214 Bacteria 174952
9 Ga0055536_1000247 3300003781 Bacteria 42902
10 Ga0055530_10007832 3300003791 Bacteria 4408
11 Ga0065714_10009491 3300005288 Bacteria 2920
12 Ga0065714_10015504 3300005288 Bacteria 2542
13 Ga0065714_10068521 3300005288 Bacteria 4681
14 Ga0065714_10088919 3300005288 Bacteria 1999
15 Ga0065714_10089615 3300005288 Bacteria 1973
16 Ga0065714_10091359 3300005288 Bacteria 1913
17 Ga0065704_10143356 3300005289 Bacteria 1496
18 Ga0065712_10138491 3300005290 Bacteria 1473
19 Ga0070670_100000303 3300005331 Bacteria 42489
20 Ga0070670_100004984 3300005331 Bacteria 11172
21 Ga0070661_100000036 3300005344 Bacteria 108531
22 Ga0070669_100000891 3300005353 Bacteria 21725
23 Ga0070662_100001590 3300005457 Bacteria 14033
24 Ga0068853_100023697 3300005539 Bacteria 5142
25 Ga0070665_100272990 3300005548 Bacteria 1693
26 Ga0070664_100000275 3300005564 Bacteria 37073
27 Ga0068851_10000132 3300005834 Bacteria 40261
28 Ga0075364_10099480 3300006051 Bacteria 1936
29 Ga0075432_10004417 3300006058 Bacteria 4788
30 Ga0075432_10009815 3300006058 Bacteria 3254
31 Ga0075432_10029657 3300006058 Bacteria 1889
32 Ga0075432_10042407 3300006058 Bacteria 1592
33 Ga0075432_10046795 3300006058 Bacteria 1519
34 Ga0075432_10053649 3300006058 Bacteria 1426
35 Ga0075436_100110392 3300006914 Bacteria 1919
36 Ga0075436_100323668 3300006914 Bacteria 1108
37 Ga0105251_10000168 3300009011 Bacteria 67221
38 Ga0105251_10001353 3300009011 Bacteria 21185
39 Ga0105251_10005941 3300009011 Bacteria 7883
40 Ga0105251_10031946 3300009011 Bacteria 2628
41 Ga0105251_10062852 3300009011 Bacteria 1743
42 Ga0105251_10114361 3300009011 Bacteria 1228
43 Ga0105244_10000801 3300009036 Bacteria 26759
44 Ga0105244_10002677 3300009036 Bacteria 13327
45 Ga0105244_10002826 3300009036 Bacteria 12878
46 Ga0105244_10033024 3300009036 Bacteria 2733
47 Ga0105244_10046496 3300009036 Bacteria 2229
48 Ga0105250_10000122 3300009092 Bacteria 67516
49 Ga0105250_10000583 3300009092 Bacteria 23970
50 Ga0105250_10000591 3300009092 Bacteria 23712
51 Ga0105250_10033711 3300009092 Bacteria 2056
52 Ga0105243_10011007 3300009148 Bacteria 6840
53 Ga0105242_10003661 3300009176 Bacteria 11960
54 Ga0105237_10001372 3300009545 Bacteria 32130
55 Ga0105246_10007319 3300011119 Bacteria 6762
56 Ga0105246_10011012 3300011119 Bacteria 5605
57 Ga0157373_10000784 3300013100 Bacteria 24454
58 Ga0157373_10002739 3300013100 Bacteria 13345
59 Ga0157373_10034006 3300013100 Bacteria 3662
60 Ga0157373_10235217 3300013100 Bacteria 1294
61 Ga0157371_10000147 3300013102 Bacteria 102369
62 Ga0157371_10000771 3300013102 Bacteria 36847
63 Ga0157370_10031156 3300013104 Bacteria 5219
64 Ga0157370_10074440 3300013104 Bacteria 3203
65 Ga0157370_10156727 3300013104 Bacteria 2118
66 Ga0157369_10005184 3300013105 Bacteria 15232
67 Ga0157369_10008823 3300013105 Bacteria 11550
68 Ga0157369_10083900 3300013105 Bacteria 3407
69 Ga0157372_10009492 3300013307 Bacteria 10346
70 Ga0157375_10001567 3300013308 Bacteria 19698
71 Ga0157375_10025255 3300013308 Bacteria 5517
72 Ga0157375_10045094 3300013308 Bacteria 4290
73 Ga0182008_10000525 3300014497 Bacteria 28726
74 Ga0182008_10005142 3300014497 Bacteria 7506
75 Ga0182008_10008636 3300014497 Bacteria 5547
76 Ga0182008_10010543 3300014497 Bacteria 4944
77 Ga0182008_10042632 3300014497 Bacteria 2260
78 Ga0182006_1001855 3300015261 Bacteria 12119
79 Ga0182006_1006100 3300015261 Bacteria 5636
80 Ga0182006_1010465 3300015261 Bacteria 4125
81 Ga0182006_1028140 3300015261 Bacteria 2288
82 Ga0182007_10001820 3300015262 Bacteria 11128
83 Ga0182005_1001427 3300015265 Bacteria 9634
84 Ga0182005_1020183 3300015265 Bacteria 1835
85 Ga0163161_10022110 3300017792 Bacteria 4476
86 Ga0163161_10025470 3300017792 Bacteria 4186
87 Ga0163161_10043048 3300017792 Bacteria 3250
88 Ga0163161_10085150 3300017792 Bacteria 2332
89 Ga0163161_10111018 3300017792 Bacteria 2050
90 Ga0163161_10172005 3300017792 Bacteria 1657
91 Ga0163161_10182530 3300017792 Bacteria 1610
92 Ga0163161_10307702 3300017792 Bacteria 1249
93 Ga0163161_10363541 3300017792 Bacteria 1153
94 Ga0209760_100025 3300025207 Bacteria 156628
95 Ga0209760_100074 3300025207 Bacteria 80573
96 Ga0207427_100003 3300025231 Bacteria 1035004
97 Ga0207427_100064 3300025231 Bacteria 174987
98 Ga0209437_100002 3300025233 Bacteria 1574801
99 Ga0209437_100044 3300025233 Bacteria 430619
100 Ga0209233_1000004 3300025261 Bacteria 1574798
101 Ga0209233_1000057 3300025261 Bacteria 430619
102 Ga0209676_1004916 3300025292 Bacteria 7194
103 Ga0209050_1000914 3300025298 Bacteria 38994
104 Ga0209051_1002770 3300025303 Bacteria 12099
105 Ga0207656_10000880 3300025321 Bacteria 9793
106 Ga0207696_1000051 3300025711 Bacteria 276833
107 Ga0207696_1000108 3300025711 Bacteria 157445
108 Ga0207696_1000264 3300025711 Bacteria 67521
109 Ga0207696_1007743 3300025711 Bacteria 4174
110 Ga0207655_1000173 3300025728 Bacteria 118589
111 Ga0207655_1001582 3300025728 Bacteria 20417
112 Ga0207655_1002917 3300025728 Bacteria 13164
113 Ga0207655_1010438 3300025728 Bacteria 5630
114 Ga0207655_1025183 3300025728 Bacteria 2895
115 Ga0207655_1029183 3300025728 Bacteria 2588
116 Ga0207713_1000020 3300025735 Bacteria 359258
117 Ga0207713_1002121 3300025735 Bacteria 14783
118 Ga0207713_1002307 3300025735 Bacteria 14027
119 Ga0207713_1005552 3300025735 Bacteria 7860
120 Ga0207713_1008034 3300025735 Bacteria 6132
121 Ga0207713_1026659 3300025735 Bacteria 2642
122 Ga0207671_10001354 3300025914 Bacteria 28611
123 Ga0207649_10000042 3300025920 Bacteria 117456
124 Ga0207681_10004855 3300025923 Bacteria 8261
125 Ga0207650_10000068 3300025925 Bacteria 139947
126 Ga0207650_10000240 3300025925 Bacteria 60809
127 Ga0207706_10063620 3300025933 Bacteria 3248
128 Ga0207709_10001157 3300025935 Bacteria 19199
129 Ga0207679_10000044 3300025945 Bacteria 122251
130 Ga0207428_10029342 3300027907 Bacteria 4560
131 Ga0207428_10052164 3300027907 Bacteria 3268
132 Ga0207428_10158460 3300027907 Bacteria 1720
133 Ga0307517_10108361 3300028786 Bacteria 2133
134 Ga0307511_10076457 3300030521 Bacteria 2393
135 Ga0307405_10008864 3300031731 Bacteria 5128
136 Ga0307412_10154313 3300031911 Bacteria 1698
137 Ga0439438_015042 3300041405 Bacteria 2286
138 Ga0439438_026174 3300041405 Bacteria 1583
139 Ga0439447_002212 3300041407 Bacteria 7135
140 Ga0439447_033104 3300041407 Bacteria 1290
141 Ga0439466_0003304 3300041411 Bacteria 6269
142 Ga0439432_001132 3300042006 Bacteria 10119
143 Ga0439432_006138 3300042006 Bacteria 4303
144 Ga0439451_006463 3300042009 Bacteria 2396
145 Ga0439452_011826 3300042010 Bacteria 2499
146 Ga0439452_015042 3300042010 Bacteria 2132
147 Ga0439463_003863 3300042016 Bacteria 3778
148 Ga0450899_005173 3300042135 Bacteria 1401
149 Ga0450907_000140 3300042146 Bacteria 27596
150 Ga0439446_0030566 3300042156 Bacteria 1556
151 Ga0450909_006821 3300042185 Bacteria 1645
152 Ga0439434_0000827 3300042435 Bacteria 8916
153 Ga0439440_0002114 3300042993 Bacteria 3710
154 Ga0495617_000954 3300046452 Bacteria 13433
155 Ga0495617_004226 3300046452 Bacteria 5249
156 Ga0495617_014223 3300046452 Bacteria 2705
157 Ga0495617_025484 3300046452 Bacteria 1993
158 Ga0495627_001501 3300046453 Bacteria 13468
159 Ga0495627_020048 3300046453 Bacteria 2233
160 Ga0495627_024162 3300046453 Bacteria 1983
161 Ga0495592_0168844 3300046454 Bacteria 1499
162 Ga0495603_0007516 3300046455 Bacteria 6553
163 Ga0495603_0008796 3300046455 Bacteria 6102
164 Ga0495590_0001143 3300046457 Bacteria 11622
165 Ga0495590_0004895 3300046457 Bacteria 5352
166 Ga0495590_0096868 3300046457 Bacteria 1046
167 Ga0495590_0163281 3300046457 Bacteria 810
168 Ga0495591_000533 3300046458 Bacteria 29482
169 Ga0495591_002186 3300046458 Bacteria 11168
170 Ga0495591_014717 3300046458 Bacteria 2796
171 Ga0495591_016241 3300046458 Bacteria 2602
