F468202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 602 | 296 | 602 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0034123|Ga0495638_0034123_2673_3044 |
| Length | 123 |
| Sequence | MEKGYSIKHRDAFERMEGSGESTWLLARKALGTDAFGYNLVEIGPGGKIPEHAESGGQVELYVILEGEAVFVMDGEELVAPAGTFASIEPAVSRSIHNRSAGKVTAMLIGVDPSGNYEPMSWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 181 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 182 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 183 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 265 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 289 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 291 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 292 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 293 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1 |
| Nodule | 0 |
| Rhizoplane | 11.13 |
| Rhizosphere | 86.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000566 | 3300001977 | Bacteria | 5583 |
| 2 | JGI24740J21852_10002767 | 3300001979 | Bacteria | 7845 |
| 3 | JGI24743J22301_10134867 | 3300001991 | Bacteria | 547 |
| 4 | JGI24748J21848_1000241 | 3300002074 | Bacteria | 6544 |
| 5 | JGI24034J26672_10000120 | 3300002239 | Bacteria | 11999 |
| 6 | JGI24742J22300_10010826 | 3300002244 | Bacteria | 1511 |
| 7 | Ga0070683_100007274 | 3300005329 | Bacteria | 9338 |
| 8 | Ga0070683_100010609 | 3300005329 | Bacteria | 7919 |
| 9 | Ga0070683_100015665 | 3300005329 | Bacteria | 6665 |
| 10 | Ga0070683_100112957 | 3300005329 | Bacteria | 2563 |
| 11 | Ga0070683_100126241 | 3300005329 | Bacteria | 2419 |
| 12 | Ga0070683_100134601 | 3300005329 | Bacteria | 2340 |
| 13 | Ga0070670_100425650 | 3300005331 | Unclassified | 1174 |
| 14 | Ga0070677_10000085 | 3300005333 | Bacteria | 29927 |
| 15 | Ga0070680_100215276 | 3300005336 | Unclassified | 1621 |
| 16 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 17 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 18 | Ga0070682_100435064 | 3300005337 | Bacteria | 1001 |
| 19 | Ga0068868_100000104 | 3300005338 | Bacteria | 52249 |
| 20 | Ga0068868_100000220 | 3300005338 | Bacteria | 38739 |
| 21 | Ga0070689_100071524 | 3300005340 | Bacteria | 2710 |
| 22 | Ga0070689_100105239 | 3300005340 | Bacteria | 2238 |
| 23 | Ga0070691_10000275 | 3300005341 | Bacteria | 17919 |
| 24 | Ga0070691_10001199 | 3300005341 | Bacteria | 10870 |
| 25 | Ga0070691_10024493 | 3300005341 | Unclassified | 2805 |
| 26 | Ga0070668_100006928 | 3300005347 | Bacteria | 8398 |
| 27 | Ga0070668_100351240 | 3300005347 | Unclassified | 1248 |
| 28 | Ga0070669_100507436 | 3300005353 | Bacteria | 1001 |
| 29 | Ga0070675_100000069 | 3300005354 | Bacteria | 59717 |
| 30 | Ga0070671_100237787 | 3300005355 | Bacteria | 1546 |
| 31 | Ga0070674_100000019 | 3300005356 | Bacteria | 89350 |
| 32 | Ga0070674_100000030 | 3300005356 | Bacteria | 69481 |
| 33 | Ga0070673_100006768 | 3300005364 | Bacteria | 7480 |
| 34 | Ga0070688_100000053 | 3300005365 | Bacteria | 55064 |
| 35 | Ga0070688_100122084 | 3300005365 | Bacteria | 1746 |
| 36 | Ga0070688_100908241 | 3300005365 | Bacteria | 695 |
| 37 | Ga0070659_100015340 | 3300005366 | Bacteria | 5738 |
| 38 | Ga0070659_100155757 | 3300005366 | Bacteria | 1866 |
| 39 | Ga0070659_101140284 | 3300005366 | Unclassified | 688 |
| 40 | Ga0070667_100002266 | 3300005367 | Bacteria | 16947 |
| 41 | Ga0070667_101546503 | 3300005367 | Bacteria | 623 |
| 42 | Ga0070703_10169785 | 3300005406 | Bacteria | 834 |
| 43 | Ga0070714_100036362 | 3300005435 | Bacteria | 4130 |
| 44 | Ga0070714_100037035 | 3300005435 | Bacteria | 4097 |
| 45 | Ga0070713_100000023 | 3300005436 | Bacteria | 98528 |
| 46 | Ga0070710_10409277 | 3300005437 | Bacteria | 911 |
| 47 | Ga0070701_10188915 | 3300005438 | Bacteria | 1211 |
| 48 | Ga0070701_10719961 | 3300005438 | Unclassified | 673 |
| 49 | Ga0070711_100004129 | 3300005439 | Bacteria | 8536 |
| 50 | Ga0070711_100628171 | 3300005439 | Unclassified | 898 |
| 51 | Ga0070700_100167973 | 3300005441 | Bacteria | 1517 |
| 52 | Ga0070694_101460428 | 3300005444 | Bacteria | 578 |
| 53 | Ga0070663_100626614 | 3300005455 | Bacteria | 907 |
| 54 | Ga0070663_100635651 | 3300005455 | Bacteria | 901 |
| 55 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 56 | Ga0070681_10042499 | 3300005458 | Bacteria | 4554 |
| 57 | Ga0070685_10000032 | 3300005466 | Bacteria | 84253 |
| 58 | Ga0070685_10000086 | 3300005466 | Bacteria | 57017 |
| 59 | Ga0070685_10132387 | 3300005466 | Unclassified | 1561 |
| 60 | Ga0070685_10407577 | 3300005466 | Bacteria | 943 |
| 61 | Ga0070679_100000258 | 3300005530 | Bacteria | 44384 |
| 62 | Ga0070684_100008110 | 3300005535 | Bacteria | 8198 |
