F469292

General Info

Members Datasets Scaffolds Average Seq Length
613 288 556 221

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0016147|Ga0495665_0016147_2882_3634
Length 250
Sequence MKGFRSSEFTYATLTPKLQALQRIWPLTMTTPSLLDRLASLDSNTVSDALDFLGLPGATFGIRPLWDCPRIVGRASTIQLGPKTDATPTVHLITPVIDEIRTGDRVLVIAGGLEGISCWGDIIANAATAKKIRGSVIDGCSRDIEGSESIGYPVFGRGITMISARNRVAQISSGKPVTFAGVVVHEDDYVVADRCGTVFVPAARIEEVVDLGERIAKRQDGMVKAVRAGRSVAEVMHDKEFEAIYVKEAK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231015 Pseudomonas sp. GM49 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231020 Pseudomonas sp. GM74 Isolate Nodule
12 2511231022 Pseudomonas sp. GM79 Isolate Nodule
13 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
14 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
15 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
16 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
17 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
18 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
19 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
20 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
21 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
22 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
23 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
24 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
25 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
26 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
27 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
28 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
29 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
30 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
31 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
32 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
33 2643221569 Achromobacter sp. Root565 Isolate Unclassified
34 2643221621 Achromobacter sp. Root83 Isolate Unclassified
35 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
36 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
37 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
38 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
39 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
40 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
41 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
42 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
43 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
44 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
45 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
46 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
47 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
48 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
49 2928058823 Ralstonia sp. 1138 Isolate Unclassified
50 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
51 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
52 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
53 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
54 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
55 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
59 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
136 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
137 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
138 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
141 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
142 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
143 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
144 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
145 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
148 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
266 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
278 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
281 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
282 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
286 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
287 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
288 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.86
Metatranscriptomes 0
Isolates 9.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 1.47
Rhizoplane 7.83
Rhizosphere 68.52
Stem 0
Stem Tuber 0
Unclassified 13.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_345 2124908027 Bacteria 3567
2 MRS2a_Contig_7109 2124908027 Bacteria 5564
3 MRS2a_Contig_759 2124908027 Bacteria 5766
4 SwRhRL2b_contig_2343660 2162886007 Bacteria 1725
5 SwRhRL2b_contig_2853474 2162886007 Bacteria 4192
6 JGI25156J39149_1000276 3300002705 Bacteria 34960
7 JGI25156J39149_1018527 3300002705 Bacteria 1283
8 JGI25159J45721_1000180 3300002987 Bacteria 29383
9 JGI25151J46595_10020784 3300003187 Bacteria 2761
10 JGI25160J50197_1000145 3300003354 Bacteria 63479
11 JGI25161J50226_1000064 3300003374 Bacteria 99448
12 Ga0055537_1006562 3300003773 Bacteria 2928
13 Ga0055543_1000883 3300004625 Bacteria 14292
14 Ga0065714_10000597 3300005288 Bacteria 4497
15 Ga0065714_10098749 3300005288 Bacteria 1700
16 Ga0065704_10075621 3300005289 Bacteria 5498
17 Ga0065715_10199254 3300005293 Bacteria 1369
18 Ga0070669_100473055 3300005353 Bacteria 1036
19 Ga0070667_101185060 3300005367 Unclassified 715
20 Ga0070707_100795662 3300005468 Bacteria 909
21 Ga0068857_100839940 3300005577 Bacteria 878
22 Ga0068854_100128568 3300005578 Bacteria 1932
23 Ga0068860_100000643 3300005843 Bacteria 40896
24 Ga0075363_100007333 3300006048 Bacteria 5060
25 Ga0075364_10001007 3300006051 Bacteria 14921
26 Ga0075364_10049147 3300006051 Bacteria 2750
27 Ga0075432_10000186 3300006058 Bacteria 15934
28 Ga0075432_10000507 3300006058 Bacteria 11659
29 Ga0075432_10001401 3300006058 Bacteria 7836
30 Ga0075432_10004561 3300006058 Bacteria 4714
31 Ga0075432_10020576 3300006058 Bacteria 2256
32 Ga0075432_10026564 3300006058 Bacteria 1989
33 Ga0075432_10116392 3300006058 Bacteria 1000
34 Ga0075362_10006136 3300006177 Bacteria 4455
35 Ga0075362_10013629 3300006177 Bacteria 3259
36 Ga0075362_10014132 3300006177 Bacteria 3215
37 Ga0075362_10052323 3300006177 Bacteria 1829
38 Ga0075369_10062933 3300006186 Bacteria 1622
39 Ga0075366_10143775 3300006195 Bacteria 1443
40 Ga0075366_10179824 3300006195 Bacteria 1285
41 Ga0075370_10290444 3300006353 Bacteria 972
42 Ga0075430_100202311 3300006846 Bacteria 1649
43 Ga0075436_100079629 3300006914 Bacteria 2270
44 Ga0105251_10000860 3300009011 Bacteria 27208
45 Ga0105251_10002212 3300009011 Bacteria 15527
46 Ga0105251_10008183 3300009011 Bacteria 6324
47 Ga0105251_10016580 3300009011 Bacteria 3976
48 Ga0105251_10060322 3300009011 Bacteria 1786
49 Ga0105251_10073487 3300009011 Bacteria 1589
50 Ga0105251_10149441 3300009011 Bacteria 1055
51 Ga0105244_10003143 3300009036 Bacteria 12020
52 Ga0105244_10013020 3300009036 Bacteria 4883
53 Ga0105244_10014892 3300009036 Bacteria 4478
54 Ga0105244_10026975 3300009036 Bacteria 3102
55 Ga0105244_10230072 3300009036 Bacteria 868
56 Ga0105250_10000970 3300009092 Bacteria 16761
57 Ga0105250_10048469 3300009092 Bacteria 1704
58 Ga0105250_10050949 3300009092 Bacteria 1661
59 Ga0105250_10149276 3300009092 Bacteria 972
60 Ga0105250_10153662 3300009092 Bacteria 958
61 Ga0105247_10000045 3300009101 Bacteria 153175
62 Ga0105243_10003560 3300009148 Bacteria 12573
63 Ga0105237_10006162 3300009545 Bacteria 13405
64 Ga0105238_10131117 3300009551 Bacteria 2485
65 Ga0105239_10000839 3300010375 Bacteria 43658
66 Ga0105246_10025782 3300011119 Bacteria 3833
67 Ga0157373_10000235 3300013100 Bacteria 45175
68 Ga0157373_10039168 3300013100 Bacteria 3394
69 Ga0157373_10500888 3300013100 Bacteria 877
70 Ga0157370_10000335 3300013104 Bacteria 59202
71 Ga0157370_10106850 3300013104 Bacteria 2619
72 Ga0157370_10198525 3300013104 Bacteria 1861
73 Ga0163162_10493931 3300013306 Bacteria 1355
74 Ga0157375_10000888 3300013308 Bacteria 25930
75 Ga0157375_10295093 3300013308 Bacteria 1784
76 Ga0182008_10000377 3300014497 Bacteria 34436
77 Ga0182008_10000450 3300014497 Bacteria 31363
78 Ga0182008_10003201 3300014497 Bacteria 10002
79 Ga0182008_10005130 3300014497 Bacteria 7514
80 Ga0182008_10051087 3300014497 Bacteria 2051
81 Ga0182006_1015369 3300015261 Bacteria 3282
82 Ga0182006_1028614 3300015261 Bacteria 2265
83 Ga0182007_10005084 3300015262 Bacteria 5840
84 Ga0182007_10072843 3300015262 Bacteria 1125
85 Ga0182005_1000795 3300015265 Bacteria 14369
86 Ga0182005_1001940 3300015265 Bacteria 7809
87 Ga0163161_10010274 3300017792 Bacteria 6482
88 Ga0163161_10231292 3300017792 Bacteria 1435
89 Ga0163161_10619262 3300017792 Bacteria 894
90 Ga0209436_118290 3300025208 Bacteria 1000
91 Ga0207425_1000827 3300025245 Bacteria 15430
92 Ga0209759_1000147 3300025256 Bacteria 121320
93 Ga0209759_1000160 3300025256 Bacteria 116290