172 Ga0495591_022210 3300046458 Bacteria 2055
173 Ga0495591_032870 3300046458 Bacteria 1540
174 Ga0495591_051965 3300046458 Bacteria 1116
175 Ga0495638_0003846 3300046460 Bacteria 11661
176 Ga0495638_0004285 3300046460 Bacteria 10824
177 Ga0495638_0027625 3300046460 Bacteria 3671
178 Ga0495638_0043277 3300046460 Bacteria 2841
179 Ga0495638_0052268 3300046460 Bacteria 2545
180 Ga0495638_0055055 3300046460 Bacteria 2471
181 Ga0495638_0055465 3300046460 Bacteria 2460
182 Ga0495638_0073047 3300046460 Bacteria 2094
183 Ga0495638_0074917 3300046460 Bacteria 2063
184 Ga0495638_0110853 3300046460 Bacteria 1630
185 Ga0495638_0130942 3300046460 Bacteria 1473
186 Ga0495638_0203055 3300046460 Bacteria 1118
187 Ga0495650_0007460 3300046471 Bacteria 6564
188 Ga0495650_0083993 3300046471 Bacteria 1222
189 Ga0495582_0018485 3300046473 Bacteria 3811
190 Ga0495605_0009407 3300046474 Bacteria 5489
191 Ga0495605_0019997 3300046474 Bacteria 3563
192 Ga0495605_0020400 3300046474 Bacteria 3522
193 Ga0495605_0034099 3300046474 Bacteria 2579
194 Ga0495605_0155094 3300046474 Bacteria 1019
195 Ga0495639_0015257 3300046475 Bacteria 3330
196 Ga0495639_0133786 3300046475 Bacteria 1188
197 Ga0495584_0001259 3300046491 Bacteria 15455
198 Ga0495584_0004158 3300046491 Bacteria 7813
199 Ga0495584_0014777 3300046491 Bacteria 3977
200 Ga0495584_0017547 3300046491 Bacteria 3642
201 Ga0495585_0003983 3300046492 Bacteria 9739
202 Ga0495585_0013722 3300046492 Bacteria 4735
203 Ga0495585_0037282 3300046492 Bacteria 2738
204 Ga0495585_0048883 3300046492 Bacteria 2350
205 Ga0495585_0051143 3300046492 Bacteria 2290
206 Ga0495585_0115801 3300046492 Bacteria 1421
207 Ga0495585_0117362 3300046492 Bacteria 1410
208 Ga0495585_0150026 3300046492 Bacteria 1216
209 Ga0495594_0041673 3300046499 Bacteria 2513
210 Ga0495596_0001522 3300046500 Bacteria 13225
211 Ga0495607_0003760 3300046501 Bacteria 11473
212 Ga0495607_0013118 3300046501 Bacteria 5440
213 Ga0495607_0031841 3300046501 Bacteria 3225
214 Ga0495607_0058558 3300046501 Bacteria 2201
215 Ga0495607_0073352 3300046501 Bacteria 1903
216 Ga0495607_0256382 3300046501 Bacteria 840
217 Ga0495607_0258664 3300046501 Bacteria 834
218 Ga0495583_0000813 3300046506 Bacteria 38429
219 Ga0495583_0015809 3300046506 Bacteria 4086
220 Ga0495583_0025588 3300046506 Bacteria 2945
221 Ga0495583_0073021 3300046506 Bacteria 1504
222 Ga0495606_0003409 3300046507 Bacteria 16880
223 Ga0495606_0006605 3300046507 Bacteria 10652
224 Ga0495606_0008724 3300046507 Bacteria 8726
225 Ga0495606_0020906 3300046507 Bacteria 4807
226 Ga0495606_0022655 3300046507 Bacteria 4568
227 Ga0495606_0043175 3300046507 Bacteria 3008
228 Ga0495606_0043845 3300046507 Bacteria 2979
229 Ga0495606_0111292 3300046507 Bacteria 1651
230 Ga0495606_0270222 3300046507 Bacteria 934
231 Ga0495610_0008962 3300046512 Bacteria 6398
232 Ga0495610_0012041 3300046512 Bacteria 5236
233 Ga0495610_0013686 3300046512 Bacteria 4807
234 Ga0495610_0025211 3300046512 Bacteria 3196
235 Ga0495610_0029318 3300046512 Bacteria 2899
236 Ga0495610_0036068 3300046512 Bacteria 2531
237 Ga0495610_0037329 3300046512 Bacteria 2474
238 Ga0495610_0097363 3300046512 Bacteria 1323
239 Ga0495610_0110967 3300046512 Bacteria 1215
240 Ga0495620_0000231 3300046515 Bacteria 41704
241 Ga0495620_0006599 3300046515 Bacteria 6363
242 Ga0495620_0013805 3300046515 Bacteria 4128
243 Ga0495620_0022744 3300046515 Bacteria 3012
244 Ga0495620_0031804 3300046515 Bacteria 2412
245 Ga0495628_0172040 3300046516 Bacteria 1642
246 Ga0495630_0033134 3300046517 Bacteria 3852
247 Ga0495630_0070229 3300046517 Bacteria 2635
248 Ga0495630_0072774 3300046517 Bacteria 2587
249 Ga0495630_0156856 3300046517 Bacteria 1732
250 Ga0495631_0000275 3300046518 Bacteria 35971
251 Ga0495631_0031742 3300046518 Bacteria 2385
252 Ga0495631_0041085 3300046518 Bacteria 2047
253 Ga0495632_0003919 3300046519 Bacteria 10335
254 Ga0495632_0012444 3300046519 Bacteria 4908
255 Ga0495632_0017422 3300046519 Bacteria 3965
256 Ga0495632_0079757 3300046519 Bacteria 1562
257 Ga0495632_0114551 3300046519 Bacteria 1264
258 Ga0495637_0000632 3300046520 Bacteria 24749
259 Ga0495637_0002657 3300046520 Bacteria 9779
260 Ga0495637_0022865 3300046520 Bacteria 2845
261 Ga0495637_0023114 3300046520 Bacteria 2829
262 Ga0495637_0027672 3300046520 Bacteria 2534
263 Ga0495637_0028929 3300046520 Bacteria 2470
264 Ga0495637_0037187 3300046520 Bacteria 2115
265 Ga0495637_0050263 3300046520 Bacteria 1749
266 Ga0495643_0029185 3300046522 Bacteria 3087
267 Ga0495643_0048524 3300046522 Bacteria 2294
268 Ga0495643_0058752 3300046522 Bacteria 2045
269 Ga0495643_0147967 3300046522 Bacteria 1165
270 Ga0495643_0148099 3300046522 Bacteria 1165
271 Ga0495644_0012174 3300046523 Bacteria 3306
272 Ga0495644_0048124 3300046523 Bacteria 1601
273 Ga0495648_0002745 3300046524 Bacteria 15897
274 Ga0495648_0003911 3300046524 Bacteria 12903
275 Ga0495648_0005770 3300046524 Bacteria 10213
276 Ga0495648_0007279 3300046524 Bacteria 8879
277 Ga0495648_0009796 3300046524 Bacteria 7372
278 Ga0495648_0034416 3300046524 Bacteria 3296
279 Ga0495648_0047947 3300046524 Bacteria 2634
280 Ga0495648_0084466 3300046524 Bacteria 1796
281 Ga0495648_0108198 3300046524 Bacteria 1518
282 Ga0495648_0215274 3300046524 Bacteria 951
283 Ga0495648_0268404 3300046524 Bacteria 815
284 Ga0495666_0009236 3300046526 Bacteria 4930
285 Ga0495666_0014961 3300046526 Bacteria 3860
286 Ga0495642_0000067 3300046528 Bacteria 61823
287 Ga0495652_0245677 3300046529 Bacteria 1329
288 Ga0495654_0004696 3300046530 Bacteria 8048
289 Ga0495654_0010440 3300046530 Bacteria 5054
290 Ga0495654_0013373 3300046530 Bacteria 4393
291 Ga0495654_0034109 3300046530 Bacteria 2570
292 Ga0495654_0034598 3300046530 Bacteria 2547
293 Ga0495654_0035530 3300046530 Bacteria 2508
294 Ga0495654_0037936 3300046530 Bacteria 2412
295 Ga0495654_0040096 3300046530 Bacteria 2335
296 Ga0495654_0079213 3300046530 Bacteria 1543
297 Ga0495586_0028017 3300046535 Bacteria 3014
298 Ga0495587_0008026 3300046536 Bacteria 6814
299 Ga0495587_0176561 3300046536 Bacteria 1212
300 Ga0495587_0180147 3300046536 Bacteria 1198
301 Ga0495609_0017820 3300046538 Bacteria 3296
302 Ga0495609_0136646 3300046538 Bacteria 1047
303 Ga0495597_0003816 3300046542 Bacteria 8570
304 Ga0495597_0017495 3300046542 Bacteria 3371
305 Ga0495597_0030340 3300046542 Bacteria 2464
306 Ga0495597_0037405 3300046542 Bacteria 2179
307 Ga0495645_0063609 3300046543 Bacteria 2671
308 Ga0495622_0044504 3300046557 Bacteria 2063
309 Ga0495622_0047006 3300046557 Bacteria 2006
310 Ga0495622_0053797 3300046557 Bacteria 1868
311 Ga0495622_0083158 3300046557 Bacteria 1473
312 Ga0495622_0158861 3300046557 Bacteria 1020
313 Ga0495633_0041268 3300046558 Bacteria 2195
314 Ga0495633_0057282 3300046558 Bacteria 1830
315 Ga0495633_0128699 3300046558 Bacteria 1171
316 Ga0495656_0002252 3300046615 Bacteria 6377
317 Ga0495656_0022598 3300046615 Bacteria 2465
318 Ga0495656_0028395 3300046615 Bacteria 2244
319 Ga0495668_0002597 3300046616 Bacteria 14638
320 Ga0495668_0002653 3300046616 Bacteria 14376
321 Ga0495634_0010691 3300046642 Bacteria 6718
322 Ga0495611_0038388 3300046648 Bacteria 2130
323 Ga0495611_0095153 3300046648 Bacteria 1378
324 Ga0495625_0003348 3300046660 Bacteria 16135
325 Ga0495625_0137588 3300046660 Bacteria 1649
326 Ga0495625_0152224 3300046660 Bacteria 1554
327 Ga0495625_0219617 3300046660 Bacteria 1246
328 Ga0495625_0245958 3300046660 Bacteria 1162
329 Ga0495635_0005376 3300046663 Bacteria 8915
330 Ga0495635_0041815 3300046663 Bacteria 3166
331 Ga0495661_0001162 3300046665 Bacteria 22969
332 Ga0495661_0008184 3300046665 Bacteria 7249
333 Ga0495661_0044893 3300046665 Bacteria 2706
334 Ga0495661_0053004 3300046665 Bacteria 2441
335 Ga0495661_0111911 3300046665 Bacteria 1520
336 Ga0495588_0035000 3300046674 Bacteria 2543