| 63 | Ga0070684_100044980 | 3300005535 | Bacteria | 3821 |
| 64 | Ga0070684_100080941 | 3300005535 | Bacteria | 2873 |
| 65 | Ga0070684_101549075 | 3300005535 | Unclassified | 625 |
| 66 | Ga0068853_100021670 | 3300005539 | Bacteria | 5361 |
| 67 | Ga0068853_100615476 | 3300005539 | Bacteria | 1032 |
| 68 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 69 | Ga0070686_101896915 | 3300005544 | Bacteria | 508 |
| 70 | Ga0070695_101231057 | 3300005545 | Bacteria | 617 |
| 71 | Ga0070693_100000638 | 3300005547 | Bacteria | 15431 |
| 72 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 73 | Ga0070665_100017640 | 3300005548 | Bacteria | 7168 |
| 74 | Ga0070665_100094251 | 3300005548 | Bacteria | 2999 |
| 75 | Ga0070665_100216008 | 3300005548 | Unclassified | 1918 |
| 76 | Ga0070704_100331076 | 3300005549 | Bacteria | 1279 |
| 77 | Ga0068855_102542366 | 3300005563 | Unclassified | 509 |
| 78 | Ga0070664_100014728 | 3300005564 | Bacteria | 6386 |
| 79 | Ga0070664_100835820 | 3300005564 | Bacteria | 862 |
| 80 | Ga0068854_100000345 | 3300005578 | Bacteria | 29913 |
| 81 | Ga0068854_100029725 | 3300005578 | Bacteria | 3785 |
| 82 | Ga0068856_100003669 | 3300005614 | Bacteria | 15395 |
| 83 | Ga0068856_100026420 | 3300005614 | Bacteria | 5662 |
| 84 | Ga0068856_100193441 | 3300005614 | Unclassified | 2048 |
| 85 | Ga0068856_100195633 | 3300005614 | Bacteria | 2036 |
| 86 | Ga0068856_100829457 | 3300005614 | Unclassified | 944 |
| 87 | Ga0068856_101994131 | 3300005614 | Unclassified | 591 |
| 88 | Ga0070702_100198963 | 3300005615 | Unclassified | 1325 |
| 89 | Ga0070702_101005917 | 3300005615 | Unclassified | 660 |
| 90 | Ga0070702_101253603 | 3300005615 | Unclassified | 600 |
| 91 | Ga0068852_100000037 | 3300005616 | Bacteria | 97602 |
| 92 | Ga0068852_100008636 | 3300005616 | Bacteria | 7526 |
| 93 | Ga0068864_100000043 | 3300005618 | Bacteria | 162928 |
| 94 | Ga0068866_10000005 | 3300005718 | Bacteria | 196339 |
| 95 | Ga0068866_10000382 | 3300005718 | Bacteria | 20838 |
| 96 | Ga0068866_10521183 | 3300005718 | Unclassified | 790 |
| 97 | Ga0068866_10534891 | 3300005718 | Unclassified | 781 |
| 98 | Ga0068851_10005227 | 3300005834 | Bacteria | 5890 |
| 99 | Ga0068851_10020425 | 3300005834 | Bacteria | 3208 |
| 100 | Ga0068870_10397359 | 3300005840 | Unclassified | 896 |
| 101 | Ga0068863_100000229 | 3300005841 | Bacteria | 59324 |
| 102 | Ga0068863_100002888 | 3300005841 | Bacteria | 17015 |
| 103 | Ga0068863_100268768 | 3300005841 | Bacteria | 1650 |
| 104 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 105 | Ga0068858_100000140 | 3300005842 | Bacteria | 76446 |
| 106 | Ga0068858_100045457 | 3300005842 | Bacteria | 4070 |
| 107 | Ga0068858_100093347 | 3300005842 | Bacteria | 2802 |
| 108 | Ga0068860_100001002 | 3300005843 | Bacteria | 31259 |
| 109 | Ga0068860_100154024 | 3300005843 | Bacteria | 2215 |
| 110 | Ga0068860_100421948 | 3300005843 | Bacteria | 1322 |
| 111 | Ga0068862_100020486 | 3300005844 | Bacteria | 5524 |
| 112 | Ga0081455_10001231 | 3300005937 | Bacteria | 31996 |
| 113 | Ga0081455_10374976 | 3300005937 | Unclassified | 996 |
| 114 | Ga0081540_1000046 | 3300005983 | Bacteria | 131375 |
| 115 | Ga0081540_1216159 | 3300005983 | Unclassified | 685 |
| 116 | Ga0081539_10001074 | 3300005985 | Bacteria | 49797 |
| 117 | Ga0075432_10332856 | 3300006058 | Unclassified | 639 |
| 118 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 119 | Ga0097621_100804729 | 3300006237 | Archaea | 871 |
| 120 | Ga0097621_100958826 | 3300006237 | Bacteria | 799 |
| 121 | Ga0068871_100085751 | 3300006358 | Unclassified | 2616 |
| 122 | Ga0075433_10007173 | 3300006852 | Bacteria | 8827 |
| 123 | Ga0075433_10939506 | 3300006852 | Unclassified | 754 |
| 124 | Ga0068865_100000081 | 3300006881 | Bacteria | 51047 |
| 125 | Ga0105245_10000249 | 3300009098 | Bacteria | 51282 |
| 126 | Ga0105245_10000330 | 3300009098 | Bacteria | 44516 |
| 127 | Ga0105245_10019372 | 3300009098 | Bacteria | 5959 |
| 128 | Ga0105245_10019398 | 3300009098 | Bacteria | 5956 |
| 129 | Ga0105245_11347658 | 3300009098 | Bacteria | 763 |
| 130 | Ga0105247_10002606 | 3300009101 | Bacteria | 12180 |
| 131 | Ga0105247_10345466 | 3300009101 | Bacteria | 1045 |
| 132 | Ga0105247_10828813 | 3300009101 | Bacteria | 708 |
| 133 | Ga0105243_10006390 | 3300009148 | Bacteria | 9104 |
| 134 | Ga0105243_11699923 | 3300009148 | Unclassified | 660 |
| 135 | Ga0105241_10124872 | 3300009174 | Bacteria | 2077 |
| 136 | Ga0105241_10216916 | 3300009174 | Unclassified | 1606 |
| 137 | Ga0105242_10000052 | 3300009176 | Bacteria | 79244 |
| 138 | Ga0105242_10035964 | 3300009176 | Bacteria | 3971 |
| 139 | Ga0105242_10049788 | 3300009176 | Bacteria | 3410 |