94 Ga0209759_1001315 3300025256 Bacteria 14631
95 Ga0209565_1002828 3300025263 Bacteria 5985
96 Ga0209130_1000094 3300025284 Bacteria 145569
97 Ga0209675_1002022 3300025291 Bacteria 10848
98 Ga0209676_1002079 3300025292 Bacteria 15520
99 Ga0209025_1003318 3300025294 Bacteria 15473
100 Ga0209025_1014686 3300025294 Bacteria 4792
101 Ga0209564_1012719 3300025295 Bacteria 3644
102 Ga0209050_1001665 3300025298 Bacteria 22438
103 Ga0209050_1003124 3300025298 Bacteria 12664
104 Ga0209050_1007337 3300025298 Bacteria 6209
105 Ga0207426_1000025 3300025302 Bacteria 532921
106 Ga0209257_1011387 3300025304 Bacteria 4292
107 Ga0207696_1000001 3300025711 Bacteria 2579611
108 Ga0207696_1000006 3300025711 Bacteria 616498
109 Ga0207696_1000205 3300025711 Bacteria 89786
110 Ga0207696_1017205 3300025711 Bacteria 2400
111 Ga0207655_1000077 3300025728 Bacteria 219418
112 Ga0207655_1005027 3300025728 Bacteria 9145
113 Ga0207655_1007554 3300025728 Bacteria 7038
114 Ga0207655_1010592 3300025728 Bacteria 5578
115 Ga0207655_1035405 3300025728 Bacteria 2229
116 Ga0207655_1066865 3300025728 Bacteria 1356
117 Ga0207713_1000016 3300025735 Bacteria 421689
118 Ga0207713_1000724 3300025735 Bacteria 30902
119 Ga0207713_1001683 3300025735 Bacteria 17102
120 Ga0207713_1007730 3300025735 Bacteria 6281
121 Ga0207713_1013775 3300025735 Bacteria 4240
122 Ga0207713_1046423 3300025735 Bacteria 1766
123 Ga0207713_1117641 3300025735 Bacteria 895
124 Ga0207710_10000070 3300025900 Bacteria 151890
125 Ga0207684_10045987 3300025910 Bacteria 3703
126 Ga0207695_10021849 3300025913 Bacteria 7285
127 Ga0207671_10030563 3300025914 Bacteria 4016
128 Ga0207709_10050270 3300025935 Bacteria 2549
129 Ga0207658_11050840 3300025986 Unclassified 743
130 Ga0207639_11062890 3300026041 Bacteria 759
131 Ga0207428_10004619 3300027907 Bacteria 13055
132 Ga0207428_10015481 3300027907 Bacteria 6597
133 Ga0207428_10022315 3300027907 Bacteria 5345
134 Ga0207428_10241691 3300027907 Bacteria 1349
135 Ga0268264_10000208 3300028381 Bacteria 119631
136 Ga0307408_100004307 3300031548 Bacteria 9658
137 Ga0307405_10004697 3300031731 Bacteria 6497
138 Ga0395905_0061326 3300037471 Bacteria 3518
139 Ga0439438_000737 3300041405 Bacteria 14700
140 Ga0439438_001069 3300041405 Bacteria 12231
141 Ga0439438_006023 3300041405 Bacteria 4360
142 Ga0439447_011588 3300041407 Bacteria 2565
143 Ga0439466_0001767 3300041411 Bacteria 8451
144 Ga0439466_0030563 3300041411 Bacteria 1846
145 Ga0439465_0034664 3300041413 Bacteria 1616
146 Ga0439431_0024786 3300041997 Bacteria 1462
147 Ga0439432_000336 3300042006 Bacteria 17113
148 Ga0439451_002232 3300042009 Bacteria 3900
149 Ga0439451_006484 3300042009 Bacteria 2392
150 Ga0439451_024083 3300042009 Bacteria 1226
151 Ga0439451_037404 3300042009 Bacteria 975
152 Ga0439452_001610 3300042010 Bacteria 8922
153 Ga0439452_009261 3300042010 Bacteria 2909
154 Ga0439452_017940 3300042010 Bacteria 1892
155 Ga0439456_001958 3300042013 Bacteria 4145
156 Ga0439456_006355 3300042013 Bacteria 2411
157 Ga0439456_064167 3300042013 Bacteria 809
158 Ga0439463_000012 3300042016 Bacteria 37568
159 Ga0450919_000868 3300042121 Bacteria 3911
160 Ga0450922_004148 3300042124 Bacteria 1333
161 Ga0450890_002190 3300042127 Bacteria 2721
162 Ga0450894_001468 3300042131 Bacteria 3376
163 Ga0450898_001428 3300042134 Bacteria 3148
164 Ga0450899_002647 3300042135 Bacteria 1934
165 Ga0450902_001375 3300042137 Bacteria 3304
166 Ga0450903_001499 3300042138 Bacteria 4360
167 Ga0450903_002822 3300042138 Bacteria 3047
168 Ga0450906_002309 3300042145 Bacteria 4178
169 Ga0450907_000283 3300042146 Bacteria 17199
170 Ga0450907_000944 3300042146 Bacteria 6906
171 Ga0450910_000298 3300042147 Bacteria 5762
172 Ga0450910_004494 3300042147 Bacteria 1883
173 Ga0439446_0017951 3300042156 Bacteria 1978
174 Ga0450908_000101 3300042184 Bacteria 17206
175 Ga0450908_005563 3300042184 Bacteria 2413
176 Ga0450909_000768 3300042185 Bacteria 4349
177 Ga0439460_0000791 3300042461 Bacteria 7161
178 Ga0439460_0001387 3300042461 Bacteria 5707
179 Ga0439440_0010988 3300042993 Bacteria 1903
180 Ga0466966_0002259 3300044684 Bacteria 12545
181 Ga0466966_0055632 3300044684 Bacteria 2504
182 Ga0466961_0166644 3300044693 Bacteria 1371
183 Ga0466971_0016521 3300044719 Bacteria 3258
184 Ga0466970_0003513 3300044765 Bacteria 7645
185 Ga0466958_0028851 3300045836 Bacteria 3293
186 Ga0495617_000074 3300046452 Bacteria 80489
187 Ga0495617_000633 3300046452 Bacteria 17644
188 Ga0495617_001923 3300046452 Bacteria 8718
189 Ga0495627_001773 3300046453 Bacteria 11594
190 Ga0495627_013844 3300046453 Bacteria 2831
191 Ga0495603_0003847 3300046455 Bacteria 8940
192 Ga0495603_0021771 3300046455 Bacteria 3881
193 Ga0495590_0000383 3300046457 Bacteria 22470
194 Ga0495591_000730 3300046458 Bacteria 23791
195 Ga0495591_002021 3300046458 Bacteria 11799
196 Ga0495629_0001059 3300046459 Bacteria 21997
197 Ga0495629_0004313 3300046459 Bacteria 10664
198 Ga0495638_0001966 3300046460 Bacteria 17607
199 Ga0495638_0032342 3300046460 Bacteria 3354
200 Ga0495638_0034100 3300046460 Bacteria 3251
201 Ga0495651_0116288 3300046462 Bacteria 1970
202 Ga0495653_0001150 3300046463 Bacteria 20361
203 Ga0495653_0002697 3300046463 Bacteria 14144
204 Ga0495653_0008944 3300046463 Bacteria 8189
205 Ga0495650_0000522 3300046471 Bacteria 56293
206 Ga0495650_0001328 3300046471 Bacteria 24822
207 Ga0495650_0002139 3300046471 Bacteria 16815
208 Ga0495650_0017469 3300046471 Bacteria 3595
209 Ga0495650_0023491 3300046471 Bacteria 2934
210 Ga0495580_0001423 3300046472 Bacteria 21034
211 Ga0495580_0004245 3300046472 Bacteria 12062
212 Ga0495580_0004994 3300046472 Bacteria 11070
213 Ga0495580_0028710 3300046472 Bacteria 4043
214 Ga0495582_0048886 3300046473 Bacteria 2329
215 Ga0495605_0000274 3300046474 Bacteria 58499
216 Ga0495605_0009759 3300046474 Bacteria 5391
217 Ga0495605_0018473 3300046474 Bacteria 3737
218 Ga0495605_0023072 3300046474 Bacteria 3277
219 Ga0495605_0031728 3300046474 Bacteria 2697
220 Ga0495605_0185528 3300046474 Bacteria 913
221 Ga0495639_0029867 3300046475 Bacteria 2421
222 Ga0495662_0020250 3300046476 Bacteria 3217
223 Ga0495664_0210127 3300046477 Bacteria 1178
224 Ga0495584_0000084 3300046491 Bacteria 65138
225 Ga0495584_0000094 3300046491 Bacteria 60342
226 Ga0495584_0001384 3300046491 Bacteria 14616
227 Ga0495584_0212010 3300046491 Bacteria 984
228 Ga0495585_0003464 3300046492 Bacteria 10657
229 Ga0495585_0071230 3300046492 Bacteria 1895
230 Ga0495594_0012994 3300046499 Bacteria 4343
231 Ga0495594_0079077 3300046499 Bacteria 1835
232 Ga0495594_0223663 3300046499 Bacteria 1073
233 Ga0495596_0000004 3300046500 Bacteria 163832
234 Ga0495596_0080837 3300046500 Bacteria 1262
235 Ga0495607_0000092 3300046501 Bacteria 93857
236 Ga0495607_0001089 3300046501 Bacteria 24801
237 Ga0495607_0002203 3300046501 Bacteria 16144
238 Ga0495607_0009093 3300046501 Bacteria 6753
239 Ga0495607_0010881 3300046501 Bacteria 6088
240 Ga0495607_0024798 3300046501 Bacteria 3734
241 Ga0495607_0037093 3300046501 Bacteria 2930
242 Ga0495607_0067235 3300046501 Bacteria 2014
243 Ga0495583_0000172 3300046506 Bacteria 109791
244 Ga0495583_0002339 3300046506 Bacteria 16462
245 Ga0495583_0004614 3300046506 Bacteria 9741
246 Ga0495583_0014490 3300046506 Bacteria 4348
247 Ga0495583_0113598 3300046506 Bacteria 1145
248 Ga0495583_0131020 3300046506 Bacteria 1049
249 Ga0495606_0000677 3300046507 Bacteria 53361
250 Ga0495606_0001019 3300046507 Bacteria 40637
251 Ga0495606_0008782 3300046507 Bacteria 8676
252 Ga0495610_0004302 3300046512 Bacteria 10576
253 Ga0495610_0033475 3300046512 Bacteria 2656
254 Ga0495616_0003847 3300046513 Bacteria 9565
255 Ga0495616_0014117 3300046513 Bacteria 4483
256 Ga0495616_0164125 3300046513 Bacteria 997
257 Ga0495620_0000031 3300046515 Bacteria 120343
258 Ga0495620_0001273 3300046515 Bacteria 15374
259 Ga0495620_0003367 3300046515 Bacteria 9161
260 Ga0495620_0003458 3300046515 Bacteria 9035
261 Ga0495628_0003725 3300046516 Bacteria 13566
262 Ga0495628_0541847 3300046516 Bacteria 836
263 Ga0495630_0053378 3300046517 Bacteria 3026
264 Ga0495631_0018576 3300046518 Bacteria 3271
265 Ga0495631_0027234 3300046518 Bacteria 2618
266 Ga0495632_0000170 3300046519 Bacteria 66918
267 Ga0495632_0000200 3300046519 Bacteria 60951
268 Ga0495632_0001021 3300046519 Bacteria 24197
269 Ga0495632_0002620 3300046519 Bacteria 13548
270 Ga0495632_0012417 3300046519 Bacteria 4916
271 Ga0495637_0000562 3300046520 Bacteria 26595
272 Ga0495637_0001997 3300046520 Bacteria 11536
273 Ga0495637_0002679 3300046520 Bacteria 9722
274 Ga0495637_0003304 3300046520 Bacteria 8575
275 Ga0495643_0006294 3300046522 Bacteria 7851
276 Ga0495643_0012927 3300046522 Bacteria 5019
277 Ga0495643_0026203 3300046522 Bacteria 3291
278 Ga0495643_0048548 3300046522 Bacteria 2293
279 Ga0495643_0052770 3300046522 Bacteria 2182