337 Ga0495588_0046616 3300046674 Bacteria 2223
338 Ga0495588_0108436 3300046674 Bacteria 1462
339 Ga0495657_0108402 3300046675 Bacteria 1762
340 Ga0495623_0006054 3300046679 Bacteria 7864
341 Ga0495623_0047708 3300046679 Bacteria 2719
342 Ga0495646_0023306 3300046680 Bacteria 3898
343 Ga0495646_0032220 3300046680 Bacteria 3262
344 Ga0495669_0005517 3300046684 Bacteria 5279
345 Ga0495613_0044332 3300046689 Bacteria 3291
346 Ga0495613_0128741 3300046689 Bacteria 1813
347 Ga0495624_0005052 3300046690 Bacteria 9545
348 Ga0495670_0013190 3300046691 Bacteria 4064
349 Ga0495670_0024849 3300046691 Bacteria 2961
350 Ga0495670_0063715 3300046691 Bacteria 1856
351 Ga0495670_0090521 3300046691 Bacteria 1565
352 Ga0495671_0007038 3300046692 Bacteria 6445
353 Ga0495671_0033129 3300046692 Bacteria 2633
354 Ga0495671_0035190 3300046692 Bacteria 2544
355 Ga0495671_0044316 3300046692 Bacteria 2231
356 Ga0495671_0045178 3300046692 Bacteria 2206
357 Ga0495671_0108684 3300046692 Bacteria 1354
358 Ga0495671_0118914 3300046692 Bacteria 1289
359 Ga0495649_0012080 3300046694 Bacteria 5038
360 Ga0495649_0029610 3300046694 Bacteria 3027
361 Ga0495649_0039383 3300046694 Bacteria 2591
362 Ga0495649_0051521 3300046694 Bacteria 2231
363 Ga0495649_0055771 3300046694 Bacteria 2134
364 Ga0495649_0058309 3300046694 Bacteria 2080
365 Ga0495649_0157093 3300046694 Bacteria 1193
366 Ga0495589_0005175 3300046794 Bacteria 6895
367 Ga0495589_0013723 3300046794 Bacteria 4178
368 Ga0495589_0035430 3300046794 Bacteria 2502
369 Ga0495589_0067080 3300046794 Bacteria 1756
370 Ga0495589_0069343 3300046794 Bacteria 1724
371 Ga0495600_0009462 3300046809 Bacteria 6022
372 Ga0495660_0010021 3300046810 Bacteria 5512
373 Ga0495660_0019081 3300046810 Bacteria 3937
374 Ga0495660_0019690 3300046810 Bacteria 3872
375 Ga0495660_0020349 3300046810 Bacteria 3803
376 Ga0495660_0037022 3300046810 Bacteria 2719
377 Ga0495660_0070047 3300046810 Bacteria 1862
378 Ga0495604_0005618 3300047317 Bacteria 9944
379 Ga0495604_0027642 3300047317 Bacteria 4509
380 Ga0495674_0069891 3300047319 Bacteria 3035
381 Ga0495672_0003277 3300047320 Bacteria 14018
382 Ga0495672_0008375 3300047320 Bacteria 7645
383 Ga0495672_0014680 3300047320 Bacteria 5350
384 Ga0495672_0015185 3300047320 Bacteria 5240
385 Ga0495672_0015612 3300047320 Bacteria 5148
386 Ga0495672_0028605 3300047320 Bacteria 3523
387 Ga0495672_0036382 3300047320 Bacteria 3023
388 Ga0495672_0043667 3300047320 Bacteria 2693
389 Ga0495672_0045458 3300047320 Bacteria 2626
390 Ga0495672_0055683 3300047320 Bacteria 2307
391 Ga0495672_0084203 3300047320 Bacteria 1764
392 Ga0495672_0233332 3300047320 Bacteria 902
393 Ga0495676_0152262 3300047321 Bacteria 1644
394 Ga0495680_0030591 3300047322 Bacteria 4394
395 Ga0495680_0097972 3300047322 Bacteria 2188
396 Ga0495680_0112036 3300047322 Bacteria 2021
397 Ga0495680_0254844 3300047322 Bacteria 1242
398 Ga0495683_0003385 3300047323 Bacteria 9315
399 Ga0495683_0104191 3300047323 Bacteria 1361
400 Ga0495687_002144 3300047443 Bacteria 16474
401 Ga0495687_011658 3300047443 Bacteria 4707
402 Ga0495675_0030773 3300047444 Bacteria 3424
403 Ga0495675_0074705 3300047444 Bacteria 2135
404 Ga0495677_0006622 3300047445 Bacteria 4367
405 Ga0495679_001670 3300047446 Bacteria 12333
406 Ga0495679_005475 3300047446 Bacteria 5624
407 Ga0495679_012561 3300047446 Bacteria 3216
408 Ga0495679_013140 3300047446 Bacteria 3121
409 Ga0495679_015057 3300047446 Bacteria 2841
410 Ga0495673_0000077 3300047469 Bacteria 204403
411 Ga0495673_0002071 3300047469 Bacteria 14668
412 Ga0495673_0008979 3300047469 Bacteria 5567
413 Ga0495673_0013504 3300047469 Bacteria 4285
414 Ga0495673_0041702 3300047469 Bacteria 2064
415 Ga0495673_0041960 3300047469 Bacteria 2056
416 Ga0495673_0059926 3300047469 Bacteria 1634
417 Ga0495673_0101838 3300047469 Bacteria 1159
418 Ga0495673_0145557 3300047469 Bacteria 920
419 Ga0495673_0171504 3300047469 Bacteria 826
420 Ga0495681_0001694 3300047470 Bacteria 16333
421 Ga0495681_0027487 3300047470 Bacteria 2941
422 Ga0495681_0031212 3300047470 Bacteria 2701
423 Ga0495681_0032196 3300047470 Bacteria 2642
424 Ga0495681_0040976 3300047470 Bacteria 2251
425 Ga0495681_0042856 3300047470 Bacteria 2187
426 Ga0495684_0081514 3300047471 Bacteria 2455
427 Ga0495684_0137814 3300047471 Bacteria 1830
428 Ga0495686_0023956 3300047472 Bacteria 4014
429 Ga0495686_0062889 3300047472 Bacteria 2301
430 Ga0495593_0007329 3300047673 Bacteria 6462
431 Ga0495593_0019565 3300047673 Bacteria 3795
432 Ga0495593_0028760 3300047673 Bacteria 3051
433 Ga0495593_0175212 3300047673 Bacteria 1080
434 Ga0495602_0009891 3300048088 Bacteria 9895
435 Ga0495614_0129640 3300048089 Bacteria 1115
436 Ga0495626_0000647 3300048091 Bacteria 33586
437 Ga0495626_0000727 3300048091 Bacteria 30796
438 Ga0495626_0002545 3300048091 Bacteria 12517
439 Ga0495626_0003906 3300048091 Bacteria 9338
440 Ga0495626_0009169 3300048091 Bacteria 5361
441 Ga0495626_0053347 3300048091 Bacteria 1861
442 Ga0496102_0000073 3300048905 Bacteria 149887
443 Ga0496103_0027756 3300048906 Bacteria 3433
444 Ga0496107_0411921 3300048910 Bacteria 1005
445 Ga0496112_0277675 3300048915 Bacteria 1623
446 Ga0496115_0091725 3300048918 Bacteria 2483
447 Ga0496116_0000221 3300048919 Bacteria 106314
448 Ga0496116_0023558 3300048919 Bacteria 4582
449 Ga0496116_0031455 3300048919 Bacteria 3798
450 Ga0496117_0002605 3300048920 Bacteria 22421
451 Ga0496117_0009691 3300048920 Bacteria 8904
452 Ga0496117_0016267 3300048920 Bacteria 6286
453 Ga0496117_0046132 3300048920 Bacteria 3137
454 Ga0496117_0049409 3300048920 Bacteria 2992
455 Ga0496117_0062021 3300048920 Bacteria 2565
456 Ga0496117_0140343 3300048920 Bacteria 1448
457 Ga0496117_0242853 3300048920 Bacteria 987
458 Ga0496118_0024655 3300048921 Bacteria 5185
459 Ga0496118_0024888 3300048921 Bacteria 5152
460 Ga0496118_0025424 3300048921 Bacteria 5077
461 Ga0496118_0028686 3300048921 Bacteria 4681
462 Ga0496118_0030667 3300048921 Bacteria 4479
463 Ga0496118_0070625 3300048921 Bacteria 2520
464 Ga0496118_0074477 3300048921 Bacteria 2426
465 Ga0496118_0102511 3300048921 Bacteria 1928
466 Ga0496118_0260643 3300048921 Bacteria 978
467 Ga0496119_0011139 3300048922 Bacteria 7489
468 Ga0496119_0018504 3300048922 Bacteria 5180
469 Ga0496119_0046113 3300048922 Bacteria 2725
470 Ga0496119_0094496 3300048922 Bacteria 1691
471 Ga0496119_0095359 3300048922 Bacteria 1680
472 Ga0496119_0220902 3300048922 Bacteria 970
473 Ga0496120_0006672 3300048923 Bacteria 8800
474 Ga0496120_0015474 3300048923 Bacteria 5027
475 Ga0496120_0037342 3300048923 Bacteria 2883
476 Ga0496120_0084800 3300048923 Bacteria 1706
477 Ga0496121_0000307 3300048924 Bacteria 101849
478 Ga0496121_0107878 3300048924 Bacteria 2131
479 Ga0496121_0120571 3300048924 Bacteria 1981
480 Ga0496121_0130415 3300048924 Bacteria 1882
481 Ga0496122_0005969 3300048925 Bacteria 14254
482 Ga0496122_0010797 3300048925 Bacteria 9357
483 Ga0496122_0029513 3300048925 Bacteria 4624
484 Ga0496122_0049028 3300048925 Bacteria 3240
485 Ga0496122_0079243 3300048925 Bacteria 2296
486 Ga0496123_0004380 3300048926 Bacteria 14895
487 Ga0496123_0007869 3300048926 Bacteria 9908
488 Ga0496123_0022827 3300048926 Bacteria 4807
489 Ga0496123_0053117 3300048926 Bacteria 2681
490 Ga0496124_0012169 3300048927 Bacteria 8517
491 Ga0496124_0024608 3300048927 Bacteria 5469
492 Ga0496124_0062409 3300048927 Bacteria 3118
493 Ga0496124_0208307 3300048927 Bacteria 1481
494 Ga0496125_0000862 3300048928 Bacteria 48602
495 Ga0496125_0002740 3300048928 Bacteria 22304
496 Ga0496125_0034714 3300048928 Bacteria 4439
497 Ga0496125_0056172 3300048928 Bacteria 3200
498 Ga0496125_0073885 3300048928 Bacteria 2647
499 Ga0496125_0133047 3300048928 Bacteria 1746
500 Ga0496126_0026916 3300048929 Bacteria 5504
501 Ga0496126_0039578 3300048929 Bacteria 4373