| 140 | Ga0105242_10249527 | 3300009176 | Bacteria | 1599 |
| 141 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 142 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 143 | Ga0105249_10000054 | 3300009553 | Bacteria | 162883 |
| 144 | Ga0105249_10005341 | 3300009553 | Bacteria | 11082 |
| 145 | Ga0105239_10217724 | 3300010375 | Bacteria | 2141 |
| 146 | Ga0105239_10332280 | 3300010375 | Bacteria | 1714 |
| 147 | Ga0105239_12098155 | 3300010375 | Bacteria | 657 |
| 148 | Ga0105246_10269439 | 3300011119 | Bacteria | 1360 |
| 149 | Ga0105246_10475227 | 3300011119 | Bacteria | 1056 |
| 150 | Ga0157370_10046483 | 3300013104 | Bacteria | 4162 |
| 151 | Ga0157370_10228969 | 3300013104 | Bacteria | 1721 |
| 152 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 153 | Ga0157374_10000242 | 3300013296 | Bacteria | 50857 |
| 154 | Ga0157374_10085714 | 3300013296 | Bacteria | 2996 |
| 155 | Ga0157374_10715480 | 3300013296 | Bacteria | 1015 |
| 156 | Ga0157378_10046947 | 3300013297 | Bacteria | 3839 |
| 157 | Ga0157378_10052908 | 3300013297 | Bacteria | 3613 |
| 158 | Ga0157378_10064214 | 3300013297 | Bacteria | 3283 |
| 159 | Ga0163162_10302474 | 3300013306 | Unclassified | 1732 |
| 160 | Ga0157372_10000284 | 3300013307 | Bacteria | 56386 |
| 161 | Ga0157375_10000620 | 3300013308 | Bacteria | 31506 |
| 162 | Ga0157375_12661401 | 3300013308 | Unclassified | 598 |
| 163 | Ga0163163_10059017 | 3300014325 | Bacteria | 3794 |
| 164 | Ga0163163_10365762 | 3300014325 | Unclassified | 1499 |
| 165 | Ga0157380_10000178 | 3300014326 | Bacteria | 36761 |
| 166 | Ga0157380_10000838 | 3300014326 | Bacteria | 19239 |
| 167 | Ga0157380_10102618 | 3300014326 | Bacteria | 2385 |
| 168 | Ga0157380_10959792 | 3300014326 | Unclassified | 885 |
| 169 | Ga0157377_10610981 | 3300014745 | Unclassified | 779 |
| 170 | Ga0157377_10632059 | 3300014745 | Bacteria | 768 |
| 171 | Ga0157379_10024043 | 3300014968 | Bacteria | 5407 |
| 172 | Ga0157379_10039602 | 3300014968 | Bacteria | 4205 |
| 173 | Ga0157379_10195594 | 3300014968 | Unclassified | 1827 |
| 174 | Ga0157376_10111428 | 3300014969 | Bacteria | 2409 |
| 175 | Ga0157376_11151965 | 3300014969 | Unclassified | 802 |
| 176 | Ga0163161_10000240 | 3300017792 | Bacteria | 49520 |
| 177 | Ga0163161_10243456 | 3300017792 | Bacteria | 1399 |
| 178 | Ga0163161_10438438 | 3300017792 | Bacteria | 1054 |
| 179 | Ga0206356_10206281 | 3300020070 | Unclassified | 1890 |
| 180 | Ga0207656_10002224 | 3300025321 | Bacteria | 6496 |
| 181 | Ga0207656_10008896 | 3300025321 | Bacteria | 3718 |
| 182 | Ga0207653_10042538 | 3300025885 | Bacteria | 1494 |
| 183 | Ga0207682_10000060 | 3300025893 | Bacteria | 46992 |
| 184 | Ga0207692_10563027 | 3300025898 | Bacteria | 729 |
| 185 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 186 | Ga0207642_10000500 | 3300025899 | Bacteria | 12040 |
| 187 | Ga0207642_10510342 | 3300025899 | Unclassified | 737 |
| 188 | Ga0207710_10000096 | 3300025900 | Bacteria | 116063 |
| 189 | Ga0207710_10402869 | 3300025900 | Unclassified | 702 |
| 190 | Ga0207688_10415841 | 3300025901 | Unclassified | 835 |
| 191 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 192 | Ga0207654_10117527 | 3300025911 | Bacteria | 1664 |
| 193 | Ga0207654_10165808 | 3300025911 | Unclassified | 1430 |
| 194 | Ga0207707_10022249 | 3300025912 | Bacteria | 5543 |
| 195 | Ga0207693_10358157 | 3300025915 | Bacteria | 1141 |
| 196 | Ga0207663_10002802 | 3300025916 | Bacteria | 8403 |
| 197 | Ga0207663_10030099 | 3300025916 | Bacteria | 3198 |
| 198 | Ga0207660_10214982 | 3300025917 | Unclassified | 1507 |
| 199 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 200 | Ga0207652_10000196 | 3300025921 | Bacteria | 63727 |
| 201 | Ga0207681_11262422 | 3300025923 | Unclassified | 620 |
| 202 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 203 | Ga0207650_10120890 | 3300025925 | Unclassified | 2039 |
| 204 | Ga0207659_10001302 | 3300025926 | Bacteria | 14889 |
| 205 | Ga0207687_10000094 | 3300025927 | Bacteria | 64753 |
| 206 | Ga0207687_10000106 | 3300025927 | Bacteria | 61275 |
| 207 | Ga0207687_10010977 | 3300025927 | Bacteria | 5919 |
| 208 | Ga0207687_10011714 | 3300025927 | Bacteria | 5736 |
| 209 | Ga0207687_10885573 | 3300025927 | Bacteria | 763 |
| 210 | Ga0207687_11676517 | 3300025927 | Unclassified | 545 |
| 211 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 212 | Ga0207664_10030260 | 3300025929 | Bacteria | 4134 |
| 213 | Ga0207664_10676386 | 3300025929 | Unclassified | 928 |
| 214 | Ga0207644_10287996 | 3300025931 | Unclassified | 1320 |
| 215 | Ga0207690_10010639 | 3300025932 | Bacteria | 5481 |
| 216 | Ga0207690_10104900 | 3300025932 | Bacteria | 2026 |