280 Ga0495644_0039226 3300046523 Bacteria 1785
281 Ga0495644_0044703 3300046523 Bacteria 1666
282 Ga0495648_0002381 3300046524 Bacteria 17458
283 Ga0495648_0008245 3300046524 Bacteria 8216
284 Ga0495648_0011242 3300046524 Bacteria 6758
285 Ga0495648_0014286 3300046524 Bacteria 5821
286 Ga0495648_0031933 3300046524 Bacteria 3464
287 Ga0495666_0000764 3300046526 Bacteria 14835
288 Ga0495642_0000234 3300046528 Bacteria 31625
289 Ga0495642_0000584 3300046528 Bacteria 18271
290 Ga0495642_0001045 3300046528 Bacteria 12865
291 Ga0495642_0044504 3300046528 Bacteria 1812
292 Ga0495652_0352920 3300046529 Bacteria 1053
293 Ga0495654_0000185 3300046530 Bacteria 61011
294 Ga0495654_0000465 3300046530 Bacteria 33806
295 Ga0495654_0000551 3300046530 Bacteria 30232
296 Ga0495654_0004692 3300046530 Bacteria 8052
297 Ga0495654_0009506 3300046530 Bacteria 5328
298 Ga0495654_0018822 3300046530 Bacteria 3614
299 Ga0495654_0023070 3300046530 Bacteria 3224
300 Ga0495654_0060267 3300046530 Bacteria 1824
301 Ga0495654_0074784 3300046530 Bacteria 1599
302 Ga0495665_0007530 3300046531 Bacteria 5894
303 Ga0495665_0016147 3300046531 Bacteria 4023
304 Ga0495665_0026602 3300046531 Bacteria 3107
305 Ga0495586_0062432 3300046535 Bacteria 2028
306 Ga0495587_0000835 3300046536 Bacteria 20361
307 Ga0495609_0000579 3300046538 Bacteria 28817
308 Ga0495609_0006320 3300046538 Bacteria 6057
309 Ga0495597_0002307 3300046542 Bacteria 12374
310 Ga0495597_0004922 3300046542 Bacteria 7183
311 Ga0495597_0013181 3300046542 Bacteria 3968
312 Ga0495597_0014501 3300046542 Bacteria 3751
313 Ga0495597_0026860 3300046542 Bacteria 2643
314 Ga0495597_0076760 3300046542 Bacteria 1432
315 Ga0495645_0000759 3300046543 Bacteria 22016
316 Ga0495622_0003408 3300046557 Bacteria 7497
317 Ga0495622_0009163 3300046557 Bacteria 4581
318 Ga0495633_0013146 3300046558 Bacteria 4375
319 Ga0495667_0012114 3300046559 Bacteria 5843
320 Ga0495656_0006084 3300046615 Bacteria 4208
321 Ga0495668_0000159 3300046616 Bacteria 102319
322 Ga0495668_0004822 3300046616 Bacteria 9386
323 Ga0495634_0000347 3300046642 Bacteria 44864
324 Ga0495611_0001152 3300046648 Bacteria 13806
325 Ga0495611_0001247 3300046648 Bacteria 13084
326 Ga0495611_0017121 3300046648 Bacteria 3098
327 Ga0495625_0005230 3300046660 Bacteria 11945
328 Ga0495625_0008077 3300046660 Bacteria 9025
329 Ga0495625_0027930 3300046660 Bacteria 4237
330 Ga0495625_0039929 3300046660 Bacteria 3425
331 Ga0495625_0053278 3300046660 Bacteria 2894
332 Ga0495635_0000402 3300046663 Bacteria 27473
333 Ga0495659_0000252 3300046664 Bacteria 22168
334 Ga0495659_0001527 3300046664 Bacteria 7824
335 Ga0495659_0003217 3300046664 Bacteria 5232
336 Ga0495659_0038983 3300046664 Bacteria 1688
337 Ga0495661_0000968 3300046665 Bacteria 26067
338 Ga0495661_0001702 3300046665 Bacteria 17826
339 Ga0495661_0041191 3300046665 Bacteria 2859
340 Ga0495588_0000444 3300046674 Bacteria 20968
341 Ga0495588_0007995 3300046674 Bacteria 4834
342 Ga0495623_0095575 3300046679 Bacteria 1817
343 Ga0495646_0000541 3300046680 Bacteria 20361
344 Ga0495646_0024093 3300046680 Bacteria 3833
345 Ga0495646_0064897 3300046680 Bacteria 2163
346 Ga0495646_0102413 3300046680 Bacteria 1640
347 Ga0495669_0002439 3300046684 Bacteria 7601
348 Ga0495669_0015147 3300046684 Bacteria 3299
349 Ga0495669_0110793 3300046684 Bacteria 1281
350 Ga0495669_0115566 3300046684 Bacteria 1255
351 Ga0495613_0098781 3300046689 Bacteria 2110
352 Ga0495624_0004099 3300046690 Bacteria 10720
353 Ga0495670_0000279 3300046691 Bacteria 24065
354 Ga0495670_0005340 3300046691 Bacteria 6320
355 Ga0495670_0068576 3300046691 Bacteria 1792
356 Ga0495671_0000136 3300046692 Bacteria 65148
357 Ga0495671_0002464 3300046692 Bacteria 11679
358 Ga0495671_0002792 3300046692 Bacteria 10923
359 Ga0495671_0010621 3300046692 Bacteria 5092
360 Ga0495671_0046680 3300046692 Bacteria 2165
361 Ga0495649_0000289 3300046694 Bacteria 44254
362 Ga0495649_0000811 3300046694 Bacteria 25193
363 Ga0495649_0001870 3300046694 Bacteria 15409
364 Ga0495649_0002973 3300046694 Bacteria 11673
365 Ga0495649_0060411 3300046694 Bacteria 2039
366 Ga0495649_0124955 3300046694 Bacteria 1359
367 Ga0495589_0000075 3300046794 Bacteria 92974
368 Ga0495589_0003632 3300046794 Bacteria 8329
369 Ga0495589_0012935 3300046794 Bacteria 4313
370 Ga0495589_0015325 3300046794 Bacteria 3946
371 Ga0495589_0016816 3300046794 Bacteria 3756
372 Ga0495589_0083597 3300046794 Bacteria 1552
373 Ga0495660_0003587 3300046810 Bacteria 9572
374 Ga0495660_0006421 3300046810 Bacteria 6957
375 Ga0495660_0023072 3300046810 Bacteria 3551
376 Ga0495660_0267270 3300046810 Bacteria 787
377 Ga0495581_0011765 3300047315 Bacteria 5066
378 Ga0495604_0139072 3300047317 Bacteria 1737
379 Ga0495636_0000848 3300047318 Bacteria 11267
380 Ga0495636_0007051 3300047318 Bacteria 4421
381 Ga0495674_0003028 3300047319 Bacteria 16365
382 Ga0495674_0044817 3300047319 Bacteria 3931
383 Ga0495674_0150724 3300047319 Bacteria 1950
384 Ga0495674_0213314 3300047319 Bacteria 1598
385 Ga0495674_0366490 3300047319 Bacteria 1167
386 Ga0495674_0474171 3300047319 Bacteria 1003
387 Ga0495672_0000433 3300047320 Bacteria 50107
388 Ga0495672_0003284 3300047320 Bacteria 13993
389 Ga0495672_0005169 3300047320 Bacteria 10418
390 Ga0495672_0015262 3300047320 Bacteria 5222
391 Ga0495672_0032069 3300047320 Bacteria 3272
392 Ga0495672_0065704 3300047320 Bacteria 2072
393 Ga0495676_0077746 3300047321 Bacteria 2529
394 Ga0495683_0002119 3300047323 Bacteria 12269
395 Ga0495683_0004963 3300047323 Bacteria 7446
396 Ga0495683_0017745 3300047323 Bacteria 3684
397 Ga0495683_0022758 3300047323 Bacteria 3221
398 Ga0495683_0105651 3300047323 Bacteria 1349
399 Ga0495687_000343 3300047443 Bacteria 59599
400 Ga0495687_001480 3300047443 Bacteria 21473
401 Ga0495687_007763 3300047443 Bacteria 6248
402 Ga0495687_056546 3300047443 Bacteria 1636
403 Ga0495675_0357980 3300047444 Bacteria 857
404 Ga0495677_0000308 3300047445 Bacteria 21215
405 Ga0495679_002975 3300047446 Bacteria 8362
406 Ga0495679_004066 3300047446 Bacteria 6855
407 Ga0495685_036763 3300047447 Bacteria 1680
408 Ga0495673_0000142 3300047469 Bacteria 128538
409 Ga0495673_0002180 3300047469 Bacteria 14217
410 Ga0495673_0010209 3300047469 Bacteria 5125
411 Ga0495673_0025453 3300047469 Bacteria 2840
412 Ga0495673_0031515 3300047469 Bacteria 2481
413 Ga0495673_0156069 3300047469 Bacteria 879
414 Ga0495681_0002804 3300047470 Bacteria 12334
415 Ga0495681_0011182 3300047470 Bacteria 5367
416 Ga0495681_0012532 3300047470 Bacteria 4976
417 Ga0495681_0124185 3300047470 Bacteria 1105
418 Ga0495686_0025039 3300047472 Bacteria 3914
419 Ga0495593_0000536 3300047673 Bacteria 21520
420 Ga0495593_0003200 3300047673 Bacteria 9827
421 Ga0495593_0027765 3300047673 Bacteria 3113
422 Ga0495614_0016971 3300048089 Bacteria 3165
423 Ga0495614_0023752 3300048089 Bacteria 2646
424 Ga0495626_0000920 3300048091 Bacteria 25811
425 Ga0495626_0007225 3300048091 Bacteria 6204
426 Ga0495626_0061547 3300048091 Bacteria 1706
427 Ga0496100_0009902 3300048903 Bacteria 5373
428 Ga0496100_0011482 3300048903 Bacteria 5044
429 Ga0496101_0038144 3300048904 Bacteria 3411
430 Ga0496101_0112312 3300048904 Bacteria 2052
431 Ga0496102_0000444 3300048905 Bacteria 47025
432 Ga0496102_0169737 3300048905 Bacteria 2054
433 Ga0496103_0000290 3300048906 Bacteria 47006
434 Ga0496103_0039592 3300048906 Bacteria 2897
435 Ga0496105_0120032 3300048908 Bacteria 2168
436 Ga0496105_0123089 3300048908 Bacteria 2138
437 Ga0496106_0082321 3300048909 Bacteria 2474
438 Ga0496106_0181849 3300048909 Bacteria 1669
439 Ga0496107_0066687 3300048910 Bacteria 2610
440 Ga0496107_0102961 3300048910 Bacteria 2094
441 Ga0496107_0220184 3300048910 Bacteria 1412
442 Ga0496109_0258779 3300048912 Bacteria 1639
443 Ga0496110_0114323 3300048913 Bacteria 2429
444 Ga0496110_0623073 3300048913 Bacteria 978
445 Ga0496110_0715794 3300048913 Bacteria 903
446 Ga0496111_0133926 3300048914 Bacteria 1835
447 Ga0496111_0191414 3300048914 Bacteria 1521
448 Ga0496112_0108732 3300048915 Bacteria 2743
449 Ga0496113_0017000 3300048916 Bacteria 5038
450 Ga0496113_0607257 3300048916 Bacteria 876
451 Ga0496114_0001183 3300048917 Bacteria 19768
452 Ga0496114_0015450 3300048917 Bacteria 6141
453 Ga0496114_0024443 3300048917 Bacteria 4932
454 Ga0496115_0018008 3300048918 Bacteria 5412
455 Ga0496115_0018733 3300048918 Bacteria 5321
456 Ga0496115_0257097 3300048918 Bacteria 1437
457 Ga0496116_0000001 3300048919 Bacteria 1501681
458 Ga0496116_0000231 3300048919 Bacteria 103493
459 Ga0496116_0022869 3300048919 Bacteria 4668
460 Ga0496116_0123694 3300048919 Bacteria 1491
461 Ga0496117_0000218 3300048920 Bacteria 109766
462 Ga0496117_0004027 3300048920 Bacteria 16550
463 Ga0496117_0005335 3300048920 Bacteria 13552
464 Ga0496117_0007320 3300048920 Bacteria 10824