502 Ga0496126_0077614 3300048929 Bacteria 2944
503 Ga0496126_0125906 3300048929 Bacteria 2217
504 Ga0496126_0258911 3300048929 Bacteria 1447
505 Ga0495678_011179 3300049459 Bacteria 4314
506 Ga0495678_029950 3300049459 Bacteria 2282
507 Ga0495682_0000263 3300049460 Bacteria 41617
508 Ga0495682_0015867 3300049460 Bacteria 2852
509 Ga0495682_0042886 3300049460 Bacteria 1657
510 Ga0495682_0054107 3300049460 Bacteria 1457
511 nmdc:mga00v17_82249_c1 3300050491 Bacteria 2012
512 Ga0500634_0003362 3300053161 Bacteria 7087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0083158 Ga0495622_0083158_14_724 236
2 3300046501 Ga0495607_0256382 Ga0495607_0256382_12_737 240
3 3300006058 Ga0075432_10042407 Ga0075432_100424072 243
4 3300046512 Ga0495610_0110967 Ga0495610_0110967_96_956 243
5 3300047470 Ga0495681_0031212 Ga0495681_0031212_772_1632 243
6 3300046457 Ga0495590_0163281 Ga0495590_0163281_53_790 245
7 3300047469 Ga0495673_0171504 Ga0495673_0171504_29_769 246
8 3300048927 Ga0496124_0024608 Ga0496124_0024608_4706_5452 247
9 3300046794 Ga0495589_0013723 Ga0495589_0013723_1130_1987 252
10 3300047446 Ga0495679_015057 Ga0495679_015057_1025_1882 252
11 3300005288 Ga0065714_10088919 Ga0065714_100889193 253
12 3300048922 Ga0496119_0011139 Ga0496119_0011139_4439_5296 255
13 3300048923 Ga0496120_0006672 Ga0496120_0006672_5555_6412 255
14 3300027907 Ga0207428_10029342 Ga0207428_100293423 256
15 3300046458 Ga0495591_051965 Ga0495591_051965_18_791 256
16 3300047446 Ga0495679_001670 Ga0495679_001670_5841_6698 257
17 3300006914 Ga0075436_100110392 Ga0075436_1001103921 261
18 3300046460 Ga0495638_0073047 Ga0495638_0073047_751_1620 262
19 3300046501 Ga0495607_0258664 Ga0495607_0258664_30_821 262
20 3300046522 Ga0495643_0048524 Ga0495643_0048524_598_1467 262
21 3300046524 Ga0495648_0268404 Ga0495648_0268404_10_801 262
22 3300046536 Ga0495587_0176561 Ga0495587_0176561_145_1008 262
23 3300046694 Ga0495649_0055771 Ga0495649_0055771_626_1495 262
24 3300046810 Ga0495660_0070047 Ga0495660_0070047_618_1487 262
25 3300049460 Ga0495682_0000263 Ga0495682_0000263_1227_2090 262
26 3300017792 Ga0163161_10182530 Ga0163161_101825301 263
27 3300041411 Ga0439466_0003304 Ga0439466_0003304_2846_3706 263
28 3300042016 Ga0439463_003863 Ga0439463_003863_1496_2356 263
29 3300046453 Ga0495627_001501 Ga0495627_001501_5962_6819 263
30 3300046458 Ga0495591_002186 Ga0495591_002186_5181_6038 263
31 3300046501 Ga0495607_0013118 Ga0495607_0013118_2810_3667 263
32 3300046519 Ga0495632_0012444 Ga0495632_0012444_712_1569 263
33 3300046665 Ga0495661_0001162 Ga0495661_0001162_5857_6714 263
34 3300047470 Ga0495681_0027487 Ga0495681_0027487_1190_2047 263
35 3300046507 Ga0495606_0270222 Ga0495606_0270222_14_808 264
36 3300048928 Ga0496125_0073885 Ga0496125_0073885_1229_2083 264
37 3300005834 Ga0068851_10000132 Ga0068851_100001326 265
38 3300025321 Ga0207656_10000880 Ga0207656_100008807 265
39 3300046524 Ga0495648_0084466 Ga0495648_0084466_579_1436 265
40 3300046520 Ga0495637_0027672 Ga0495637_0027672_531_1388 267
41 3300046558 Ga0495633_0041268 Ga0495633_0041268_201_1064 268
42 3300047320 Ga0495672_0055683 Ga0495672_0055683_341_1204 268
43 3300046512 Ga0495610_0097363 Ga0495610_0097363_16_873 269
44 3300017792 Ga0163161_10043048 Ga0163161_100430484 270
45 3300047446 Ga0495679_005475 Ga0495679_005475_1315_2172 270
46 3300048928 Ga0496125_0034714 Ga0496125_0034714_1374_2231 270
47 3300005344 Ga0070661_100000036 Ga0070661_1000000362 271
48 3300005353 Ga0070669_100000891 Ga0070669_1000008916 271
49 3300005564 Ga0070664_100000275 Ga0070664_1000002753 271
50 3300009011 Ga0105251_10001353 Ga0105251_1000135313 271
51 3300009036 Ga0105244_10000801 Ga0105244_1000080123 271
52 3300009176 Ga0105242_10003661 Ga0105242_100036613 271
53 3300009545 Ga0105237_10001372 Ga0105237_100013723 271
54 3300011119 Ga0105246_10011012 Ga0105246_100110122 271
55 3300013100 Ga0157373_10235217 Ga0157373_102352172 271
56 3300013104 Ga0157370_10156727 Ga0157370_101567271 271
57 3300013105 Ga0157369_10005184 Ga0157369_1000518411 271
58 3300013105 Ga0157369_10008823 Ga0157369_100088236 271
59 3300013105 Ga0157369_10083900 Ga0157369_100839001 271
60 3300013308 Ga0157375_10045094 Ga0157375_100450942 271
61 3300017792 Ga0163161_10022110 Ga0163161_100221105 271
62 3300025728 Ga0207655_1000173 Ga0207655_100017398 271
63 3300025735 Ga0207713_1002307 Ga0207713_10023077 271
64 3300025914 Ga0207671_10001354 Ga0207671_1000135421 271
65 3300025920 Ga0207649_10000042 Ga0207649_1000004210 271
66 3300025923 Ga0207681_10004855 Ga0207681_100048557 271
67 3300025945 Ga0207679_10000044 Ga0207679_10000044108 271
68 3300046460 Ga0495638_0052268 Ga0495638_0052268_1028_1885 271
69 3300046501 Ga0495607_0058558 Ga0495607_0058558_691_1548 271
70 3300046507 Ga0495606_0020906 Ga0495606_0020906_1571_2428 271
71 3300046507 Ga0495606_0111292 Ga0495606_0111292_571_1428 271
72 3300046512 Ga0495610_0025211 Ga0495610_0025211_1451_2308 271
73 3300046512 Ga0495610_0036068 Ga0495610_0036068_505_1362 271
74 3300046515 Ga0495620_0006599 Ga0495620_0006599_3192_4049 271
75 3300046660 Ga0495625_0003348 Ga0495625_0003348_6055_6912 271
76 3300046690 Ga0495624_0005052 Ga0495624_0005052_7373_8230 271
77 3300046809 Ga0495600_0009462 Ga0495600_0009462_4389_5246 271
78 3300046810 Ga0495660_0019081 Ga0495660_0019081_932_1789 271
79 3300047320 Ga0495672_0008375 Ga0495672_0008375_5473_6330 271
80 3300047323 Ga0495683_0003385 Ga0495683_0003385_6041_6898 271
81 3300047470 Ga0495681_0040976 Ga0495681_0040976_1311_2168 271
82 3300048920 Ga0496117_0002605 Ga0496117_0002605_15609_16466 271
83 3300048921 Ga0496118_0102511 Ga0496118_0102511_476_1333 271
84 3300048922 Ga0496119_0018504 Ga0496119_0018504_3805_4662 271
85 3300048922 Ga0496119_0220902 Ga0496119_0220902_101_958 271
86 3300048923 Ga0496120_0015474 Ga0496120_0015474_1135_1992 271
87 3300048925 Ga0496122_0079243 Ga0496122_0079243_286_1143 271
88 3300048926 Ga0496123_0053117 Ga0496123_0053117_1140_1997 271
89 3300048927 Ga0496124_0012169 Ga0496124_0012169_5907_6764 271
90 3300048928 Ga0496125_0002740 Ga0496125_0002740_5910_6767 271
91 3300048929 Ga0496126_0125906 Ga0496126_0125906_567_1424 271
92 3300005288 Ga0065714_10068521 Ga0065714_100685214 272
93 3300005331 Ga0070670_100000303 Ga0070670_10000030338 272
94 3300005331 Ga0070670_100004984 Ga0070670_1000049846 272
95 3300005457 Ga0070662_100001590 Ga0070662_1000015903 272
96 3300005539 Ga0068853_100023697 Ga0068853_1000236975 272
97 3300014497 Ga0182008_10008636 Ga0182008_100086364 272
98 3300015261 Ga0182006_1001855 Ga0182006_10018557 272
99 3300017792 Ga0163161_10025470 Ga0163161_100254703 272
100 3300025925 Ga0207650_10000068 Ga0207650_10000068127 272
101 3300025925 Ga0207650_10000240 Ga0207650_1000024011 272
102 3300025933 Ga0207706_10063620 Ga0207706_100636202 272
103 3300041407 Ga0439447_033104 Ga0439447_033104_177_1034 272
104 3300042006 Ga0439432_001132 Ga0439432_001132_3389_4246 272
105 3300046519 Ga0495632_0079757 Ga0495632_0079757_104_961 272
106 3300046530 Ga0495654_0004696 Ga0495654_0004696_2568_3425 272
107 3300048920 Ga0496117_0049409 Ga0496117_0049409_1197_2054 272
108 3300048928 Ga0496125_0056172 Ga0496125_0056172_1630_2487 272
109 3300009011 Ga0105251_10000168 Ga0105251_100001684 274
110 3300009092 Ga0105250_10000122 Ga0105250_1000012265 274
111 3300011119 Ga0105246_10007319 Ga0105246_100073193 274
112 3300013100 Ga0157373_10002739 Ga0157373_100027397 274
113 3300014497 Ga0182008_10010543 Ga0182008_100105433 274
114 3300015262 Ga0182007_10001820 Ga0182007_100018206 274
115 3300025711 Ga0207696_1000264 Ga0207696_100026465 274
116 3300025735 Ga0207713_1000020 Ga0207713_1000020219 274
117 3300048920 Ga0496117_0062021 Ga0496117_0062021_630_1487 274
118 3300048921 Ga0496118_0074477 Ga0496118_0074477_420_1277 274
119 3300009036 Ga0105244_10002677 Ga0105244_100026776 275