| 217 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 218 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 219 | Ga0207686_10003508 | 3300025934 | Bacteria | 8424 |
| 220 | Ga0207686_10285331 | 3300025934 | Bacteria | 1220 |
| 221 | Ga0207686_10549287 | 3300025934 | Bacteria | 903 |
| 222 | Ga0207709_10019786 | 3300025935 | Bacteria | 3789 |
| 223 | Ga0207670_10023085 | 3300025936 | Bacteria | 3866 |
| 224 | Ga0207670_10088689 | 3300025936 | Bacteria | 2182 |
| 225 | Ga0207669_10000029 | 3300025937 | Bacteria | 88351 |
| 226 | Ga0207669_10000047 | 3300025937 | Bacteria | 60937 |
| 227 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 228 | Ga0207704_10140066 | 3300025938 | Bacteria | 1691 |
| 229 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 230 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 231 | Ga0207661_10005996 | 3300025944 | Bacteria | 8582 |
| 232 | Ga0207661_10013598 | 3300025944 | Bacteria | 5944 |
| 233 | Ga0207661_10099391 | 3300025944 | Bacteria | 2440 |
| 234 | Ga0207661_10101096 | 3300025944 | Bacteria | 2421 |
| 235 | Ga0207661_10177052 | 3300025944 | Bacteria | 1860 |
| 236 | Ga0207679_10013592 | 3300025945 | Bacteria | 5336 |
| 237 | Ga0207679_10700427 | 3300025945 | Unclassified | 919 |
| 238 | Ga0207667_10771052 | 3300025949 | Unclassified | 960 |
| 239 | Ga0207651_10004033 | 3300025960 | Bacteria | 7309 |
| 240 | Ga0207712_10000032 | 3300025961 | Bacteria | 210628 |
| 241 | Ga0207712_10007217 | 3300025961 | Bacteria | 7008 |
| 242 | Ga0207668_10080861 | 3300025972 | Unclassified | 2355 |
| 243 | Ga0207668_10666277 | 3300025972 | Unclassified | 912 |
| 244 | Ga0207640_10000077 | 3300025981 | Bacteria | 76155 |
| 245 | Ga0207640_10010886 | 3300025981 | Bacteria | 5131 |
| 246 | Ga0207658_10002876 | 3300025986 | Bacteria | 12335 |
| 247 | Ga0207658_10570280 | 3300025986 | Bacteria | 1014 |
| 248 | Ga0207677_10000479 | 3300026023 | Bacteria | 26103 |
| 249 | Ga0207677_10001833 | 3300026023 | Bacteria | 11221 |
| 250 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 251 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 252 | Ga0207703_10039734 | 3300026035 | Bacteria | 3761 |
| 253 | Ga0207703_10067575 | 3300026035 | Unclassified | 2942 |
| 254 | Ga0207639_10067249 | 3300026041 | Bacteria | 2788 |
| 255 | Ga0207639_10633883 | 3300026041 | Bacteria | 988 |
| 256 | Ga0207639_10987106 | 3300026041 | Bacteria | 788 |
| 257 | Ga0207678_11007096 | 3300026067 | Bacteria | 737 |
| 258 | Ga0207678_11676297 | 3300026067 | Unclassified | 559 |
| 259 | Ga0207708_10189714 | 3300026075 | Bacteria | 1635 |
| 260 | Ga0207708_10933949 | 3300026075 | Bacteria | 752 |
| 261 | Ga0207702_10000419 | 3300026078 | Bacteria | 48574 |
| 262 | Ga0207702_10003965 | 3300026078 | Bacteria | 13291 |
| 263 | Ga0207702_10031122 | 3300026078 | Bacteria | 4447 |
| 264 | Ga0207702_10603808 | 3300026078 | Bacteria | 1077 |
| 265 | Ga0207702_10666544 | 3300026078 | Unclassified | 1024 |
| 266 | Ga0207641_10001796 | 3300026088 | Bacteria | 20626 |
| 267 | Ga0207641_10002314 | 3300026088 | Bacteria | 17689 |
| 268 | Ga0207641_10034705 | 3300026088 | Bacteria | 4198 |
| 269 | Ga0207648_10001072 | 3300026089 | Bacteria | 30645 |
| 270 | Ga0207676_10000042 | 3300026095 | Bacteria | 163475 |
| 271 | Ga0207675_100061701 | 3300026118 | Bacteria | 3499 |
| 272 | Ga0207683_10013197 | 3300026121 | Bacteria | 7048 |
| 273 | Ga0207683_10356576 | 3300026121 | Unclassified | 1343 |
| 274 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 275 | Ga0207698_10008081 | 3300026142 | Bacteria | 6635 |
| 276 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 277 | Ga0268266_10001186 | 3300028379 | Bacteria | 32148 |
| 278 | Ga0268266_10038746 | 3300028379 | Bacteria | 4057 |
| 279 | Ga0268266_10210857 | 3300028379 | Unclassified | 1781 |
| 280 | Ga0268266_10986753 | 3300028379 | Unclassified | 815 |
| 281 | Ga0268265_10029147 | 3300028380 | Bacteria | 3959 |
| 282 | Ga0268264_10003675 | 3300028381 | Bacteria | 13169 |
| 283 | Ga0268264_10072728 | 3300028381 | Bacteria | 2916 |
| 284 | Ga0268264_10293288 | 3300028381 | Unclassified | 1528 |
| 285 | Ga0268264_12077223 | 3300028381 | Unclassified | 577 |
| 286 | Ga0265337_1000101 | 3300028556 | Bacteria | 42173 |
| 287 | Ga0265326_10000033 | 3300028558 | Bacteria | 91972 |
| 288 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 289 | Ga0265334_10098676 | 3300028573 | Unclassified | 1059 |
| 290 | Ga0265323_10263201 | 3300028653 | Bacteria | 535 |
| 291 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 292 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 293 | Ga0265338_11001490 | 3300028800 | Bacteria | 566 |
| 294 | Ga0265324_10000207 | 3300029957 | Bacteria | 44991 |