465 Ga0496117_0010727 3300048920 Bacteria 8284
466 Ga0496117_0049977 3300048920 Bacteria 2968
467 Ga0496117_0171436 3300048920 Bacteria 1259
468 Ga0496118_0000106 3300048921 Bacteria 155884
469 Ga0496118_0003581 3300048921 Bacteria 19339
470 Ga0496118_0004391 3300048921 Bacteria 16756
471 Ga0496118_0008738 3300048921 Bacteria 10398
472 Ga0496118_0018145 3300048921 Bacteria 6362
473 Ga0496118_0044105 3300048921 Bacteria 3496
474 Ga0496118_0058321 3300048921 Bacteria 2885
475 Ga0496118_0059569 3300048921 Bacteria 2841
476 Ga0496119_0020580 3300048922 Bacteria 4807
477 Ga0496119_0047576 3300048922 Bacteria 2667
478 Ga0496119_0072946 3300048922 Bacteria 2003
479 Ga0496119_0115870 3300048922 Bacteria 1479
480 Ga0496119_0198121 3300048922 Bacteria 1041
481 Ga0496120_0007025 3300048923 Bacteria 8460
482 Ga0496120_0026173 3300048923 Bacteria 3607
483 Ga0496120_0295650 3300048923 Bacteria 743
484 Ga0496121_0000502 3300048924 Bacteria 74720
485 Ga0496121_0001139 3300048924 Bacteria 46685
486 Ga0496121_0003175 3300048924 Bacteria 23699
487 Ga0496121_0005762 3300048924 Bacteria 15717
488 Ga0496121_0024073 3300048924 Bacteria 5835
489 Ga0496121_0035719 3300048924 Bacteria 4446
490 Ga0496121_0039251 3300048924 Bacteria 4176
491 Ga0496121_0061950 3300048924 Bacteria 3067
492 Ga0496121_0217162 3300048924 Bacteria 1350
493 Ga0496122_0003924 3300048925 Bacteria 19025
494 Ga0496122_0007948 3300048925 Bacteria 11603
495 Ga0496122_0026992 3300048925 Bacteria 4928
496 Ga0496122_0058318 3300048925 Bacteria 2859
497 Ga0496123_0001070 3300048926 Bacteria 41381
498 Ga0496123_0037134 3300048926 Bacteria 3444
499 Ga0496123_0100717 3300048926 Bacteria 1682
500 Ga0496124_0002144 3300048927 Bacteria 26500
501 Ga0496124_0007825 3300048927 Bacteria 11281
502 Ga0496124_0016723 3300048927 Bacteria 6956
503 Ga0496124_0070345 3300048927 Bacteria 2903
504 Ga0496124_0101159 3300048927 Bacteria 2335
505 Ga0496124_0220975 3300048927 Bacteria 1424
506 Ga0496124_0376411 3300048927 Bacteria 994
507 Ga0496124_0415629 3300048927 Bacteria 929
508 Ga0496125_0000038 3300048928 Bacteria 328120
509 Ga0496125_0001948 3300048928 Bacteria 28191
510 Ga0496125_0015063 3300048928 Bacteria 7505
511 Ga0496126_0001154 3300048929 Bacteria 43772
512 Ga0496126_0002253 3300048929 Bacteria 26616
513 Ga0496126_0008908 3300048929 Bacteria 10745
514 Ga0496126_0019278 3300048929 Bacteria 6721
515 Ga0496126_0020634 3300048929 Bacteria 6454
516 Ga0496126_0058171 3300048929 Bacteria 3485
517 Ga0496126_0092880 3300048929 Bacteria 2650
518 Ga0496126_0097754 3300048929 Bacteria 2572
519 Ga0496126_0108320 3300048929 Bacteria 2422
520 Ga0496126_0294635 3300048929 Bacteria 1341
521 Ga0496126_0313510 3300048929 Bacteria 1291
522 Ga0466983_0000100 3300048986 Bacteria 23893
523 Ga0495678_000018 3300049459 Bacteria 279747
524 Ga0495678_000255 3300049459 Bacteria 59619
525 Ga0495678_000987 3300049459 Bacteria 24370
526 Ga0495678_046221 3300049459 Bacteria 1712
527 Ga0495678_083497 3300049459 Bacteria 1141
528 Ga0495682_0000497 3300049460 Bacteria 27198
529 Ga0495682_0000755 3300049460 Bacteria 20873
530 Ga0495682_0008624 3300049460 Bacteria 4013
531 Ga0495682_0010343 3300049460 Bacteria 3617
532 nmdc:mga03683_11875_c1 3300050489 Bacteria 3166
533 nmdc:mga03683_160342_c1 3300050489 Bacteria 1019
534 nmdc:mga03683_31525_c1 3300050489 Bacteria 2127
535 nmdc:mga03n38_47351_c1 3300050490 Bacteria 1902
536 nmdc:mga00v17_26095_c1 3300050491 Bacteria 3400
537 nmdc:mga00v17_46366_c1 3300050491 Bacteria 2629
538 nmdc:mga00v17_49489_c1 3300050491 Bacteria 2549
539 nmdc:mga00v17_75582_c1 3300050491 Bacteria 2095
540 nmdc:mga0yw44_58061_c1 3300050492 Bacteria 2363
541 nmdc:mga0k408_18265_c1 3300050493 Bacteria 3913
542 nmdc:mga0k408_41878_c1 3300050493 Bacteria 2637
543 nmdc:mga07m45_228301_c1 3300050496 Bacteria 1083
544 nmdc:mga0qj67_162015_c1 3300050509 Bacteria 1816
545 nmdc:mga08x19_234819_c1 3300050514 Bacteria 1263
546 nmdc:mga08x19_44047_c1 3300050514 Bacteria 2848
547 nmdc:mga0sz30_70209_c1 3300050516 Bacteria 1507
548 Ga0500610_0251832 3300053079 Bacteria 813
549 Ga0500562_005673 3300053108 Bacteria 3143
550 Ga0500593_000199 3300053117 Bacteria 24418
551 Ga0500607_001635 3300053121 Bacteria 19715
552 Ga0500659_0002578 3300053135 Bacteria 10879
553 Ga0500577_0101038 3300053142 Bacteria 1179
554 Ga0500634_0017002 3300053161 Bacteria 3889
555 Ga0500645_003921 3300053730 Bacteria 5868
556 Ga0500661_000983 3300055283 Bacteria 5334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0014117 Ga0495616_0014117_3373_3981 202
2 3300048913 Ga0496110_0114323 Ga0496110_0114323_1298_1924 207
3 3300053135 Ga0500659_0002578 Ga0500659_0002578_4957_5586 209
4 3300046474 Ga0495605_0185528 Ga0495605_0185528_150_785 210
5 3300046522 Ga0495643_0026203 Ga0495643_0026203_313_945 210
6 3300046616 Ga0495668_0004822 Ga0495668_0004822_4734_5375 213
7 3300048909 Ga0496106_0181849 Ga0496106_0181849_473_1117 214
8 3300048924 Ga0496121_0005762 Ga0496121_0005762_9763_10407 214
9 iso_pu_bacteria 2945961074 2945962616 214
10 iso_pu_bacteria 2510917013 2511088612 215
11 iso_pu_bacteria 2511231003 2511249779 215
12 iso_pu_bacteria 2643221569 2643860173 215
13 iso_pu_bacteria 2643221621 2644119988 215
14 iso_pu_bacteria 2690316117 2692314993 215
15 iso_pu_bacteria 2847417321 2847419949 215
16 iso_pu_bacteria 2904584206 2904589670 215
17 iso_pu_bacteria 2904589729 2904595319 215
18 iso_pu_bacteria 2928058823 2928059647 215
19 iso_pu_bacteria 641736154 642420233 215
20 iso_pu_bacteria 2919063839 2919068092 216
21 iso_pu_bacteria 3007419365 3007422769 216
22 iso_pu_bacteria 8056137416 8056139982 216
23 iso_pu_bacteria 2511231004 2511253072 217
24 iso_pu_bacteria 2511231012 2511304914 217
25 iso_pu_bacteria 2511231015 2511321778 217
26 iso_pu_bacteria 2511231016 2511328278 217
27 iso_pu_bacteria 2511231017 2511333790 217
28 iso_pu_bacteria 2511231020 2511348980 217
29 iso_pu_bacteria 2511231022 2511366244 217
30 iso_pu_bacteria 2562617112 2563061046 217
31 iso_pu_bacteria 2599185160 2599357606 217
32 iso_pu_bacteria 2599185161 2599364399 217
33 iso_pu_bacteria 2599185162 2599370720 217
34 iso_pu_bacteria 2599185163 2599377087 217
35 iso_pu_bacteria 2599185164 2599382678 217
36 iso_pu_bacteria 2599185165 2599389125 217
37 iso_pu_bacteria 2599185166 2599395945 217
38 iso_pu_bacteria 2599185168 2599408335 217
39 iso_pu_bacteria 2599185181 2599463905 217
40 iso_pu_bacteria 2599185185 2599486532 217
41 iso_pu_bacteria 2599185186 2599492925 217
42 iso_pu_bacteria 2599185288 2599883803 217
43 iso_pu_bacteria 2599185303 2599951354 217
44 iso_pu_bacteria 2599185311 2599992451 217
45 iso_pu_bacteria 2599185324 2600072714 217
46 iso_pu_bacteria 2599185356 2600217045 217
47 iso_pu_bacteria 2600254931 2600367567 217
48 iso_pu_bacteria 2600255313 2601777217 217
49 iso_pu_bacteria 2643221565 2643843370 217
50 iso_pu_bacteria 2711768613 2713476006 217
51 iso_pu_bacteria 2713897149 2715756831 217
52 iso_pu_bacteria 2738541294 2738811834 217
53 iso_pu_bacteria 2738541309 2738899194 217
54 iso_pu_bacteria 2738543015 2739256981 217
55 iso_pu_bacteria 2856287931 2856294360 217
56 iso_pu_bacteria 2857357740 2857367735 217
57 iso_pu_bacteria 2931396565 2931401260 217
58 iso_pu_bacteria 2939636861 2939639183 217
59 iso_pu_bacteria 2939636861 2939639385 217
60 iso_pu_bacteria 3007855910 3007856545 217
61 3300002705 JGI25156J39149_1000276 JGI25156J39149_100027624 218
62 3300005367 Ga0070667_101185060 Ga0070667_1011850601 218
63 3300005843 Ga0068860_100000643 Ga0068860_10000064329 218
64 3300009011 Ga0105251_10060322 Ga0105251_100603222 218
65 3300009092 Ga0105250_10048469 Ga0105250_100484692 218
66 3300013306 Ga0163162_10493931 Ga0163162_104939312 218
67 3300025256 Ga0209759_1000147 Ga0209759_100014776 218
68 3300025256 Ga0209759_1000160 Ga0209759_100016047 218
69 3300025735 Ga0207713_1046423 Ga0207713_10464231 218
70 3300025986 Ga0207658_11050840 Ga0207658_110508401 218
71 3300027907 Ga0207428_10004619 Ga0207428_100046195 218
72 3300028381 Ga0268264_10000208 Ga0268264_10000208109 218
73 3300042009 Ga0439451_006484 Ga0439451_006484_1693_2349 218
74 3300042013 Ga0439456_001958 Ga0439456_001958_717_1373 218
75 3300046501 Ga0495607_0009093 Ga0495607_0009093_134_790 218
76 3300046501 Ga0495607_0037093 Ga0495607_0037093_1383_2039 218
77 3300046507 Ga0495606_0008782 Ga0495606_0008782_1415_2071 218
78 3300046513 Ga0495616_0164125 Ga0495616_0164125_331_987 218
79 3300046515 Ga0495620_0003367 Ga0495620_0003367_5169_5825 218
80 3300046519 Ga0495632_0002620 Ga0495632_0002620_6936_7592 218
81 3300046522 Ga0495643_0048548 Ga0495643_0048548_1193_1849 218
82 3300046530 Ga0495654_0009506 Ga0495654_0009506_2241_2897 218
83 3300046794 Ga0495589_0003632 Ga0495589_0003632_1240_1896 218
84 3300047446 Ga0495679_004066 Ga0495679_004066_5077_5733 218