120 3300013308 Ga0157375_10001567 Ga0157375_100015678 275
121 3300025728 Ga0207655_1002917 Ga0207655_10029176 275
122 3300046506 Ga0495583_0000813 Ga0495583_0000813_5993_6850 275
123 3300005290 Ga0065712_10138491 Ga0065712_101384912 276
124 3300009092 Ga0105250_10000583 Ga0105250_1000058319 276
125 3300013308 Ga0157375_10025255 Ga0157375_100252555 276
126 3300025711 Ga0207696_1000108 Ga0207696_1000108115 276
127 3300042135 Ga0450899_005173 Ga0450899_005173_139_996 276
128 3300046507 Ga0495606_0043845 Ga0495606_0043845_24_881 276
129 3300046692 Ga0495671_0007038 Ga0495671_0007038_1567_2424 276
130 3300046692 Ga0495671_0045178 Ga0495671_0045178_303_1160 276
131 3300047320 Ga0495672_0014680 Ga0495672_0014680_4442_5317 276
132 3300047446 Ga0495679_013140 Ga0495679_013140_1092_1949 276
133 3300048924 Ga0496121_0130415 Ga0496121_0130415_651_1508 276
134 3300048925 Ga0496122_0010797 Ga0496122_0010797_1534_2391 276
135 3300048925 Ga0496122_0029513 Ga0496122_0029513_1923_2780 276
136 3300048926 Ga0496123_0007869 Ga0496123_0007869_3024_3881 276
137 3300048926 Ga0496123_0022827 Ga0496123_0022827_2022_2879 276
138 3300048928 Ga0496125_0000862 Ga0496125_0000862_5508_6365 276
139 3300017792 Ga0163161_10363541 Ga0163161_103635411 277
140 3300046460 Ga0495638_0003846 Ga0495638_0003846_1866_2726 277
141 3300046515 Ga0495620_0000231 Ga0495620_0000231_14503_15363 277
142 3300046694 Ga0495649_0039383 Ga0495649_0039383_585_1442 277
143 iso_pu_bacteria 8056172158 8056173785 277
144 3300006058 Ga0075432_10009815 Ga0075432_100098152 278
145 3300027907 Ga0207428_10052164 Ga0207428_100521643 278
146 3300046491 Ga0495584_0017547 Ga0495584_0017547_753_1610 278
147 3300046515 Ga0495620_0031804 Ga0495620_0031804_784_1641 278
148 3300046810 Ga0495660_0010021 Ga0495660_0010021_960_1817 278
149 iso_pu_bacteria 2946006987 2946008995 278
150 3300006058 Ga0075432_10046795 Ga0075432_100467952 279
151 3300009011 Ga0105251_10005941 Ga0105251_100059415 279
152 3300017792 Ga0163161_10172005 Ga0163161_101720051 279
153 3300025735 Ga0207713_1002121 Ga0207713_100212110 279
154 3300031731 Ga0307405_10008864 Ga0307405_100088645 279
155 3300048920 Ga0496117_0009691 Ga0496117_0009691_4501_5358 279
156 3300048921 Ga0496118_0024888 Ga0496118_0024888_4110_4967 279
157 3300048927 Ga0496124_0062409 Ga0496124_0062409_585_1442 279
158 3300048929 Ga0496126_0026916 Ga0496126_0026916_2516_3373 279
159 3300048929 Ga0496126_0077614 Ga0496126_0077614_814_1671 279
160 3300048929 Ga0496126_0258911 Ga0496126_0258911_362_1219 279
161 3300046460 Ga0495638_0055055 Ga0495638_0055055_596_1456 280
162 iso_pu_bacteria 2511231010 2511289068 280
163 iso_pu_bacteria 2511231011 2511296224 280
164 iso_pu_bacteria 2597489888 2597864675 280
165 iso_pu_bacteria 2597489889 2597870485 280
166 iso_pu_bacteria 2599185167 2599397848 280
167 iso_pu_bacteria 2599185179 2599452295 280
168 iso_pu_bacteria 2599185189 2599506873 280
169 iso_pu_bacteria 2599185190 2599513326 280
170 iso_pu_bacteria 2599185191 2599518174 280
171 iso_pu_bacteria 2599185288 2599877966 280
172 iso_pu_bacteria 2599185290 2599892002 280
173 iso_pu_bacteria 2599185303 2599952226 280
174 iso_pu_bacteria 2600255296 2601690034 280
175 iso_pu_bacteria 2600255318 2601797091 280
176 iso_pu_bacteria 2603880185 2606076178 280
177 iso_pu_bacteria 2603880199 2606131088 280
178 iso_pu_bacteria 2619619299 2621298809 280
179 iso_pu_bacteria 2643221571 2643871377 280
180 iso_pu_bacteria 2643221713 2644622806 280
181 iso_pu_bacteria 2675903420 2677900718 280
182 iso_pu_bacteria 2713897149 2715755884 280
183 iso_pu_bacteria 2721755607 2723249453 280
184 iso_pu_bacteria 2738541265 2738672057 280
185 iso_pu_bacteria 2738541282 2738750450 280
186 iso_pu_bacteria 2738541294 2738810050 280
187 iso_pu_bacteria 2738541303 2738859491 280
188 iso_pu_bacteria 2738541309 2738897410 280
189 iso_pu_bacteria 2784132063 2784265019 280
190 iso_pu_bacteria 2808606385 2808976981 280
191 iso_pu_bacteria 2808606388 2808992136 280
192 iso_pu_bacteria 2816332298 2817492030 280
193 iso_pu_bacteria 2834028612 2834032840 280
194 iso_pu_bacteria 2842826826 2842828195 280
195 iso_pu_bacteria 2842837860 2842841211 280
196 iso_pu_bacteria 2852612431 2852613685 280
197 iso_pu_bacteria 2852657418 2852659538 280
198 iso_pu_bacteria 2852667396 2852668579 280
199 iso_pu_bacteria 2860867994 2860871174 280
200 iso_pu_bacteria 2878029506 2878033338 280
201 iso_pu_bacteria 2880230671 2880232942 280
202 iso_pu_bacteria 2908446538 2908450520 280
203 iso_pu_bacteria 2919063839 2919066960 280
204 iso_pu_bacteria 2929189879 2929193245 280
205 iso_pu_bacteria 2931390751 2931394523 280
206 iso_pu_bacteria 2945928738 2945934212 280
207 iso_pu_bacteria 2945961074 2945964832 280
208 iso_pu_bacteria 2946027586 2946031526 280
209 iso_pu_bacteria 2947233263 2947238490 280
210 iso_pu_bacteria 8019769354 8019775042 280
211 iso_pu_bacteria 8054285046 8054288371 280
212 iso_pu_bacteria 8054347763 8054348915 280
213 iso_pu_bacteria 8054503363 8054507035 280
214 iso_pu_bacteria 8055817908 8055821992 280
215 iso_pu_bacteria 8056131705 8056135466 280
216 iso_pu_bacteria 8056148874 8056154453 280
217 iso_pu_bacteria 8056161164 8056165268 280
218 iso_pu_bacteria 8057798959 8057799972 280
219 3300003791 Ga0055530_10007832 Ga0055530_100078322 281
220 3300025292 Ga0209676_1004916 Ga0209676_10049166 281
221 3300025298 Ga0209050_1000914 Ga0209050_100091434 281
222 3300025303 Ga0209051_1002770 Ga0209051_10027707 281
223 3300046460 Ga0495638_0004285 Ga0495638_0004285_2743_3588 281
224 3300046473 Ga0495582_0018485 Ga0495582_0018485_1772_2617 281
225 3300046475 Ga0495639_0015257 Ga0495639_0015257_1200_2045 281
226 3300046499 Ga0495594_0041673 Ga0495594_0041673_951_1796 281
227 3300046501 Ga0495607_0073352 Ga0495607_0073352_92_937 281
228 3300046517 Ga0495630_0033134 Ga0495630_0033134_855_1700 281
229 3300046517 Ga0495630_0070229 Ga0495630_0070229_1120_1965 281
230 3300046519 Ga0495632_0017422 Ga0495632_0017422_2005_2850 281
231 3300046520 Ga0495637_0022865 Ga0495637_0022865_673_1518 281
232 3300046522 Ga0495643_0147967 Ga0495643_0147967_152_997 281
233 3300046526 Ga0495666_0009236 Ga0495666_0009236_2375_3220 281
234 3300046530 Ga0495654_0034598 Ga0495654_0034598_534_1379 281
235 3300046535 Ga0495586_0028017 Ga0495586_0028017_964_1809 281
236 3300046543 Ga0495645_0063609 Ga0495645_0063609_603_1448 281
237 3300046680 Ga0495646_0023306 Ga0495646_0023306_2254_3099 281
238 3300046689 Ga0495613_0044332 Ga0495613_0044332_1828_2673 281
239 3300046794 Ga0495589_0067080 Ga0495589_0067080_126_971 281
240 3300047317 Ga0495604_0005618 Ga0495604_0005618_2245_3090 281
241 3300047322 Ga0495680_0112036 Ga0495680_0112036_43_888 281
242 3300047444 Ga0495675_0030773 Ga0495675_0030773_2392_3237 281
243 3300047673 Ga0495593_0028760 Ga0495593_0028760_1574_2419 281
244 iso_pu_bacteria 2511231012 2511300326 281
245 iso_pu_bacteria 2511231014 2511314658 281
246 iso_pu_bacteria 2511231015 2511322871 281
247 iso_pu_bacteria 2511231017 2511331391 281
248 iso_pu_bacteria 2511231018 2511336165 281
249 iso_pu_bacteria 2511231019 2511342250 281
250 iso_pu_bacteria 2511231020 2511348471 281
251 iso_pu_bacteria 2738543015 2739258606 281
252 iso_pu_bacteria 2860339153 2860342325 281
253 iso_pu_bacteria 2904550169 2904550559 281
254 iso_pu_bacteria 2919456309 2919459007 281
255 iso_pu_bacteria 2931396565 2931402408 281
256 iso_pu_bacteria 3007511990 3007514606 281
257 iso_pu_bacteria 3007619802 3007621837 281
258 3300046694 Ga0495649_0157093 Ga0495649_0157093_52_900 282
259 3300047320 Ga0495672_0036382 Ga0495672_0036382_997_1845 282
260 3300048920 Ga0496117_0046132 Ga0496117_0046132_1156_2007 282
261 3300048921 Ga0496118_0028686 Ga0496118_0028686_1211_2062 282
262 iso_pu_bacteria 2511231006 2511263765 282
263 iso_pu_bacteria 2582580891 2583793007 282