| 295 | Ga0265324_10075613 | 3300029957 | Unclassified | 1146 |
| 296 | Ga0265332_10034937 | 3300031238 | Bacteria | 2184 |
| 297 | Ga0265328_10001194 | 3300031239 | Bacteria | 12029 |
| 298 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 299 | Ga0265325_10005471 | 3300031241 | Bacteria | 7835 |
| 300 | Ga0265329_10008633 | 3300031242 | Bacteria | 3850 |
| 301 | Ga0265339_10016352 | 3300031249 | Bacteria | 4424 |
| 302 | Ga0265331_10000869 | 3300031250 | Bacteria | 24602 |
| 303 | Ga0265331_10188553 | 3300031250 | Unclassified | 930 |
| 304 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 305 | Ga0265316_10068127 | 3300031344 | Bacteria | 2751 |
| 306 | Ga0265314_10000208 | 3300031711 | Bacteria | 86855 |
| 307 | Ga0265342_10378692 | 3300031712 | Unclassified | 733 |
| 308 | Ga0265342_10628040 | 3300031712 | Bacteria | 540 |
| 309 | Ga0307415_100020148 | 3300032126 | Bacteria | 4066 |
| 310 | Ga0373953_0182304 | 3300035117 | Unclassified | 906 |
| 311 | Ga0373954_0157931 | 3300035118 | Unclassified | 1109 |
| 312 | Ga0373956_0327061 | 3300035119 | Bacteria | 731 |
| 313 | Ga0373943_0791806 | 3300035170 | Unclassified | 564 |
| 314 | Ga0373955_0129684 | 3300035172 | Bacteria | 1471 |
| 315 | Ga0316574_0672238 | 3300035398 | Bacteria | 636 |
| 316 | Ga0373935_0848864 | 3300035692 | Unclassified | 675 |
| 317 | Ga0373937_0015203 | 3300036401 | Bacteria | 6802 |
| 318 | Ga0373937_0463516 | 3300036401 | Bacteria | 1203 |
| 319 | Ga0373937_0595463 | 3300036401 | Unclassified | 1050 |
| 320 | Ga0373937_0759043 | 3300036401 | Bacteria | 917 |
| 321 | Ga0373937_1195500 | 3300036401 | Bacteria | 709 |
| 322 | Ga0395898_1290253 | 3300037466 | Unclassified | 660 |
| 323 | Ga0451791_0052506 | 3300041451 | Bacteria | 1246 |
| 324 | Ga0451800_0357192 | 3300041459 | Bacteria | 601 |
| 325 | Ga0451800_0629083 | 3300041459 | Bacteria | 568 |
| 326 | Ga0451804_0369380 | 3300041463 | Unclassified | 709 |
| 327 | Ga0451807_0497514 | 3300041486 | Bacteria | 2174 |
| 328 | Ga0451807_1858638 | 3300041486 | Unclassified | 1068 |
| 329 | Ga0451835_0782939 | 3300041492 | Unclassified | 659 |
| 330 | Ga0451845_0189617 | 3300041501 | Unclassified | 730 |
| 331 | Ga0451849_0745045 | 3300041505 | Unclassified | 1048 |
| 332 | Ga0451849_1502250 | 3300041505 | Bacteria | 925 |
| 333 | Ga0451853_1500978 | 3300041512 | Unclassified | 1634 |
| 334 | Ga0451853_1723538 | 3300041512 | Bacteria | 2756 |
| 335 | Ga0451853_3840077 | 3300041512 | Bacteria | 3368 |
| 336 | Ga0466963_0000012 | 3300044694 | Bacteria | 62839 |
| 337 | Ga0466963_0044188 | 3300044694 | Bacteria | 2932 |
| 338 | Ga0466960_0163099 | 3300044901 | Bacteria | 1198 |
| 339 | Ga0466960_0208636 | 3300044901 | Bacteria | 1070 |
| 340 | Ga0466967_0000012 | 3300045976 | Bacteria | 104270 |
| 341 | Ga0466967_0027403 | 3300045976 | Bacteria | 4739 |
| 342 | Ga0466967_2037144 | 3300045976 | Unclassified | 570 |
| 343 | Ga0495592_0001189 | 3300046454 | Bacteria | 18063 |
| 344 | Ga0495592_0374756 | 3300046454 | Bacteria | 907 |
| 345 | Ga0495592_0696854 | 3300046454 | Unclassified | 611 |
| 346 | Ga0495603_0000861 | 3300046455 | Bacteria | 17377 |
| 347 | Ga0495603_0007243 | 3300046455 | Bacteria | 6660 |
| 348 | Ga0495629_0000421 | 3300046459 | Bacteria | 35460 |
| 349 | Ga0495629_0018857 | 3300046459 | Bacteria | 4932 |
| 350 | Ga0495629_0033550 | 3300046459 | Bacteria | 3630 |
| 351 | Ga0495629_0519749 | 3300046459 | Archaea | 801 |
| 352 | Ga0495638_0034123 | 3300046460 | Bacteria | 3250 |
| 353 | Ga0495641_0000440 | 3300046461 | Bacteria | 34775 |
| 354 | Ga0495641_0065757 | 3300046461 | Bacteria | 1632 |
| 355 | Ga0495641_0207533 | 3300046461 | Unclassified | 878 |
| 356 | Ga0495651_0165995 | 3300046462 | Bacteria | 1577 |
| 357 | Ga0495653_0013286 | 3300046463 | Bacteria | 6713 |
| 358 | Ga0495653_0093416 | 3300046463 | Bacteria | 2194 |
| 359 | Ga0495653_0165543 | 3300046463 | Bacteria | 1531 |
| 360 | Ga0495653_0188759 | 3300046463 | Bacteria | 1408 |
| 361 | Ga0495653_0259344 | 3300046463 | Unclassified | 1150 |
| 362 | Ga0495582_0000002 | 3300046473 | Bacteria | 219909 |
| 363 | Ga0495639_0027611 | 3300046475 | Bacteria | 2513 |
| 364 | Ga0495662_0000130 | 3300046476 | Bacteria | 28303 |
| 365 | Ga0495662_0002551 | 3300046476 | Bacteria | 9194 |
| 366 | Ga0495662_0061446 | 3300046476 | Bacteria | 1815 |
| 367 | Ga0495664_0312191 | 3300046477 | Unclassified | 949 |
| 368 | Ga0495584_0215143 | 3300046491 | Unclassified | 977 |
| 369 | Ga0495594_0000012 | 3300046499 | Bacteria | 105133 |
| 370 | Ga0495606_0000908 | 3300046507 | Bacteria | 43982 |
| 371 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 372 | Ga0495608_0000346 | 3300046511 | Bacteria | 32424 |