85 3300047470 Ga0495681_0012532 Ga0495681_0012532_2492_3148 218
86 3300047472 Ga0495686_0025039 Ga0495686_0025039_1139_1795 218
87 3300048919 Ga0496116_0123694 Ga0496116_0123694_207_863 218
88 3300048920 Ga0496117_0000218 Ga0496117_0000218_33629_34285 218
89 3300048921 Ga0496118_0058321 Ga0496118_0058321_1150_1806 218
90 3300048922 Ga0496119_0072946 Ga0496119_0072946_228_884 218
91 3300048923 Ga0496120_0007025 Ga0496120_0007025_5993_6649 218
92 3300048927 Ga0496124_0002144 Ga0496124_0002144_12490_13146 218
93 3300048928 Ga0496125_0001948 Ga0496125_0001948_12671_13327 218
94 3300048929 Ga0496126_0020634 Ga0496126_0020634_4742_5398 218
95 3300050491 nmdc:mga00v17_49489_c1 nmdc:mga00v17_49489_c1_570_1226 218
96 3300009011 Ga0105251_10000860 Ga0105251_100008609 219
97 3300009092 Ga0105250_10000970 Ga0105250_100009703 219
98 3300009101 Ga0105247_10000045 Ga0105247_1000004596 219
99 3300025298 Ga0209050_1007337 Ga0209050_10073376 219
100 3300025711 Ga0207696_1000001 Ga0207696_10000011318 219
101 3300025735 Ga0207713_1000016 Ga0207713_1000016281 219
102 3300025900 Ga0207710_10000070 Ga0207710_1000007096 219
103 3300037471 Ga0395905_0061326 Ga0395905_0061326_602_1261 219
104 3300044684 Ga0466966_0002259 Ga0466966_0002259_3648_4307 219
105 3300044684 Ga0466966_0055632 Ga0466966_0055632_714_1373 219
106 3300044693 Ga0466961_0166644 Ga0466961_0166644_50_709 219
107 3300044719 Ga0466971_0016521 Ga0466971_0016521_1980_2639 219
108 3300044765 Ga0466970_0003513 Ga0466970_0003513_2579_3238 219
109 3300045836 Ga0466958_0028851 Ga0466958_0028851_563_1222 219
110 3300046471 Ga0495650_0023491 Ga0495650_0023491_1405_2064 219
111 3300048905 Ga0496102_0169737 Ga0496102_0169737_1306_1965 219
112 3300048906 Ga0496103_0039592 Ga0496103_0039592_813_1472 219
113 3300048916 Ga0496113_0607257 Ga0496113_0607257_40_699 219
114 3300048919 Ga0496116_0000001 Ga0496116_0000001_743376_744035 219
115 3300048919 Ga0496116_0022869 Ga0496116_0022869_2766_3425 219
116 3300048920 Ga0496117_0004027 Ga0496117_0004027_8510_9169 219
117 3300048920 Ga0496117_0049977 Ga0496117_0049977_1411_2070 219
118 3300048921 Ga0496118_0008738 Ga0496118_0008738_894_1553 219
119 3300048921 Ga0496118_0018145 Ga0496118_0018145_2902_3561 219
120 3300048922 Ga0496119_0020580 Ga0496119_0020580_463_1122 219
121 3300048923 Ga0496120_0026173 Ga0496120_0026173_2169_2828 219
122 3300048925 Ga0496122_0026992 Ga0496122_0026992_3373_4032 219
123 3300048926 Ga0496123_0100717 Ga0496123_0100717_381_1040 219
124 3300048927 Ga0496124_0070345 Ga0496124_0070345_722_1381 219
125 3300048929 Ga0496126_0002253 Ga0496126_0002253_2554_3243 219
126 3300048929 Ga0496126_0008908 Ga0496126_0008908_3350_4009 219
127 3300048986 Ga0466983_0000100 Ga0466983_0000100_20615_21274 219
128 3300053079 Ga0500610_0251832 Ga0500610_0251832_10_669 219
129 3300053108 Ga0500562_005673 Ga0500562_005673_236_895 219
130 3300053142 Ga0500577_0101038 Ga0500577_0101038_66_725 219
131 iso_pu_bacteria 2501025502 2501084305 219
132 iso_pu_bacteria 2921643360 2921649009 219
133 3300002987 JGI25159J45721_1000180 JGI25159J45721_100018012 220
134 3300003187 JGI25151J46595_10020784 JGI25151J46595_100207841 220
135 3300003354 JGI25160J50197_1000145 JGI25160J50197_100014524 220
136 3300003374 JGI25161J50226_1000064 JGI25161J50226_100006458 220
137 3300003773 Ga0055537_1006562 Ga0055537_10065624 220
138 3300004625 Ga0055543_1000883 Ga0055543_100088317 220
139 3300005468 Ga0070707_100795662 Ga0070707_1007956622 220
140 3300005578 Ga0068854_100128568 Ga0068854_1001285682 220
141 3300006058 Ga0075432_10001401 Ga0075432_100014014 220
142 3300006177 Ga0075362_10014132 Ga0075362_100141324 220
143 3300006195 Ga0075366_10179824 Ga0075366_101798242 220
144 3300006353 Ga0075370_10290444 Ga0075370_102904441 220
145 3300009036 Ga0105244_10013020 Ga0105244_100130205 220
146 3300013100 Ga0157373_10000235 Ga0157373_1000023541 220
147 3300013104 Ga0157370_10000335 Ga0157370_1000033525 220
148 3300014497 Ga0182008_10000377 Ga0182008_1000037719 220
149 3300025208 Ga0209436_118290 Ga0209436_1182902 220
150 3300025245 Ga0207425_1000827 Ga0207425_100082712 220
151 3300025263 Ga0209565_1002828 Ga0209565_10028285 220
152 3300025284 Ga0209130_1000094 Ga0209130_100009497 220
153 3300025291 Ga0209675_1002022 Ga0209675_10020225 220
154 3300025294 Ga0209025_1003318 Ga0209025_100331822 220
155 3300025294 Ga0209025_1014686 Ga0209025_10146863 220
156 3300025295 Ga0209564_1012719 Ga0209564_10127195 220
157 3300025298 Ga0209050_1003124 Ga0209050_10031245 220
158 3300025302 Ga0207426_1000025 Ga0207426_1000025462 220
159 3300025304 Ga0209257_1011387 Ga0209257_10113874 220
160 3300025711 Ga0207696_1017205 Ga0207696_10172052 220
161 3300025728 Ga0207655_1000077 Ga0207655_1000077123 220
162 3300026041 Ga0207639_11062890 Ga0207639_110628901 220
163 3300046453 Ga0495627_013844 Ga0495627_013844_1071_1736 220
164 3300046455 Ga0495603_0021771 Ga0495603_0021771_2698_3363 220
165 3300046459 Ga0495629_0001059 Ga0495629_0001059_18635_19300 220
166 3300046462 Ga0495651_0116288 Ga0495651_0116288_601_1266 220
167 3300046463 Ga0495653_0008944 Ga0495653_0008944_5900_6565 220
168 3300046471 Ga0495650_0017469 Ga0495650_0017469_242_907 220
169 3300046472 Ga0495580_0004245 Ga0495580_0004245_6138_6803 220
170 3300046472 Ga0495580_0028710 Ga0495580_0028710_2680_3345 220
171 3300046473 Ga0495582_0048886 Ga0495582_0048886_645_1310 220
172 3300046475 Ga0495639_0029867 Ga0495639_0029867_1079_1744 220
173 3300046476 Ga0495662_0020250 Ga0495662_0020250_103_768 220
174 3300046477 Ga0495664_0210127 Ga0495664_0210127_374_1039 220
175 3300046492 Ga0495585_0071230 Ga0495585_0071230_52_717 220
176 3300046499 Ga0495594_0223663 Ga0495594_0223663_393_1058 220
177 3300046500 Ga0495596_0080837 Ga0495596_0080837_371_1036 220
178 3300046506 Ga0495583_0131020 Ga0495583_0131020_294_959 220
179 3300046515 Ga0495620_0000031 Ga0495620_0000031_107359_108024 220
180 3300046517 Ga0495630_0053378 Ga0495630_0053378_50_715 220
181 3300046528 Ga0495642_0001045 Ga0495642_0001045_2670_3335 220
182 3300046529 Ga0495652_0352920 Ga0495652_0352920_69_734 220
183 3300046531 Ga0495665_0007530 Ga0495665_0007530_4318_4983 220
184 3300046535 Ga0495586_0062432 Ga0495586_0062432_1312_1977 220
185 3300046543 Ga0495645_0000759 Ga0495645_0000759_2698_3363 220
186 3300046559 Ga0495667_0012114 Ga0495667_0012114_1973_2638 220
187 3300046648 Ga0495611_0001247 Ga0495611_0001247_1015_1680 220
188 3300046665 Ga0495661_0041191 Ga0495661_0041191_1124_1789 220
189 3300046674 Ga0495588_0007995 Ga0495588_0007995_1480_2145 220
190 3300046679 Ga0495623_0095575 Ga0495623_0095575_188_853 220
191 3300046680 Ga0495646_0024093 Ga0495646_0024093_1214_1879 220
192 3300046684 Ga0495669_0015147 Ga0495669_0015147_2038_2703 220
193 3300046691 Ga0495670_0005340 Ga0495670_0005340_1107_1772 220
194 3300046692 Ga0495671_0046680 Ga0495671_0046680_1124_1789 220
195 3300046794 Ga0495589_0016816 Ga0495589_0016816_2673_3338 220
196 3300047315 Ga0495581_0011765 Ga0495581_0011765_2660_3325 220
197 3300047317 Ga0495604_0139072 Ga0495604_0139072_362_1027 220
198 3300047319 Ga0495674_0150724 Ga0495674_0150724_1238_1903 220
199 3300047444 Ga0495675_0357980 Ga0495675_0357980_150_815 220
200 3300047469 Ga0495673_0025453 Ga0495673_0025453_1124_1789 220
201 3300047470 Ga0495681_0124185 Ga0495681_0124185_10_675 220
202 3300047673 Ga0495593_0027765 Ga0495593_0027765_2226_2891 220
203 3300048089 Ga0495614_0016971 Ga0495614_0016971_963_1628 220
204 3300048903 Ga0496100_0011482 Ga0496100_0011482_1935_2600 220
205 3300048904 Ga0496101_0112312 Ga0496101_0112312_1367_2032 220
206 3300048908 Ga0496105_0123089 Ga0496105_0123089_1058_1723 220
207 3300048910 Ga0496107_0066687 Ga0496107_0066687_172_837 220
208 3300048912 Ga0496109_0258779 Ga0496109_0258779_195_860 220
209 3300048913 Ga0496110_0715794 Ga0496110_0715794_153_818 220
210 3300048914 Ga0496111_0191414 Ga0496111_0191414_150_815 220
211 3300048917 Ga0496114_0001183 Ga0496114_0001183_18211_18873 220
212 3300048917 Ga0496114_0024443 Ga0496114_0024443_1601_2266 220
213 3300048918 Ga0496115_0018733 Ga0496115_0018733_2681_3346 220
214 3300048920 Ga0496117_0010727 Ga0496117_0010727_1537_2199 220
215 3300048921 Ga0496118_0003581 Ga0496118_0003581_18041_18703 220
216 3300048924 Ga0496121_0217162 Ga0496121_0217162_302_964 220
217 3300048925 Ga0496122_0007948 Ga0496122_0007948_5205_5867 220
218 3300048925 Ga0496122_0058318 Ga0496122_0058318_1124_1789 220
219 3300048926 Ga0496123_0001070 Ga0496123_0001070_27973_28635 220
220 3300048926 Ga0496123_0037134 Ga0496123_0037134_1124_1789 220
221 3300048927 Ga0496124_0007825 Ga0496124_0007825_8952_9614 220
222 3300048927 Ga0496124_0101159 Ga0496124_0101159_1378_2040 220
223 3300048929 Ga0496126_0294635 Ga0496126_0294635_451_1113 220
224 3300049459 Ga0495678_000018 Ga0495678_000018_168639_169304 220