264 iso_pu_bacteria 2597489887 2597857547 282
265 iso_pu_bacteria 2599185185 2599484528 282
266 iso_pu_bacteria 2599185257 2599802207 282
267 iso_pu_bacteria 2600254931 2600366958 282
268 iso_pu_bacteria 2671180172 2671770174 282
269 iso_pu_bacteria 2984286254 2984290027 282
270 iso_pu_bacteria 3007395558 3007401542 282
271 3300046458 Ga0495591_022210 Ga0495591_022210_83_937 283
272 3300046474 Ga0495605_0155094 Ga0495605_0155094_56_910 283
273 3300046492 Ga0495585_0003983 Ga0495585_0003983_1570_2424 283
274 3300046520 Ga0495637_0028929 Ga0495637_0028929_705_1559 283
275 3300046522 Ga0495643_0148099 Ga0495643_0148099_220_1074 283
276 3300046524 Ga0495648_0007279 Ga0495648_0007279_754_1608 283
277 3300046530 Ga0495654_0040096 Ga0495654_0040096_694_1548 283
278 3300046557 Ga0495622_0053797 Ga0495622_0053797_207_1061 283
279 3300046648 Ga0495611_0038388 Ga0495611_0038388_664_1518 283
280 3300046692 Ga0495671_0035190 Ga0495671_0035190_808_1662 283
281 3300046694 Ga0495649_0029610 Ga0495649_0029610_1371_2225 283
282 3300046794 Ga0495589_0035430 Ga0495589_0035430_1259_2113 283
283 3300046810 Ga0495660_0020349 Ga0495660_0020349_488_1342 283
284 3300047469 Ga0495673_0041960 Ga0495673_0041960_954_1805 283
285 3300048091 Ga0495626_0009169 Ga0495626_0009169_678_1532 283
286 3300048919 Ga0496116_0023558 Ga0496116_0023558_981_1835 283
287 3300048925 Ga0496122_0049028 Ga0496122_0049028_1205_2059 283
288 iso_pu_bacteria 2512047018 2512327041 283
289 iso_pu_bacteria 2740892503 2743736968 283
290 iso_pu_bacteria 2923153595 2923155998 283
291 iso_pu_bacteria 8055770955 8055773352 283
292 3300003781 Ga0055536_1000247 Ga0055536_100024717 284
293 3300005548 Ga0070665_100272990 Ga0070665_1002729902 284
294 3300009011 Ga0105251_10031946 Ga0105251_100319461 284
295 3300009011 Ga0105251_10114361 Ga0105251_101143611 284
296 3300009036 Ga0105244_10002826 Ga0105244_100028266 284
297 3300009036 Ga0105244_10046496 Ga0105244_100464962 284
298 3300009092 Ga0105250_10000591 Ga0105250_1000059116 284
299 3300009092 Ga0105250_10033711 Ga0105250_100337112 284
300 3300013100 Ga0157373_10000784 Ga0157373_1000078416 284
301 3300013100 Ga0157373_10034006 Ga0157373_100340064 284
302 3300013307 Ga0157372_10009492 Ga0157372_100094926 284
303 3300014497 Ga0182008_10005142 Ga0182008_100051427 284
304 3300015261 Ga0182006_1006100 Ga0182006_10061003 284
305 3300015261 Ga0182006_1028140 Ga0182006_10281402 284
306 3300015265 Ga0182005_1020183 Ga0182005_10201832 284
307 3300017792 Ga0163161_10111018 Ga0163161_101110182 284
308 3300025711 Ga0207696_1000051 Ga0207696_1000051100 284
309 3300025711 Ga0207696_1007743 Ga0207696_10077433 284
310 3300025728 Ga0207655_1001582 Ga0207655_100158216 284
311 3300025728 Ga0207655_1010438 Ga0207655_10104386 284
312 3300025735 Ga0207713_1005552 Ga0207713_10055525 284
313 3300025735 Ga0207713_1026659 Ga0207713_10266591 284
314 3300028786 Ga0307517_10108361 Ga0307517_101083613 284
315 3300031911 Ga0307412_10154313 Ga0307412_101543131 284
316 3300046454 Ga0495592_0168844 Ga0495592_0168844_495_1352 284
317 3300046458 Ga0495591_014717 Ga0495591_014717_1461_2318 284
318 3300046492 Ga0495585_0117362 Ga0495585_0117362_95_952 284
319 3300046507 Ga0495606_0008724 Ga0495606_0008724_5627_6484 284
320 3300046512 Ga0495610_0008962 Ga0495610_0008962_3983_4840 284
321 3300046520 Ga0495637_0023114 Ga0495637_0023114_1965_2819 284
322 3300046530 Ga0495654_0013373 Ga0495654_0013373_1361_2218 284
323 3300046530 Ga0495654_0037936 Ga0495654_0037936_478_1335 284
324 3300046530 Ga0495654_0079213 Ga0495654_0079213_421_1278 284
325 3300046536 Ga0495587_0180147 Ga0495587_0180147_265_1122 284
326 3300046665 Ga0495661_0008184 Ga0495661_0008184_2211_3068 284
327 3300046674 Ga0495588_0108436 Ga0495588_0108436_44_901 284
328 3300046680 Ga0495646_0032220 Ga0495646_0032220_1450_2307 284
329 3300046689 Ga0495613_0128741 Ga0495613_0128741_221_1078 284
330 3300046794 Ga0495589_0069343 Ga0495589_0069343_416_1273 284
331 3300047317 Ga0495604_0027642 Ga0495604_0027642_1786_2643 284
332 3300047320 Ga0495672_0084203 Ga0495672_0084203_148_1005 284
333 3300047321 Ga0495676_0152262 Ga0495676_0152262_744_1601 284
334 3300047471 Ga0495684_0137814 Ga0495684_0137814_248_1105 284
335 3300047673 Ga0495593_0019565 Ga0495593_0019565_309_1166 284
336 3300048088 Ga0495602_0009891 Ga0495602_0009891_7270_8127 284
337 3300048091 Ga0495626_0000647 Ga0495626_0000647_12538_13392 284
338 3300048919 Ga0496116_0031455 Ga0496116_0031455_1917_2774 284
339 3300048920 Ga0496117_0140343 Ga0496117_0140343_21_884 284
340 3300048921 Ga0496118_0030667 Ga0496118_0030667_3210_4067 284
341 3300048921 Ga0496118_0260643 Ga0496118_0260643_95_958 284
342 3300048922 Ga0496119_0046113 Ga0496119_0046113_705_1562 284
343 3300048922 Ga0496119_0095359 Ga0496119_0095359_400_1257 284
344 3300048923 Ga0496120_0037342 Ga0496120_0037342_1268_2125 284
345 3300048923 Ga0496120_0084800 Ga0496120_0084800_456_1313 284
346 3300048924 Ga0496121_0120571 Ga0496121_0120571_644_1501 284
347 3300048928 Ga0496125_0133047 Ga0496125_0133047_632_1489 284
348 3300053161 Ga0500634_0003362 Ga0500634_0003362_1969_2826 284
349 3300005288 Ga0065714_10009491 Ga0065714_100094912 285
350 3300005288 Ga0065714_10015504 Ga0065714_100155043 285
351 3300005288 Ga0065714_10089615 Ga0065714_100896153 285
352 3300005288 Ga0065714_10091359 Ga0065714_100913592 285
353 3300005289 Ga0065704_10143356 Ga0065704_101433563 285
354 3300006051 Ga0075364_10099480 Ga0075364_100994802 285
355 3300006058 Ga0075432_10004417 Ga0075432_100044172 285
356 3300006058 Ga0075432_10029657 Ga0075432_100296572 285
357 3300006058 Ga0075432_10053649 Ga0075432_100536492 285
358 3300006914 Ga0075436_100323668 Ga0075436_1003236682 285
359 3300009011 Ga0105251_10062852 Ga0105251_100628523 285
360 3300009036 Ga0105244_10033024 Ga0105244_100330243 285
361 3300013102 Ga0157371_10000771 Ga0157371_1000077114 285
362 3300013104 Ga0157370_10031156 Ga0157370_100311563 285
363 3300013104 Ga0157370_10074440 Ga0157370_100744401 285
364 3300014497 Ga0182008_10042632 Ga0182008_100426322 285
365 3300015261 Ga0182006_1010465 Ga0182006_10104654 285
366 3300015265 Ga0182005_1001427 Ga0182005_10014277 285
367 3300017792 Ga0163161_10085150 Ga0163161_100851502 285
368 3300017792 Ga0163161_10307702 Ga0163161_103077021 285
369 3300025728 Ga0207655_1025183 Ga0207655_10251834 285
370 3300025728 Ga0207655_1029183 Ga0207655_10291832 285
371 3300025735 Ga0207713_1008034 Ga0207713_10080343 285
372 3300027907 Ga0207428_10158460 Ga0207428_101584603 285
373 3300030521 Ga0307511_10076457 Ga0307511_100764572 285
374 3300041405 Ga0439438_015042 Ga0439438_015042_54_914 285
375 3300041405 Ga0439438_026174 Ga0439438_026174_221_1078 285
376 3300041407 Ga0439447_002212 Ga0439447_002212_527_1387 285
377 3300042006 Ga0439432_006138 Ga0439432_006138_532_1392 285
378 3300042009 Ga0439451_006463 Ga0439451_006463_505_1365 285
379 3300042010 Ga0439452_011826 Ga0439452_011826_344_1204 285
380 3300042010 Ga0439452_015042 Ga0439452_015042_1048_1908 285
381 3300042146 Ga0450907_000140 Ga0450907_000140_24418_25278 285
382 3300042156 Ga0439446_0030566 Ga0439446_0030566_10_870 285
383 3300042185 Ga0450909_006821 Ga0450909_006821_359_1219 285
384 3300042435 Ga0439434_0000827 Ga0439434_0000827_5748_6608 285
385 3300042993 Ga0439440_0002114 Ga0439440_0002114_1738_2598 285
386 3300046452 Ga0495617_000954 Ga0495617_000954_6455_7312 285
387 3300046452 Ga0495617_004226 Ga0495617_004226_2088_2948 285
388 3300046452 Ga0495617_014223 Ga0495617_014223_1211_2068 285
389 3300046452 Ga0495617_025484 Ga0495617_025484_59_919 285
390 3300046453 Ga0495627_020048 Ga0495627_020048_1105_1962 285
391 3300046453 Ga0495627_024162 Ga0495627_024162_549_1406 285
392 3300046455 Ga0495603_0007516 Ga0495603_0007516_4786_5646 285
393 3300046455 Ga0495603_0008796 Ga0495603_0008796_2469_3329 285