| 373 | Ga0495608_0010058 | 3300046511 | Bacteria | 6599 |
| 374 | Ga0495608_0052814 | 3300046511 | Bacteria | 2690 |
| 375 | Ga0495618_0000218 | 3300046514 | Bacteria | 41741 |
| 376 | Ga0495620_0000466 | 3300046515 | Bacteria | 26454 |
| 377 | Ga0495628_0001008 | 3300046516 | Bacteria | 25683 |
| 378 | Ga0495628_0014578 | 3300046516 | Bacteria | 6582 |
| 379 | Ga0495628_0051007 | 3300046516 | Bacteria | 3272 |
| 380 | Ga0495628_0126513 | 3300046516 | Bacteria | 1958 |
| 381 | Ga0495628_0137629 | 3300046516 | Bacteria | 1865 |
| 382 | Ga0495628_0233724 | 3300046516 | Bacteria | 1377 |
| 383 | Ga0495628_0264828 | 3300046516 | Unclassified | 1280 |
| 384 | Ga0495630_0001724 | 3300046517 | Bacteria | 15254 |
| 385 | Ga0495630_0003792 | 3300046517 | Bacteria | 10541 |
| 386 | Ga0495630_0028143 | 3300046517 | Bacteria | 4176 |
| 387 | Ga0495630_0172751 | 3300046517 | Bacteria | 1647 |
| 388 | Ga0495630_0360763 | 3300046517 | Bacteria | 1112 |
| 389 | Ga0495631_0104808 | 3300046518 | Bacteria | 1217 |
| 390 | Ga0495637_0062760 | 3300046520 | Bacteria | 1520 |
| 391 | Ga0495644_0001063 | 3300046523 | Bacteria | 11437 |
| 392 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 393 | Ga0495652_0040087 | 3300046529 | Bacteria | 4048 |
| 394 | Ga0495652_0551287 | 3300046529 | Unclassified | 793 |
| 395 | Ga0495665_0343336 | 3300046531 | Bacteria | 761 |
| 396 | Ga0495640_0020319 | 3300046533 | Bacteria | 4890 |
| 397 | Ga0495640_0569502 | 3300046533 | Bacteria | 686 |
| 398 | Ga0495586_0000359 | 3300046535 | Bacteria | 28382 |
| 399 | Ga0495586_0229640 | 3300046535 | Bacteria | 1056 |
| 400 | Ga0495587_0011918 | 3300046536 | Bacteria | 5495 |
| 401 | Ga0495587_0042253 | 3300046536 | Bacteria | 2719 |
| 402 | Ga0495587_0115195 | 3300046536 | Bacteria | 1542 |
| 403 | Ga0495621_0025134 | 3300046539 | Bacteria | 1998 |
| 404 | Ga0495645_0027561 | 3300046543 | Bacteria | 4128 |
| 405 | Ga0495645_0054850 | 3300046543 | Bacteria | 2894 |
| 406 | Ga0495622_0000076 | 3300046557 | Bacteria | 86777 |
| 407 | Ga0495633_0305168 | 3300046558 | Unclassified | 723 |
| 408 | Ga0495667_0000019 | 3300046559 | Bacteria | 181645 |
| 409 | Ga0495667_0128417 | 3300046559 | Bacteria | 1635 |
| 410 | Ga0495656_0000151 | 3300046615 | Bacteria | 25724 |
| 411 | Ga0495634_0001012 | 3300046642 | Bacteria | 26406 |
| 412 | Ga0495634_0022565 | 3300046642 | Bacteria | 4434 |
| 413 | Ga0495634_0033575 | 3300046642 | Bacteria | 3526 |
| 414 | Ga0495634_0073488 | 3300046642 | Bacteria | 2248 |
| 415 | Ga0495634_0220485 | 3300046642 | Bacteria | 1171 |
| 416 | Ga0495625_0000395 | 3300046660 | Bacteria | 66640 |
| 417 | Ga0495625_0535240 | 3300046660 | Unclassified | 711 |
| 418 | Ga0495635_0000017 | 3300046663 | Bacteria | 195506 |
| 419 | Ga0495635_0282436 | 3300046663 | Bacteria | 1115 |
| 420 | Ga0495635_0469335 | 3300046663 | Unclassified | 831 |
| 421 | Ga0495588_0000247 | 3300046674 | Bacteria | 45295 |
| 422 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 423 | Ga0495657_0055870 | 3300046675 | Bacteria | 2633 |
| 424 | Ga0495657_0064266 | 3300046675 | Bacteria | 2418 |
| 425 | Ga0495657_0223041 | 3300046675 | Bacteria | 1142 |
| 426 | Ga0495599_0031576 | 3300046678 | Bacteria | 3324 |
| 427 | Ga0495599_0249467 | 3300046678 | Unclassified | 1081 |
| 428 | Ga0495599_0670832 | 3300046678 | Bacteria | 599 |
| 429 | Ga0495599_0688971 | 3300046678 | Unclassified | 590 |
| 430 | Ga0495623_0125714 | 3300046679 | Bacteria | 1540 |
| 431 | Ga0495647_0000028 | 3300046681 | Bacteria | 56683 |
| 432 | Ga0495647_0002875 | 3300046681 | Bacteria | 5469 |
| 433 | Ga0495647_0029830 | 3300046681 | Unclassified | 2019 |
| 434 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 435 | Ga0495658_0015227 | 3300046683 | Bacteria | 3943 |
| 436 | Ga0495669_0000181 | 3300046684 | Bacteria | 39486 |
| 437 | Ga0495669_0009025 | 3300046684 | Bacteria | 4201 |
| 438 | Ga0495613_0000132 | 3300046689 | Bacteria | 74233 |
| 439 | Ga0495613_0000690 | 3300046689 | Bacteria | 26621 |
| 440 | Ga0495613_0040693 | 3300046689 | Bacteria | 3443 |
| 441 | Ga0495613_0082962 | 3300046689 | Bacteria | 2328 |
| 442 | Ga0495624_0000196 | 3300046690 | Bacteria | 46319 |
| 443 | Ga0495624_0002294 | 3300046690 | Bacteria | 14578 |
| 444 | Ga0495624_0064053 | 3300046690 | Bacteria | 2298 |
| 445 | Ga0495624_0190003 | 3300046690 | Bacteria | 1249 |
| 446 | Ga0495670_0010732 | 3300046691 | Unclassified | 4501 |
| 447 | Ga0495600_0000652 | 3300046809 | Bacteria | 18003 |
| 448 | Ga0495600_0047087 | 3300046809 | Bacteria | 2813 |
| 449 | Ga0495600_0100908 | 3300046809 | Bacteria | 1881 |
| 450 | Ga0495600_0426297 | 3300046809 | Unclassified | 823 |
| 451 | Ga0495581_0045133 | 3300047315 | Bacteria | 2548 |