225 3300050489 nmdc:mga03683_11875_c1 nmdc:mga03683_11875_c1_819_1481 220
226 3300050490 nmdc:mga03n38_47351_c1 nmdc:mga03n38_47351_c1_527_1189 220
227 3300050491 nmdc:mga00v17_26095_c1 nmdc:mga00v17_26095_c1_696_1358 220
228 3300053121 Ga0500607_001635 Ga0500607_001635_12258_12923 220
229 iso_pu_bacteria 8054285046 8054289047 220
230 2124908027 MRS2a_Contig_345 MRS2a_00242560 221
231 2124908027 MRS2a_Contig_7109 MRS2a_00010960 221
232 2124908027 MRS2a_Contig_759 MRS2a_00616910 221
233 2162886007 SwRhRL2b_contig_2343660 SwRhRL2b_0462.00007920 221
234 2162886007 SwRhRL2b_contig_2853474 SwRhRL2b_0679.00004860 221
235 3300002705 JGI25156J39149_1018527 JGI25156J39149_10185272 221
236 3300005288 Ga0065714_10000597 Ga0065714_100005974 221
237 3300005288 Ga0065714_10098749 Ga0065714_100987492 221
238 3300005289 Ga0065704_10075621 Ga0065704_100756214 221
239 3300005293 Ga0065715_10199254 Ga0065715_101992542 221
240 3300005353 Ga0070669_100473055 Ga0070669_1004730551 221
241 3300005577 Ga0068857_100839940 Ga0068857_1008399402 221
242 3300006048 Ga0075363_100007333 Ga0075363_1000073333 221
243 3300006051 Ga0075364_10001007 Ga0075364_100010079 221
244 3300006051 Ga0075364_10049147 Ga0075364_100491473 221
245 3300006058 Ga0075432_10000186 Ga0075432_100001869 221
246 3300006058 Ga0075432_10000507 Ga0075432_100005079 221
247 3300006058 Ga0075432_10004561 Ga0075432_100045614 221
248 3300006058 Ga0075432_10020576 Ga0075432_100205762 221
249 3300006058 Ga0075432_10026564 Ga0075432_100265642 221
250 3300006058 Ga0075432_10116392 Ga0075432_101163921 221
251 3300006177 Ga0075362_10006136 Ga0075362_100061362 221
252 3300006177 Ga0075362_10013629 Ga0075362_100136292 221
253 3300006177 Ga0075362_10052323 Ga0075362_100523233 221
254 3300006186 Ga0075369_10062933 Ga0075369_100629333 221
255 3300006195 Ga0075366_10143775 Ga0075366_101437752 221
256 3300006846 Ga0075430_100202311 Ga0075430_1002023112 221
257 3300006914 Ga0075436_100079629 Ga0075436_1000796292 221
258 3300009011 Ga0105251_10002212 Ga0105251_1000221211 221
259 3300009011 Ga0105251_10008183 Ga0105251_100081833 221
260 3300009011 Ga0105251_10016580 Ga0105251_100165803 221
261 3300009011 Ga0105251_10073487 Ga0105251_100734872 221
262 3300009011 Ga0105251_10149441 Ga0105251_101494412 221
263 3300009036 Ga0105244_10003143 Ga0105244_100031436 221
264 3300009036 Ga0105244_10014892 Ga0105244_100148922 221
265 3300009036 Ga0105244_10026975 Ga0105244_100269752 221
266 3300009036 Ga0105244_10230072 Ga0105244_102300721 221
267 3300009092 Ga0105250_10050949 Ga0105250_100509492 221
268 3300009092 Ga0105250_10149276 Ga0105250_101492761 221
269 3300009092 Ga0105250_10153662 Ga0105250_101536622 221
270 3300009148 Ga0105243_10003560 Ga0105243_100035603 221
271 3300009545 Ga0105237_10006162 Ga0105237_100061624 221
272 3300009551 Ga0105238_10131117 Ga0105238_101311172 221
273 3300010375 Ga0105239_10000839 Ga0105239_1000083926 221
274 3300011119 Ga0105246_10025782 Ga0105246_100257824 221
275 3300013100 Ga0157373_10039168 Ga0157373_100391682 221
276 3300013100 Ga0157373_10500888 Ga0157373_105008882 221
277 3300013104 Ga0157370_10106850 Ga0157370_101068503 221
278 3300013104 Ga0157370_10198525 Ga0157370_101985252 221
279 3300013308 Ga0157375_10000888 Ga0157375_100008882 221
280 3300013308 Ga0157375_10295093 Ga0157375_102950932 221
281 3300014497 Ga0182008_10000450 Ga0182008_1000045018 221
282 3300014497 Ga0182008_10003201 Ga0182008_100032014 221
283 3300014497 Ga0182008_10005130 Ga0182008_100051304 221
284 3300014497 Ga0182008_10051087 Ga0182008_100510872 221
285 3300015261 Ga0182006_1015369 Ga0182006_10153693 221
286 3300015261 Ga0182006_1028614 Ga0182006_10286142 221
287 3300015262 Ga0182007_10005084 Ga0182007_100050841 221
288 3300015262 Ga0182007_10072843 Ga0182007_100728432 221
289 3300015265 Ga0182005_1000795 Ga0182005_10007959 221
290 3300015265 Ga0182005_1001940 Ga0182005_10019408 221
291 3300017792 Ga0163161_10010274 Ga0163161_100102748 221
292 3300017792 Ga0163161_10231292 Ga0163161_102312922 221
293 3300017792 Ga0163161_10619262 Ga0163161_106192621 221
294 3300025256 Ga0209759_1001315 Ga0209759_10013154 221
295 3300025292 Ga0209676_1002079 Ga0209676_10020796 221
296 3300025298 Ga0209050_1001665 Ga0209050_100166510 221
297 3300025711 Ga0207696_1000006 Ga0207696_1000006229 221
298 3300025711 Ga0207696_1000205 Ga0207696_100020564 221
299 3300025728 Ga0207655_1005027 Ga0207655_10050272 221
300 3300025728 Ga0207655_1007554 Ga0207655_10075542 221
301 3300025728 Ga0207655_1010592 Ga0207655_10105924 221
302 3300025728 Ga0207655_1035405 Ga0207655_10354053 221
303 3300025728 Ga0207655_1066865 Ga0207655_10668652 221
304 3300025735 Ga0207713_1000724 Ga0207713_100072423 221
305 3300025735 Ga0207713_1001683 Ga0207713_10016839 221
306 3300025735 Ga0207713_1007730 Ga0207713_10077303 221
307 3300025735 Ga0207713_1013775 Ga0207713_10137753 221
308 3300025735 Ga0207713_1117641 Ga0207713_11176411 221
309 3300025910 Ga0207684_10045987 Ga0207684_100459874 221
310 3300025913 Ga0207695_10021849 Ga0207695_100218494 221
311 3300025914 Ga0207671_10030563 Ga0207671_100305632 221
312 3300025935 Ga0207709_10050270 Ga0207709_100502702 221
313 3300027907 Ga0207428_10004619 Ga0207428_1000461915 221
314 3300027907 Ga0207428_10015481 Ga0207428_100154816 221
315 3300027907 Ga0207428_10022315 Ga0207428_100223154 221
316 3300027907 Ga0207428_10241691 Ga0207428_102416912 221
317 3300031548 Ga0307408_100004307 Ga0307408_1000043074 221
318 3300031731 Ga0307405_10004697 Ga0307405_100046978 221
319 3300041405 Ga0439438_000737 Ga0439438_000737_8210_8875 221
320 3300041405 Ga0439438_001069 Ga0439438_001069_4659_5324 221
321 3300041405 Ga0439438_006023 Ga0439438_006023_1722_2402 221
322 3300041407 Ga0439447_011588 Ga0439447_011588_1061_1726 221
323 3300041411 Ga0439466_0001767 Ga0439466_0001767_5693_6358 221
324 3300041411 Ga0439466_0030563 Ga0439466_0030563_1000_1680 221
325 3300041413 Ga0439465_0034664 Ga0439465_0034664_931_1596 221
326 3300041997 Ga0439431_0024786 Ga0439431_0024786_430_1107 221
327 3300042006 Ga0439432_000336 Ga0439432_000336_6987_7652 221
328 3300042009 Ga0439451_002232 Ga0439451_002232_179_844 221
329 3300042009 Ga0439451_024083 Ga0439451_024083_96_761 221
330 3300042009 Ga0439451_037404 Ga0439451_037404_42_707 221
331 3300042010 Ga0439452_001610 Ga0439452_001610_6729_7394 221
332 3300042010 Ga0439452_009261 Ga0439452_009261_421_1101 221
333 3300042010 Ga0439452_017940 Ga0439452_017940_340_1005 221
334 3300042013 Ga0439456_006355 Ga0439456_006355_1721_2386 221
335 3300042013 Ga0439456_064167 Ga0439456_064167_84_764 221
336 3300042016 Ga0439463_000012 Ga0439463_000012_20013_20684 221
337 3300042121 Ga0450919_000868 Ga0450919_000868_2908_3573 221
338 3300042124 Ga0450922_004148 Ga0450922_004148_606_1271 221
339 3300042127 Ga0450890_002190 Ga0450890_002190_1327_1992 221
340 3300042131 Ga0450894_001468 Ga0450894_001468_2577_3245 221
341 3300042134 Ga0450898_001428 Ga0450898_001428_2308_2976 221
342 3300042135 Ga0450899_002647 Ga0450899_002647_1227_1895 221
343 3300042137 Ga0450902_001375 Ga0450902_001375_2377_3042 221
344 3300042138 Ga0450903_001499 Ga0450903_001499_3524_4189 221
345 3300042138 Ga0450903_002822 Ga0450903_002822_1856_2521 221
346 3300042145 Ga0450906_002309 Ga0450906_002309_724_1389 221
347 3300042146 Ga0450907_000283 Ga0450907_000283_8215_8880 221
348 3300042146 Ga0450907_000944 Ga0450907_000944_510_1175 221
349 3300042147 Ga0450910_000298 Ga0450910_000298_3750_4415 221
350 3300042147 Ga0450910_004494 Ga0450910_004494_488_1153 221
351 3300042156 Ga0439446_0017951 Ga0439446_0017951_258_923 221
352 3300042184 Ga0450908_000101 Ga0450908_000101_8348_9013 221
353 3300042184 Ga0450908_005563 Ga0450908_005563_913_1578 221
354 3300042185 Ga0450909_000768 Ga0450909_000768_2790_3455 221
355 3300042461 Ga0439460_0000791 Ga0439460_0000791_862_1527 221
356 3300042461 Ga0439460_0001387 Ga0439460_0001387_379_1044 221
357 3300042993 Ga0439440_0010988 Ga0439440_0010988_383_1054 221
358 3300046452 Ga0495617_000074 Ga0495617_000074_45294_45962 221
359 3300046452 Ga0495617_000633 Ga0495617_000633_6634_7299 221
360 3300046452 Ga0495617_001923 Ga0495617_001923_4725_5390 221
361 3300046453 Ga0495627_001773 Ga0495627_001773_6928_7593 221
362 3300046455 Ga0495603_0003847 Ga0495603_0003847_3215_3883 221
363 3300046457 Ga0495590_0000383 Ga0495590_0000383_17546_18214 221
364 3300046458 Ga0495591_000730 Ga0495591_000730_15294_15959 221
365 3300046458 Ga0495591_002021 Ga0495591_002021_6118_6783 221
366 3300046459 Ga0495629_0004313 Ga0495629_0004313_2951_3619 221
367 3300046460 Ga0495638_0001966 Ga0495638_0001966_14545_15210 221
368 3300046460 Ga0495638_0032342 Ga0495638_0032342_777_1442 221
369 3300046460 Ga0495638_0034100 Ga0495638_0034100_2129_2794 221
370 3300046463 Ga0495653_0001150 Ga0495653_0001150_8353_9021 221