394 3300046457 Ga0495590_0001143 Ga0495590_0001143_10591_11448 285
395 3300046457 Ga0495590_0004895 Ga0495590_0004895_3862_4719 285
396 3300046457 Ga0495590_0096868 Ga0495590_0096868_102_959 285
397 3300046458 Ga0495591_000533 Ga0495591_000533_16760_17617 285
398 3300046458 Ga0495591_016241 Ga0495591_016241_79_936 285
399 3300046458 Ga0495591_032870 Ga0495591_032870_590_1450 285
400 3300046460 Ga0495638_0027625 Ga0495638_0027625_1615_2472 285
401 3300046460 Ga0495638_0043277 Ga0495638_0043277_1878_2735 285
402 3300046460 Ga0495638_0055465 Ga0495638_0055465_567_1424 285
403 3300046460 Ga0495638_0074917 Ga0495638_0074917_992_1849 285
404 3300046460 Ga0495638_0110853 Ga0495638_0110853_696_1553 285
405 3300046460 Ga0495638_0130942 Ga0495638_0130942_565_1422 285
406 3300046460 Ga0495638_0203055 Ga0495638_0203055_139_996 285
407 3300046471 Ga0495650_0007460 Ga0495650_0007460_2128_2988 285
408 3300046471 Ga0495650_0083993 Ga0495650_0083993_159_1016 285
409 3300046474 Ga0495605_0009407 Ga0495605_0009407_3617_4477 285
410 3300046474 Ga0495605_0019997 Ga0495605_0019997_63_920 285
411 3300046474 Ga0495605_0020400 Ga0495605_0020400_1762_2619 285
412 3300046474 Ga0495605_0034099 Ga0495605_0034099_922_1779 285
413 3300046475 Ga0495639_0133786 Ga0495639_0133786_253_1110 285
414 3300046491 Ga0495584_0001259 Ga0495584_0001259_2421_3278 285
415 3300046491 Ga0495584_0004158 Ga0495584_0004158_4291_5148 285
416 3300046491 Ga0495584_0014777 Ga0495584_0014777_2244_3101 285
417 3300046492 Ga0495585_0013722 Ga0495585_0013722_1815_2675 285
418 3300046492 Ga0495585_0037282 Ga0495585_0037282_558_1418 285
419 3300046492 Ga0495585_0048883 Ga0495585_0048883_250_1110 285
420 3300046492 Ga0495585_0051143 Ga0495585_0051143_682_1539 285
421 3300046492 Ga0495585_0115801 Ga0495585_0115801_250_1110 285
422 3300046492 Ga0495585_0150026 Ga0495585_0150026_301_1158 285
423 3300046500 Ga0495596_0001522 Ga0495596_0001522_506_1363 285
424 3300046501 Ga0495607_0003760 Ga0495607_0003760_9801_10661 285
425 3300046501 Ga0495607_0031841 Ga0495607_0031841_2262_3119 285
426 3300046506 Ga0495583_0015809 Ga0495583_0015809_2325_3182 285
427 3300046506 Ga0495583_0025588 Ga0495583_0025588_945_1802 285
428 3300046506 Ga0495583_0073021 Ga0495583_0073021_430_1290 285
429 3300046507 Ga0495606_0003409 Ga0495606_0003409_5994_6851 285
430 3300046507 Ga0495606_0006605 Ga0495606_0006605_344_1201 285
431 3300046507 Ga0495606_0022655 Ga0495606_0022655_1558_2418 285
432 3300046507 Ga0495606_0043175 Ga0495606_0043175_458_1315 285
433 3300046512 Ga0495610_0012041 Ga0495610_0012041_2668_3525 285
434 3300046512 Ga0495610_0013686 Ga0495610_0013686_307_1164 285
435 3300046512 Ga0495610_0029318 Ga0495610_0029318_1969_2826 285
436 3300046512 Ga0495610_0037329 Ga0495610_0037329_984_1841 285
437 3300046515 Ga0495620_0013805 Ga0495620_0013805_1400_2257 285
438 3300046515 Ga0495620_0022744 Ga0495620_0022744_1422_2279 285
439 3300046516 Ga0495628_0172040 Ga0495628_0172040_20_877 285
440 3300046517 Ga0495630_0072774 Ga0495630_0072774_938_1795 285
441 3300046517 Ga0495630_0156856 Ga0495630_0156856_512_1369 285
442 3300046518 Ga0495631_0000275 Ga0495631_0000275_2358_3218 285
443 3300046518 Ga0495631_0031742 Ga0495631_0031742_107_964 285
444 3300046518 Ga0495631_0041085 Ga0495631_0041085_80_940 285
445 3300046519 Ga0495632_0003919 Ga0495632_0003919_2598_3458 285
446 3300046519 Ga0495632_0114551 Ga0495632_0114551_332_1189 285
447 3300046520 Ga0495637_0000632 Ga0495637_0000632_7135_7992 285
448 3300046520 Ga0495637_0002657 Ga0495637_0002657_6796_7656 285
449 3300046520 Ga0495637_0037187 Ga0495637_0037187_527_1384 285
450 3300046520 Ga0495637_0050263 Ga0495637_0050263_48_905 285
451 3300046522 Ga0495643_0029185 Ga0495643_0029185_81_941 285
452 3300046522 Ga0495643_0058752 Ga0495643_0058752_1105_1965 285
453 3300046523 Ga0495644_0012174 Ga0495644_0012174_1919_2776 285
454 3300046523 Ga0495644_0048124 Ga0495644_0048124_678_1538 285
455 3300046524 Ga0495648_0002745 Ga0495648_0002745_6695_7552 285
456 3300046524 Ga0495648_0003911 Ga0495648_0003911_6046_6903 285
457 3300046524 Ga0495648_0005770 Ga0495648_0005770_2140_3000 285
458 3300046524 Ga0495648_0009796 Ga0495648_0009796_345_1202 285
459 3300046524 Ga0495648_0034416 Ga0495648_0034416_1623_2483 285
460 3300046524 Ga0495648_0047947 Ga0495648_0047947_826_1683 285
461 3300046524 Ga0495648_0108198 Ga0495648_0108198_229_1089 285
462 3300046524 Ga0495648_0215274 Ga0495648_0215274_72_929 285
463 3300046526 Ga0495666_0014961 Ga0495666_0014961_2273_3130 285
464 3300046528 Ga0495642_0000067 Ga0495642_0000067_18100_18957 285
465 3300046529 Ga0495652_0245677 Ga0495652_0245677_70_927 285
466 3300046530 Ga0495654_0010440 Ga0495654_0010440_1600_2457 285
467 3300046530 Ga0495654_0034109 Ga0495654_0034109_770_1627 285
468 3300046530 Ga0495654_0035530 Ga0495654_0035530_131_991 285
469 3300046536 Ga0495587_0008026 Ga0495587_0008026_182_1039 285
470 3300046538 Ga0495609_0017820 Ga0495609_0017820_897_1754 285
471 3300046538 Ga0495609_0136646 Ga0495609_0136646_87_947 285
472 3300046542 Ga0495597_0003816 Ga0495597_0003816_6689_7546 285
473 3300046542 Ga0495597_0017495 Ga0495597_0017495_2339_3196 285
474 3300046542 Ga0495597_0030340 Ga0495597_0030340_693_1550 285
475 3300046542 Ga0495597_0037405 Ga0495597_0037405_766_1623 285
476 3300046557 Ga0495622_0044504 Ga0495622_0044504_84_941 285
477 3300046557 Ga0495622_0158861 Ga0495622_0158861_44_901 285
478 3300046558 Ga0495633_0057282 Ga0495633_0057282_874_1734 285
479 3300046558 Ga0495633_0128699 Ga0495633_0128699_129_986 285
480 3300046615 Ga0495656_0002252 Ga0495656_0002252_3577_4437 285
481 3300046615 Ga0495656_0022598 Ga0495656_0022598_87_947 285
482 3300046616 Ga0495668_0002597 Ga0495668_0002597_11859_12716 285
483 3300046616 Ga0495668_0002653 Ga0495668_0002653_306_1163 285
484 3300046642 Ga0495634_0010691 Ga0495634_0010691_3832_4689 285
485 3300046648 Ga0495611_0095153 Ga0495611_0095153_446_1306 285
486 3300046660 Ga0495625_0137588 Ga0495625_0137588_118_975 285
487 3300046660 Ga0495625_0152224 Ga0495625_0152224_625_1482 285
488 3300046660 Ga0495625_0219617 Ga0495625_0219617_240_1097 285
489 3300046660 Ga0495625_0245958 Ga0495625_0245958_53_913 285
490 3300046663 Ga0495635_0005376 Ga0495635_0005376_4997_5854 285
491 3300046663 Ga0495635_0041815 Ga0495635_0041815_871_1728 285
492 3300046665 Ga0495661_0044893 Ga0495661_0044893_1128_1985 285
493 3300046665 Ga0495661_0053004 Ga0495661_0053004_717_1577 285
494 3300046665 Ga0495661_0111911 Ga0495661_0111911_108_965 285
495 3300046674 Ga0495588_0035000 Ga0495588_0035000_945_1802 285
496 3300046674 Ga0495588_0046616 Ga0495588_0046616_1304_2161 285
497 3300046675 Ga0495657_0108402 Ga0495657_0108402_158_1015 285
498 3300046679 Ga0495623_0006054 Ga0495623_0006054_2400_3257 285
499 3300046679 Ga0495623_0047708 Ga0495623_0047708_1840_2697 285
500 3300046684 Ga0495669_0005517 Ga0495669_0005517_2763_3623 285
501 3300046691 Ga0495670_0013190 Ga0495670_0013190_1767_2627 285
502 3300046691 Ga0495670_0024849 Ga0495670_0024849_1061_1918 285
503 3300046691 Ga0495670_0063715 Ga0495670_0063715_417_1277 285
504 3300046691 Ga0495670_0090521 Ga0495670_0090521_84_941 285
505 3300046692 Ga0495671_0033129 Ga0495671_0033129_600_1457 285
506 3300046692 Ga0495671_0044316 Ga0495671_0044316_739_1596 285
507 3300046692 Ga0495671_0108684 Ga0495671_0108684_53_913 285
508 3300046692 Ga0495671_0118914 Ga0495671_0118914_61_918 285
509 3300046694 Ga0495649_0012080 Ga0495649_0012080_3387_4244 285
510 3300046694 Ga0495649_0051521 Ga0495649_0051521_763_1620 285
511 3300046694 Ga0495649_0058309 Ga0495649_0058309_163_1020 285
512 3300046794 Ga0495589_0005175 Ga0495589_0005175_5428_6285 285
513 3300046810 Ga0495660_0019690 Ga0495660_0019690_687_1544 285
514 3300046810 Ga0495660_0037022 Ga0495660_0037022_662_1519 285