| 452 | Ga0495604_0000104 | 3300047317 | Bacteria | 71390 |
| 453 | Ga0495604_0000527 | 3300047317 | Bacteria | 33774 |
| 454 | Ga0495674_0000024 | 3300047319 | Bacteria | 141746 |
| 455 | Ga0495674_0319263 | 3300047319 | Bacteria | 1266 |
| 456 | Ga0495672_0101297 | 3300047320 | Bacteria | 1561 |
| 457 | Ga0495676_0006298 | 3300047321 | Bacteria | 10919 |
| 458 | Ga0495676_0031967 | 3300047321 | Bacteria | 4446 |
| 459 | Ga0495676_0138708 | 3300047321 | Bacteria | 1745 |
| 460 | Ga0495680_0001363 | 3300047322 | Bacteria | 26520 |
| 461 | Ga0495680_0007564 | 3300047322 | Bacteria | 9935 |
| 462 | Ga0495680_0011541 | 3300047322 | Bacteria | 7816 |
| 463 | Ga0495680_0193046 | 3300047322 | Unclassified | 1464 |
| 464 | Ga0495680_0254627 | 3300047322 | Bacteria | 1243 |
| 465 | Ga0495680_0470572 | 3300047322 | Bacteria | 857 |
| 466 | Ga0495680_0527743 | 3300047322 | Bacteria | 798 |
| 467 | Ga0495675_0000094 | 3300047444 | Bacteria | 63338 |
| 468 | Ga0495679_012187 | 3300047446 | Bacteria | 3282 |
| 469 | Ga0495679_083779 | 3300047446 | Bacteria | 902 |
| 470 | Ga0495685_074866 | 3300047447 | Bacteria | 1131 |
| 471 | Ga0495684_0604571 | 3300047471 | Bacteria | 739 |
| 472 | Ga0495686_0022374 | 3300047472 | Bacteria | 4184 |
| 473 | Ga0495593_0048881 | 3300047673 | Unclassified | 2247 |
| 474 | Ga0495593_0139664 | 3300047673 | Bacteria | 1227 |
| 475 | Ga0495602_0001025 | 3300048088 | Bacteria | 27203 |
| 476 | Ga0495602_0667342 | 3300048088 | Bacteria | 708 |
| 477 | Ga0495614_0169057 | 3300048089 | Unclassified | 980 |
| 478 | Ga0496100_0000006 | 3300048903 | Bacteria | 297429 |
| 479 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 480 | Ga0496100_0956553 | 3300048903 | Bacteria | 673 |
| 481 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 482 | Ga0496101_0000009 | 3300048904 | Bacteria | 297429 |
| 483 | Ga0496102_0000438 | 3300048905 | Bacteria | 47526 |
| 484 | Ga0496102_0025372 | 3300048905 | Bacteria | 5277 |
| 485 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 486 | Ga0496103_0470968 | 3300048906 | Unclassified | 805 |
| 487 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 488 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 489 | Ga0496104_0015865 | 3300048907 | Bacteria | 6834 |
| 490 | Ga0496104_0059279 | 3300048907 | Bacteria | 3624 |
| 491 | Ga0496104_0077504 | 3300048907 | Bacteria | 3167 |
| 492 | Ga0496104_0798945 | 3300048907 | Bacteria | 850 |
| 493 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 494 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 495 | Ga0496105_0000386 | 3300048908 | Bacteria | 28919 |
| 496 | Ga0496105_0153180 | 3300048908 | Bacteria | 1894 |
| 497 | Ga0496106_0000064 | 3300048909 | Bacteria | 85019 |
| 498 | Ga0496106_0000137 | 3300048909 | Bacteria | 54395 |
| 499 | Ga0496106_0000156 | 3300048909 | Bacteria | 50301 |
| 500 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 501 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 502 | Ga0496107_1312216 | 3300048910 | Unclassified | 517 |
| 503 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 504 | Ga0496108_0000349 | 3300048911 | Bacteria | 39032 |
| 505 | Ga0496108_0007713 | 3300048911 | Bacteria | 8717 |
| 506 | Ga0496108_0009268 | 3300048911 | Bacteria | 7965 |
| 507 | Ga0496108_0047519 | 3300048911 | Bacteria | 3587 |
| 508 | Ga0496108_0499702 | 3300048911 | Unclassified | 1062 |
| 509 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 510 | Ga0496109_0000031 | 3300048912 | Bacteria | 163998 |
| 511 | Ga0496109_0000307 | 3300048912 | Bacteria | 46191 |
| 512 | Ga0496109_0006693 | 3300048912 | Bacteria | 9703 |
| 513 | Ga0496109_0276207 | 3300048912 | Bacteria | 1583 |
| 514 | Ga0496109_0319107 | 3300048912 | Bacteria | 1466 |
| 515 | Ga0496109_0827302 | 3300048912 | Unclassified | 864 |
| 516 | Ga0496109_2071452 | 3300048912 | Unclassified | 501 |
| 517 | Ga0496110_0000166 | 3300048913 | Bacteria | 40195 |
| 518 | Ga0496110_0028735 | 3300048913 | Bacteria | 4779 |
| 519 | Ga0496110_0035382 | 3300048913 | Bacteria | 4332 |
| 520 | Ga0496110_0105349 | 3300048913 | Bacteria | 2530 |
| 521 | Ga0496111_0000046 | 3300048914 | Bacteria | 48246 |
| 522 | Ga0496111_0457959 | 3300048914 | Unclassified | 941 |
| 523 | Ga0496111_0500529 | 3300048914 | Bacteria | 894 |
| 524 | Ga0496111_0706136 | 3300048914 | Bacteria | 733 |
| 525 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 526 | Ga0496112_0025758 | 3300048915 | Bacteria | 5649 |
| 527 | Ga0496112_0147714 | 3300048915 | Bacteria | 2319 |
| 528 | Ga0496112_1414648 | 3300048915 | Unclassified | 610 |
| 529 | Ga0496113_0000017 | 3300048916 | Bacteria | 74327 |