371 3300046463 Ga0495653_0002697 Ga0495653_0002697_2032_2700 221
372 3300046471 Ga0495650_0000522 Ga0495650_0000522_17572_18240 221
373 3300046471 Ga0495650_0001328 Ga0495650_0001328_16345_17010 221
374 3300046471 Ga0495650_0002139 Ga0495650_0002139_6786_7451 221
375 3300046472 Ga0495580_0001423 Ga0495580_0001423_310_975 221
376 3300046472 Ga0495580_0004994 Ga0495580_0004994_4955_5623 221
377 3300046474 Ga0495605_0000274 Ga0495605_0000274_28593_29261 221
378 3300046474 Ga0495605_0009759 Ga0495605_0009759_3456_4121 221
379 3300046474 Ga0495605_0018473 Ga0495605_0018473_1271_1936 221
380 3300046474 Ga0495605_0023072 Ga0495605_0023072_2520_3185 221
381 3300046474 Ga0495605_0031728 Ga0495605_0031728_312_977 221
382 3300046491 Ga0495584_0000084 Ga0495584_0000084_24171_24836 221
383 3300046491 Ga0495584_0000094 Ga0495584_0000094_16900_17568 221
384 3300046491 Ga0495584_0001384 Ga0495584_0001384_1607_2272 221
385 3300046491 Ga0495584_0212010 Ga0495584_0212010_291_956 221
386 3300046492 Ga0495585_0003464 Ga0495585_0003464_6214_6879 221
387 3300046499 Ga0495594_0012994 Ga0495594_0012994_1219_1887 221
388 3300046499 Ga0495594_0079077 Ga0495594_0079077_136_801 221
389 3300046500 Ga0495596_0000004 Ga0495596_0000004_93739_94404 221
390 3300046501 Ga0495607_0000092 Ga0495607_0000092_64713_65381 221
391 3300046501 Ga0495607_0001089 Ga0495607_0001089_8822_9487 221
392 3300046501 Ga0495607_0002203 Ga0495607_0002203_2900_3568 221
393 3300046501 Ga0495607_0010881 Ga0495607_0010881_3183_3848 221
394 3300046501 Ga0495607_0024798 Ga0495607_0024798_2621_3286 221
395 3300046501 Ga0495607_0067235 Ga0495607_0067235_1038_1706 221
396 3300046506 Ga0495583_0000172 Ga0495583_0000172_10429_11094 221
397 3300046506 Ga0495583_0002339 Ga0495583_0002339_10366_11052 221
398 3300046506 Ga0495583_0004614 Ga0495583_0004614_2916_3584 221
399 3300046506 Ga0495583_0014490 Ga0495583_0014490_721_1389 221
400 3300046506 Ga0495583_0113598 Ga0495583_0113598_291_956 221
401 3300046507 Ga0495606_0000677 Ga0495606_0000677_23908_24573 221
402 3300046507 Ga0495606_0001019 Ga0495606_0001019_32164_32829 221
403 3300046512 Ga0495610_0004302 Ga0495610_0004302_1912_2577 221
404 3300046512 Ga0495610_0033475 Ga0495610_0033475_1937_2614 221
405 3300046513 Ga0495616_0003847 Ga0495616_0003847_3052_3717 221
406 3300046515 Ga0495620_0001273 Ga0495620_0001273_6639_7304 221
407 3300046515 Ga0495620_0003458 Ga0495620_0003458_3975_4643 221
408 3300046516 Ga0495628_0003725 Ga0495628_0003725_6648_7313 221
409 3300046516 Ga0495628_0541847 Ga0495628_0541847_136_804 221
410 3300046518 Ga0495631_0018576 Ga0495631_0018576_1821_2486 221
411 3300046518 Ga0495631_0027234 Ga0495631_0027234_1068_1733 221
412 3300046519 Ga0495632_0000170 Ga0495632_0000170_37630_38295 221
413 3300046519 Ga0495632_0000200 Ga0495632_0000200_15227_15895 221
414 3300046519 Ga0495632_0001021 Ga0495632_0001021_6533_7198 221
415 3300046519 Ga0495632_0012417 Ga0495632_0012417_3999_4664 221
416 3300046520 Ga0495637_0000562 Ga0495637_0000562_18814_19479 221
417 3300046520 Ga0495637_0001997 Ga0495637_0001997_6890_7555 221
418 3300046520 Ga0495637_0002679 Ga0495637_0002679_6655_7323 221
419 3300046520 Ga0495637_0003304 Ga0495637_0003304_5812_6477 221
420 3300046522 Ga0495643_0006294 Ga0495643_0006294_4840_5505 221
421 3300046522 Ga0495643_0012927 Ga0495643_0012927_713_1378 221
422 3300046522 Ga0495643_0052770 Ga0495643_0052770_1365_2030 221
423 3300046523 Ga0495644_0039226 Ga0495644_0039226_644_1309 221
424 3300046523 Ga0495644_0044703 Ga0495644_0044703_131_796 221
425 3300046524 Ga0495648_0002381 Ga0495648_0002381_14524_15189 221
426 3300046524 Ga0495648_0008245 Ga0495648_0008245_2103_2771 221
427 3300046524 Ga0495648_0011242 Ga0495648_0011242_2708_3376 221
428 3300046524 Ga0495648_0014286 Ga0495648_0014286_4258_4923 221
429 3300046524 Ga0495648_0031933 Ga0495648_0031933_1766_2431 221
430 3300046526 Ga0495666_0000764 Ga0495666_0000764_11047_11715 221
431 3300046528 Ga0495642_0000234 Ga0495642_0000234_15256_15924 221
432 3300046528 Ga0495642_0000584 Ga0495642_0000584_7284_7949 221
433 3300046528 Ga0495642_0044504 Ga0495642_0044504_53_721 221
434 3300046530 Ga0495654_0000185 Ga0495654_0000185_54173_54841 221
435 3300046530 Ga0495654_0000465 Ga0495654_0000465_20260_20928 221
436 3300046530 Ga0495654_0000551 Ga0495654_0000551_14556_15221 221
437 3300046530 Ga0495654_0004692 Ga0495654_0004692_4960_5625 221
438 3300046530 Ga0495654_0018822 Ga0495654_0018822_1033_1698 221
439 3300046530 Ga0495654_0023070 Ga0495654_0023070_2516_3184 221
440 3300046530 Ga0495654_0060267 Ga0495654_0060267_796_1464 221
441 3300046530 Ga0495654_0074784 Ga0495654_0074784_792_1457 221
442 3300046531 Ga0495665_0016147 Ga0495665_0016147_2882_3634 221
443 3300046531 Ga0495665_0026602 Ga0495665_0026602_417_1085 221
444 3300046536 Ga0495587_0000835 Ga0495587_0000835_11341_12009 221
445 3300046538 Ga0495609_0000579 Ga0495609_0000579_12512_13180 221
446 3300046538 Ga0495609_0006320 Ga0495609_0006320_449_1114 221
447 3300046542 Ga0495597_0002307 Ga0495597_0002307_5107_5775 221
448 3300046542 Ga0495597_0004922 Ga0495597_0004922_5591_6256 221
449 3300046542 Ga0495597_0013181 Ga0495597_0013181_345_1013 221
450 3300046542 Ga0495597_0014501 Ga0495597_0014501_2290_2955 221
451 3300046542 Ga0495597_0026860 Ga0495597_0026860_20_685 221
452 3300046542 Ga0495597_0076760 Ga0495597_0076760_748_1413 221
453 3300046557 Ga0495622_0003408 Ga0495622_0003408_3022_3690 221
454 3300046557 Ga0495622_0009163 Ga0495622_0009163_1834_2499 221
455 3300046558 Ga0495633_0013146 Ga0495633_0013146_1670_2338 221
456 3300046615 Ga0495656_0006084 Ga0495656_0006084_165_830 221
457 3300046616 Ga0495668_0000159 Ga0495668_0000159_86274_86939 221
458 3300046642 Ga0495634_0000347 Ga0495634_0000347_18490_19158 221
459 3300046648 Ga0495611_0001152 Ga0495611_0001152_5005_5673 221
460 3300046648 Ga0495611_0017121 Ga0495611_0017121_273_941 221
461 3300046660 Ga0495625_0005230 Ga0495625_0005230_7836_8501 221
462 3300046660 Ga0495625_0008077 Ga0495625_0008077_4130_4816 221
463 3300046660 Ga0495625_0027930 Ga0495625_0027930_3230_3895 221
464 3300046660 Ga0495625_0039929 Ga0495625_0039929_116_781 221
465 3300046660 Ga0495625_0053278 Ga0495625_0053278_96_761 221
466 3300046663 Ga0495635_0000402 Ga0495635_0000402_8853_9521 221
467 3300046664 Ga0495659_0000252 Ga0495659_0000252_13644_14309 221
468 3300046664 Ga0495659_0001527 Ga0495659_0001527_2723_3388 221
469 3300046664 Ga0495659_0003217 Ga0495659_0003217_3752_4420 221
470 3300046664 Ga0495659_0038983 Ga0495659_0038983_662_1327 221
471 3300046665 Ga0495661_0000968 Ga0495661_0000968_14698_15363 221
472 3300046665 Ga0495661_0001702 Ga0495661_0001702_11025_11690 221
473 3300046674 Ga0495588_0000444 Ga0495588_0000444_8319_8984 221
474 3300046680 Ga0495646_0000541 Ga0495646_0000541_11341_12009 221
475 3300046680 Ga0495646_0064897 Ga0495646_0064897_809_1474 221
476 3300046680 Ga0495646_0102413 Ga0495646_0102413_708_1376 221
477 3300046684 Ga0495669_0002439 Ga0495669_0002439_4281_4946 221
478 3300046684 Ga0495669_0110793 Ga0495669_0110793_230_916 221
479 3300046684 Ga0495669_0115566 Ga0495669_0115566_487_1152 221
480 3300046689 Ga0495613_0098781 Ga0495613_0098781_1332_2000 221
481 3300046690 Ga0495624_0004099 Ga0495624_0004099_3007_3675 221
482 3300046691 Ga0495670_0000279 Ga0495670_0000279_2779_3444 221
483 3300046691 Ga0495670_0068576 Ga0495670_0068576_164_829 221
484 3300046692 Ga0495671_0000136 Ga0495671_0000136_40303_40968 221
485 3300046692 Ga0495671_0002464 Ga0495671_0002464_6782_7447 221
486 3300046692 Ga0495671_0002792 Ga0495671_0002792_4364_5029 221
487 3300046692 Ga0495671_0010621 Ga0495671_0010621_273_938 221
488 3300046694 Ga0495649_0000289 Ga0495649_0000289_14132_14800 221
489 3300046694 Ga0495649_0000811 Ga0495649_0000811_13338_14003 221
490 3300046694 Ga0495649_0001870 Ga0495649_0001870_10059_10724 221
491 3300046694 Ga0495649_0002973 Ga0495649_0002973_1541_2227 221
492 3300046694 Ga0495649_0060411 Ga0495649_0060411_1043_1708 221
493 3300046694 Ga0495649_0124955 Ga0495649_0124955_627_1292 221
494 3300046794 Ga0495589_0000075 Ga0495589_0000075_44509_45177 221
495 3300046794 Ga0495589_0012935 Ga0495589_0012935_2609_3274 221
496 3300046794 Ga0495589_0015325 Ga0495589_0015325_422_1087 221
497 3300046794 Ga0495589_0083597 Ga0495589_0083597_53_721 221
498 3300046810 Ga0495660_0003587 Ga0495660_0003587_1885_2550 221
499 3300046810 Ga0495660_0006421 Ga0495660_0006421_1101_1769 221
500 3300046810 Ga0495660_0023072 Ga0495660_0023072_2872_3537 221
501 3300046810 Ga0495660_0267270 Ga0495660_0267270_94_759 221
502 3300047318 Ga0495636_0000848 Ga0495636_0000848_8315_8983 221
503 3300047318 Ga0495636_0007051 Ga0495636_0007051_862_1530 221
504 3300047319 Ga0495674_0003028 Ga0495674_0003028_13607_14275 221