515 3300047319 Ga0495674_0069891 Ga0495674_0069891_994_1851 285
516 3300047320 Ga0495672_0003277 Ga0495672_0003277_6071_6928 285
517 3300047320 Ga0495672_0015185 Ga0495672_0015185_2308_3165 285
518 3300047320 Ga0495672_0015612 Ga0495672_0015612_227_1087 285
519 3300047320 Ga0495672_0028605 Ga0495672_0028605_1688_2545 285
520 3300047320 Ga0495672_0043667 Ga0495672_0043667_1530_2387 285
521 3300047320 Ga0495672_0045458 Ga0495672_0045458_1529_2389 285
522 3300047320 Ga0495672_0233332 Ga0495672_0233332_19_876 285
523 3300047322 Ga0495680_0030591 Ga0495680_0030591_499_1356 285
524 3300047322 Ga0495680_0097972 Ga0495680_0097972_361_1218 285
525 3300047322 Ga0495680_0254844 Ga0495680_0254844_320_1177 285
526 3300047323 Ga0495683_0104191 Ga0495683_0104191_370_1227 285
527 3300047443 Ga0495687_002144 Ga0495687_002144_3585_4442 285
528 3300047443 Ga0495687_011658 Ga0495687_011658_2875_3732 285
529 3300047444 Ga0495675_0074705 Ga0495675_0074705_1036_1893 285
530 3300047445 Ga0495677_0006622 Ga0495677_0006622_2372_3232 285
531 3300047446 Ga0495679_012561 Ga0495679_012561_1196_2053 285
532 3300047469 Ga0495673_0002071 Ga0495673_0002071_11388_12245 285
533 3300047469 Ga0495673_0008979 Ga0495673_0008979_2313_3170 285
534 3300047469 Ga0495673_0013504 Ga0495673_0013504_702_1559 285
535 3300047469 Ga0495673_0041702 Ga0495673_0041702_956_1813 285
536 3300047469 Ga0495673_0059926 Ga0495673_0059926_67_924 285
537 3300047469 Ga0495673_0101838 Ga0495673_0101838_218_1078 285
538 3300047469 Ga0495673_0145557 Ga0495673_0145557_14_871 285
539 3300047470 Ga0495681_0001694 Ga0495681_0001694_13358_14215 285
540 3300047470 Ga0495681_0032196 Ga0495681_0032196_1099_1956 285
541 3300047470 Ga0495681_0042856 Ga0495681_0042856_658_1518 285
542 3300047471 Ga0495684_0081514 Ga0495684_0081514_776_1633 285
543 3300047472 Ga0495686_0023956 Ga0495686_0023956_2223_3080 285
544 3300047472 Ga0495686_0062889 Ga0495686_0062889_1390_2250 285
545 3300047673 Ga0495593_0007329 Ga0495593_0007329_4836_5693 285
546 3300047673 Ga0495593_0175212 Ga0495593_0175212_11_868 285
547 3300048089 Ga0495614_0129640 Ga0495614_0129640_24_881 285
548 3300048091 Ga0495626_0000727 Ga0495626_0000727_6282_7139 285
549 3300048091 Ga0495626_0002545 Ga0495626_0002545_7407_8264 285
550 3300048091 Ga0495626_0003906 Ga0495626_0003906_2385_3242 285
551 3300048091 Ga0495626_0053347 Ga0495626_0053347_519_1376 285
552 3300048905 Ga0496102_0000073 Ga0496102_0000073_146747_147604 285
553 3300048906 Ga0496103_0027756 Ga0496103_0027756_953_1810 285
554 3300048910 Ga0496107_0411921 Ga0496107_0411921_94_951 285
555 3300048918 Ga0496115_0091725 Ga0496115_0091725_416_1273 285
556 3300048920 Ga0496117_0016267 Ga0496117_0016267_3698_4555 285
557 3300048920 Ga0496117_0242853 Ga0496117_0242853_25_882 285
558 3300048921 Ga0496118_0024655 Ga0496118_0024655_2158_3015 285
559 3300048921 Ga0496118_0070625 Ga0496118_0070625_909_1766 285
560 3300048922 Ga0496119_0094496 Ga0496119_0094496_110_967 285
561 3300048924 Ga0496121_0107878 Ga0496121_0107878_748_1605 285
562 3300048927 Ga0496124_0208307 Ga0496124_0208307_67_924 285
563 3300048929 Ga0496126_0039578 Ga0496126_0039578_1765_2622 285
564 3300049459 Ga0495678_011179 Ga0495678_011179_1749_2606 285
565 3300049459 Ga0495678_029950 Ga0495678_029950_589_1446 285
566 3300049460 Ga0495682_0015867 Ga0495682_0015867_1947_2804 285
567 3300049460 Ga0495682_0042886 Ga0495682_0042886_471_1328 285
568 3300049460 Ga0495682_0054107 Ga0495682_0054107_136_993 285
569 3300050491 nmdc:mga00v17_82249_c1 nmdc:mga00v17_82249_c1_584_1441 285
570 iso_pu_bacteria 2554235341 2555669548 287
571 iso_pu_bacteria 2599185160 2599353454 287
572 iso_pu_bacteria 2599185161 2599363849 287
573 iso_pu_bacteria 2599185162 2599370169 287
574 iso_pu_bacteria 2599185163 2599372476 287
575 iso_pu_bacteria 2599185164 2599378562 287
576 iso_pu_bacteria 2599185165 2599384061 287
577 iso_pu_bacteria 2599185166 2599391335 287
578 iso_pu_bacteria 2599185168 2599407581 287
579 iso_pu_bacteria 2599185181 2599460288 287
580 iso_pu_bacteria 2599185182 2599470682 287
581 iso_pu_bacteria 2599185186 2599489309 287
582 iso_pu_bacteria 2599185356 2600212896 287
583 iso_pu_bacteria 2600255313 2601773064 287
584 iso_pu_bacteria 2667528171 2671094977 287
585 iso_pu_bacteria 2818991464 2819705669 287
586 iso_pu_bacteria 2844665904 2844670048 287
587 iso_pu_bacteria 2917070673 2917073361 287
588 iso_pu_bacteria 2935353572 2935357640 287
589 iso_pu_bacteria 637000220 637319881 287
590 3300047469 Ga0495673_0000077 Ga0495673_0000077_55774_56649 290
591 3300002737 JGI25162J39368_1000014 JGI25162J39368_1000014218 291
592 3300002737 JGI25162J39368_1000041 JGI25162J39368_1000041141 291
593 3300002771 JGI25163J39215_1000165 JGI25163J39215_100016516 291
594 3300002771 JGI25163J39215_1000405 JGI25163J39215_100040510 291
595 3300002772 JGI25164J39214_1000021 JGI25164J39214_100002132 291
596 3300002772 JGI25164J39214_1000059 JGI25164J39214_10000596 291
597 3300003214 JGI25165J46597_1000027 JGI25165J46597_1000027101 291
598 3300003214 JGI25165J46597_1000081 JGI25165J46597_1000081141 291
599 3300009148 Ga0105243_10011007 Ga0105243_100110071 291
600 3300013102 Ga0157371_10000147 Ga0157371_1000014730 291
601 3300014497 Ga0182008_10000525 Ga0182008_1000052520 291
602 3300025207 Ga0209760_100025 Ga0209760_10002512 291
603 3300025207 Ga0209760_100074 Ga0209760_10007434 291
604 3300025231 Ga0207427_100003 Ga0207427_100003579 291
605 3300025231 Ga0207427_100064 Ga0207427_10006435 291
606 3300025233 Ga0209437_100002 Ga0209437_100002434 291
607 3300025233 Ga0209437_100044 Ga0209437_100044389 291
608 3300025261 Ga0209233_1000004 Ga0209233_1000004991 291
609 3300025261 Ga0209233_1000057 Ga0209233_1000057389 291
610 3300025935 Ga0207709_10001157 Ga0207709_100011578 291
611 3300046557 Ga0495622_0047006 Ga0495622_0047006_419_1294 291
612 3300046615 Ga0495656_0028395 Ga0495656_0028395_692_1570 291
613 3300048915 Ga0496112_0277675 Ga0496112_0277675_550_1428 291
614 3300048919 Ga0496116_0000221 Ga0496116_0000221_94283_95158 291
615 3300048921 Ga0496118_0025424 Ga0496118_0025424_4003_4878 291
616 3300048924 Ga0496121_0000307 Ga0496121_0000307_90218_91093 291
617 3300048925 Ga0496122_0005969 Ga0496122_0005969_10710_11585 291
618 3300048926 Ga0496123_0004380 Ga0496123_0004380_3350_4225 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05425

CopD

Copper resistance protein D

185

282

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.6488 6 289
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.6339 6 289
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.6321 2 281
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.6112 2 281
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.6012 4 284
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5928 4 283 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.579 4 283 1.20.1630.10
af_Q4DB10_34_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5269 4 167 1.20.120.1770
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5087 4 280 1.20.1630.10
af_A0A1D6ML49_3_186_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4925 3 160 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A3A6R1A0-F1-model_v4 Copper resistance protein D 0.9448 1 290 GO:0005886
GO:0006825
GO:0046688
AF-A0A3A6R1A0-F1-model_v4 Copper resistance protein D 0.9416 1 290 GO:0005886
GO:0006825
GO:0046688
AF-A0A1M3KNW9-F1-model_v4 Copper resistance protein D domain-containing protein 0.9272 1 286 GO:0005886
GO:0006825
AF-A0A3D9Z0M1-F1-model_v4 Putative copper resistance protein D 0.9225 5 287 GO:0005886
GO:0006825
AF-A0A6B3UEP6-F1-model_v4 Copper homeostasis membrane protein CopD 0.9218 2 289 GO:0005886
GO:0006825

Feature Viewer

pLDDT pTM Quality
88.52 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map