505 3300047319 Ga0495674_0044817 Ga0495674_0044817_2026_2694 221
506 3300047319 Ga0495674_0213314 Ga0495674_0213314_871_1536 221
507 3300047319 Ga0495674_0366490 Ga0495674_0366490_343_1011 221
508 3300047319 Ga0495674_0474171 Ga0495674_0474171_29_694 221
509 3300047320 Ga0495672_0000433 Ga0495672_0000433_25856_26524 221
510 3300047320 Ga0495672_0003284 Ga0495672_0003284_10293_10958 221
511 3300047320 Ga0495672_0005169 Ga0495672_0005169_6050_6715 221
512 3300047320 Ga0495672_0015262 Ga0495672_0015262_3188_3856 221
513 3300047320 Ga0495672_0032069 Ga0495672_0032069_2451_3116 221
514 3300047320 Ga0495672_0065704 Ga0495672_0065704_157_822 221
515 3300047321 Ga0495676_0077746 Ga0495676_0077746_1019_1687 221
516 3300047323 Ga0495683_0002119 Ga0495683_0002119_6866_7531 221
517 3300047323 Ga0495683_0004963 Ga0495683_0004963_5989_6654 221
518 3300047323 Ga0495683_0017745 Ga0495683_0017745_2006_2671 221
519 3300047323 Ga0495683_0022758 Ga0495683_0022758_1780_2445 221
520 3300047323 Ga0495683_0105651 Ga0495683_0105651_344_1009 221
521 3300047443 Ga0495687_000343 Ga0495687_000343_45284_45949 221
522 3300047443 Ga0495687_001480 Ga0495687_001480_2285_2953 221
523 3300047443 Ga0495687_007763 Ga0495687_007763_5138_5806 221
524 3300047443 Ga0495687_056546 Ga0495687_056546_890_1555 221
525 3300047445 Ga0495677_0000308 Ga0495677_0000308_10078_10743 221
526 3300047446 Ga0495679_002975 Ga0495679_002975_2192_2857 221
527 3300047447 Ga0495685_036763 Ga0495685_036763_765_1433 221
528 3300047469 Ga0495673_0000142 Ga0495673_0000142_23825_24490 221
529 3300047469 Ga0495673_0002180 Ga0495673_0002180_4644_5312 221
530 3300047469 Ga0495673_0010209 Ga0495673_0010209_1846_2511 221
531 3300047469 Ga0495673_0031515 Ga0495673_0031515_696_1364 221
532 3300047469 Ga0495673_0156069 Ga0495673_0156069_38_703 221
533 3300047470 Ga0495681_0002804 Ga0495681_0002804_4870_5535 221
534 3300047470 Ga0495681_0011182 Ga0495681_0011182_599_1264 221
535 3300047673 Ga0495593_0000536 Ga0495593_0000536_8798_9466 221
536 3300047673 Ga0495593_0003200 Ga0495593_0003200_7004_7672 221
537 3300048089 Ga0495614_0023752 Ga0495614_0023752_312_977 221
538 3300048091 Ga0495626_0000920 Ga0495626_0000920_17917_18585 221
539 3300048091 Ga0495626_0007225 Ga0495626_0007225_449_1114 221
540 3300048091 Ga0495626_0061547 Ga0495626_0061547_940_1605 221
541 3300048903 Ga0496100_0009902 Ga0496100_0009902_1684_2352 221
542 3300048904 Ga0496101_0038144 Ga0496101_0038144_1783_2451 221
543 3300048905 Ga0496102_0000444 Ga0496102_0000444_18177_18845 221
544 3300048906 Ga0496103_0000290 Ga0496103_0000290_17681_18349 221
545 3300048908 Ga0496105_0120032 Ga0496105_0120032_56_724 221
546 3300048909 Ga0496106_0082321 Ga0496106_0082321_1156_1824 221
547 3300048910 Ga0496107_0102961 Ga0496107_0102961_919_1587 221
548 3300048910 Ga0496107_0220184 Ga0496107_0220184_667_1332 221
549 3300048913 Ga0496110_0623073 Ga0496110_0623073_247_912 221
550 3300048914 Ga0496111_0133926 Ga0496111_0133926_126_794 221
551 3300048915 Ga0496112_0108732 Ga0496112_0108732_1943_2611 221
552 3300048916 Ga0496113_0017000 Ga0496113_0017000_2301_2969 221
553 3300048917 Ga0496114_0015450 Ga0496114_0015450_4161_4829 221
554 3300048918 Ga0496115_0018008 Ga0496115_0018008_4153_4821 221
555 3300048918 Ga0496115_0257097 Ga0496115_0257097_561_1229 221
556 3300048919 Ga0496116_0000231 Ga0496116_0000231_13656_14321 221
557 3300048920 Ga0496117_0005335 Ga0496117_0005335_8443_9111 221
558 3300048920 Ga0496117_0007320 Ga0496117_0007320_8849_9517 221
559 3300048920 Ga0496117_0171436 Ga0496117_0171436_473_1138 221
560 3300048921 Ga0496118_0000106 Ga0496118_0000106_7065_7733 221
561 3300048921 Ga0496118_0004391 Ga0496118_0004391_4455_5123 221
562 3300048921 Ga0496118_0044105 Ga0496118_0044105_1840_2508 221
563 3300048921 Ga0496118_0059569 Ga0496118_0059569_1840_2508 221
564 3300048922 Ga0496119_0047576 Ga0496119_0047576_919_1587 221
565 3300048922 Ga0496119_0115870 Ga0496119_0115870_167_835 221
566 3300048922 Ga0496119_0198121 Ga0496119_0198121_98_766 221
567 3300048923 Ga0496120_0295650 Ga0496120_0295650_19_687 221
568 3300048924 Ga0496121_0000502 Ga0496121_0000502_29006_29674 221
569 3300048924 Ga0496121_0001139 Ga0496121_0001139_40436_41104 221
570 3300048924 Ga0496121_0003175 Ga0496121_0003175_12131_12802 221
571 3300048924 Ga0496121_0024073 Ga0496121_0024073_57_725 221
572 3300048924 Ga0496121_0035719 Ga0496121_0035719_1580_2245 221
573 3300048924 Ga0496121_0039251 Ga0496121_0039251_297_965 221
574 3300048924 Ga0496121_0061950 Ga0496121_0061950_1211_1879 221
575 3300048925 Ga0496122_0003924 Ga0496122_0003924_4702_5367 221
576 3300048927 Ga0496124_0016723 Ga0496124_0016723_6156_6824 221
577 3300048927 Ga0496124_0220975 Ga0496124_0220975_394_1062 221
578 3300048927 Ga0496124_0376411 Ga0496124_0376411_194_862 221
579 3300048927 Ga0496124_0415629 Ga0496124_0415629_252_917 221
580 3300048928 Ga0496125_0000038 Ga0496125_0000038_69612_70280 221
581 3300048928 Ga0496125_0015063 Ga0496125_0015063_3088_3756 221
582 3300048929 Ga0496126_0001154 Ga0496126_0001154_14152_14820 221
583 3300048929 Ga0496126_0019278 Ga0496126_0019278_5308_5976 221
584 3300048929 Ga0496126_0058171 Ga0496126_0058171_324_992 221
585 3300048929 Ga0496126_0092880 Ga0496126_0092880_1788_2456 221
586 3300048929 Ga0496126_0097754 Ga0496126_0097754_326_994 221
587 3300048929 Ga0496126_0108320 Ga0496126_0108320_1405_2070 221
588 3300048929 Ga0496126_0313510 Ga0496126_0313510_609_1277 221
589 3300049459 Ga0495678_000255 Ga0495678_000255_42766_43434 221
590 3300049459 Ga0495678_000987 Ga0495678_000987_21124_21789 221
591 3300049459 Ga0495678_046221 Ga0495678_046221_276_941 221
592 3300049459 Ga0495678_083497 Ga0495678_083497_413_1081 221
593 3300049460 Ga0495682_0000497 Ga0495682_0000497_17820_18485 221
594 3300049460 Ga0495682_0000755 Ga0495682_0000755_14336_15001 221
595 3300049460 Ga0495682_0008624 Ga0495682_0008624_449_1114 221
596 3300049460 Ga0495682_0010343 Ga0495682_0010343_1756_2421 221
597 3300050489 nmdc:mga03683_160342_c1 nmdc:mga03683_160342_c1_62_730 221
598 3300050489 nmdc:mga03683_31525_c1 nmdc:mga03683_31525_c1_1263_1931 221
599 3300050491 nmdc:mga00v17_46366_c1 nmdc:mga00v17_46366_c1_81_749 221
600 3300050491 nmdc:mga00v17_75582_c1 nmdc:mga00v17_75582_c1_669_1337 221
601 3300050492 nmdc:mga0yw44_58061_c1 nmdc:mga0yw44_58061_c1_1062_1730 221
602 3300050493 nmdc:mga0k408_18265_c1 nmdc:mga0k408_18265_c1_1837_2505 221
603 3300050493 nmdc:mga0k408_41878_c1 nmdc:mga0k408_41878_c1_286_954 221
604 3300050496 nmdc:mga07m45_228301_c1 nmdc:mga07m45_228301_c1_243_911 221
605 3300050509 nmdc:mga0qj67_162015_c1 nmdc:mga0qj67_162015_c1_831_1499 221
606 3300050514 nmdc:mga08x19_234819_c1 nmdc:mga08x19_234819_c1_290_958 221
607 3300050514 nmdc:mga08x19_44047_c1 nmdc:mga08x19_44047_c1_586_1251 221
608 3300050516 nmdc:mga0sz30_70209_c1 nmdc:mga0sz30_70209_c1_781_1449 221
609 3300053117 Ga0500593_000199 Ga0500593_000199_6445_7113 221
610 3300053161 Ga0500634_0017002 Ga0500634_0017002_1991_2656 221
611 3300053730 Ga0500645_003921 Ga0500645_003921_3900_4568 221
612 3300055283 Ga0500661_000983 Ga0500661_000983_4101_4769 221
613 iso_pu_bacteria 2808606445 2809215345 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

43

199

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k4i-assembly1.cif.gz_C crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.939 2 208
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.9268 6 209
5ir2-assembly1.cif.gz_A crystal structure of novel cellulases from microbes associated with the gut ecosystem 0.9016 1 193
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.8915 6 209
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.888 6 199
ID Description Score Start End Superfamily
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9218 2 173 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9163 2 173 3.50.30.40
5ir2A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8854 1 193 3.50.30.40
af_Q5AP69_11_244_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8745 5 207 3.50.30.40
af_Q58060_12_207_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8596 8 208 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A257H299-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9939 1 206 GO:0046872
AF-A0A2C5ZBK0-F1-model_v4 Demethylmenaquinone methyltransferase 0.9933 6 221 GO:0046872
AF-A0A554TY55-F1-model_v4 deleted 0.9861 2 219
AF-A0A257H299-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Regulator of ribonuclease activity homolog) (RraA-like protein) 0.9843 1 206 GO:0046872
AF-A0A2G7FS70-F1-model_v4 Demethylmenaquinone methyltransferase family protein 0.9842 1 221 GO:0000166
GO:0008168
GO:0016651
GO:0032259
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.02 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map