| 530 | Ga0496113_0013671 | 3300048916 | Bacteria | 5511 |
| 531 | Ga0496113_0064188 | 3300048916 | Bacteria | 2776 |
| 532 | Ga0496113_0312440 | 3300048916 | Unclassified | 1259 |
| 533 | Ga0496113_0521745 | 3300048916 | Unclassified | 953 |
| 534 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 535 | Ga0496114_0115091 | 3300048917 | Bacteria | 2307 |
| 536 | Ga0496114_0405934 | 3300048917 | Bacteria | 1206 |
| 537 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 538 | Ga0496115_0000027 | 3300048918 | Bacteria | 145505 |
| 539 | Ga0496119_0064063 | 3300048922 | Bacteria | 2184 |
| 540 | Ga0496120_0027513 | 3300048923 | Bacteria | 3496 |
| 541 | Ga0496125_0087147 | 3300048928 | Bacteria | 2359 |
| 542 | Ga0501036_0838948 | 3300049572 | Bacteria | 756 |
| 543 | Ga0501038_0893710 | 3300049574 | Bacteria | 656 |
| 544 | Ga0501039_0070081 | 3300049575 | Bacteria | 2724 |
| 545 | Ga0501040_0776095 | 3300049576 | Bacteria | 693 |
| 546 | Ga0501042_0034840 | 3300049578 | Bacteria | 3571 |
| 547 | Ga0501042_0140933 | 3300049578 | Bacteria | 1738 |
| 548 | Ga0501048_0744711 | 3300049582 | Bacteria | 704 |
| 549 | Ga0501068_0247227 | 3300049584 | Bacteria | 1136 |
| 550 | Ga0501071_1039736 | 3300049587 | Unclassified | 633 |
| 551 | Ga0501072_0297739 | 3300049588 | Bacteria | 1282 |
| 552 | Ga0501075_0206157 | 3300049591 | Bacteria | 1500 |
| 553 | Ga0501076_1024948 | 3300049592 | Bacteria | 680 |
| 554 | Ga0501079_0675985 | 3300049741 | Bacteria | 813 |
| 555 | Ga0501079_0929334 | 3300049741 | Bacteria | 685 |
| 556 | Ga0501081_0167588 | 3300049743 | Bacteria | 1585 |
| 557 | Ga0501081_0330962 | 3300049743 | Bacteria | 1121 |
| 558 | Ga0501272_045735 | 3300049769 | Archaea | 596 |
| 559 | nmdc:mga0n895_375319_c1 | 3300050512 | Bacteria | 1439 |
| 560 | nmdc:mga0a205_1461_c1 | 3300050515 | Bacteria | 20140 |
| 561 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 562 | Ga0495601_0000029 | 3300053077 | Bacteria | 111437 |
| 563 | Ga0495601_0000179 | 3300053077 | Bacteria | 33502 |
| 564 | Ga0495601_0006771 | 3300053077 | Bacteria | 6714 |
| 565 | Ga0495601_0041695 | 3300053077 | Bacteria | 2878 |
| 566 | Ga0495601_0042388 | 3300053077 | Bacteria | 2856 |
| 567 | Ga0495601_0227202 | 3300053077 | Bacteria | 1219 |
| 568 | Ga0495601_0516998 | 3300053077 | Bacteria | 769 |
| 569 | Ga0495601_1070113 | 3300053077 | Unclassified | 505 |
| 570 | Ga0495612_0000115 | 3300053078 | Bacteria | 33767 |
| 571 | Ga0495612_0002233 | 3300053078 | Bacteria | 7962 |
| 572 | Ga0495612_0008755 | 3300053078 | Bacteria | 4105 |
| 573 | Ga0495612_0020013 | 3300053078 | Bacteria | 2681 |
| 574 | Ga0495612_0090788 | 3300053078 | Unclassified | 1293 |
| 575 | Ga0495612_0351598 | 3300053078 | Unclassified | 665 |
| 576 | Ga0495612_0404223 | 3300053078 | Bacteria | 621 |
| 577 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 578 | Ga0495655_0106099 | 3300053083 | Bacteria | 838 |
| 579 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 580 | Ga0495595_0001355 | 3300053084 | Bacteria | 9514 |
| 581 | Ga0495595_0007157 | 3300053084 | Bacteria | 4559 |
| 582 | Ga0495595_0231618 | 3300053084 | Bacteria | 923 |
| 583 | Ga0495595_0585974 | 3300053084 | Bacteria | 570 |
| 584 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 585 | Ga0495619_0000233 | 3300053085 | Bacteria | 40638 |
| 586 | Ga0495619_0000413 | 3300053085 | Bacteria | 29033 |
| 587 | Ga0495619_0001241 | 3300053085 | Bacteria | 16706 |
| 588 | Ga0495619_0010884 | 3300053085 | Bacteria | 5724 |
| 589 | Ga0495619_0033178 | 3300053085 | Bacteria | 3352 |
| 590 | Ga0495619_0078447 | 3300053085 | Bacteria | 2220 |
| 591 | Ga0495619_0137018 | 3300053085 | Bacteria | 1684 |
| 592 | Ga0500566_0009429 | 3300053094 | Bacteria | 5768 |
| 593 | Ga0500641_0001760 | 3300053096 | Bacteria | 7670 |
| 594 | Ga0500650_0317058 | 3300053098 | Bacteria | 687 |
| 595 | Ga0500554_022360 | 3300053102 | Bacteria | 1766 |
| 596 | Ga0500614_002080 | 3300053123 | Bacteria | 4572 |
| 597 | Ga0500628_000039 | 3300053129 | Bacteria | 49907 |
| 598 | Ga0501084_0722328 | 3300054114 | Bacteria | 840 |
| 599 | Ga0501082_0579950 | 3300060353 | Archaea | 981 |
| 600 | Ga0501082_1917150 | 3300060353 | Unclassified | 517 |
| 601 | Ga0530510_0083074 | 3300061734 | Bacteria | 2333 |
| 602 | Ga0530510_0476894 | 3300061734 | Bacteria | 945 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046491 | Ga0495584_0215143 | Ga0495584_0215143_244_597 | 113 |
| 2 | 3300006852 | Ga0075433_10939506 | Ga0075433_109395062 | 121 |
| 3 | 3300009148 | Ga0105243_11699923 | Ga0105243_116999231 | 121 |
| 4 | 3300025927 | Ga0207687_11676517 | Ga0207687_116765171 | 121 |
| 5 | 3300050512 | nmdc:mga0n895_375319_c1 | nmdc:mga0n895_375319_c1_384_752 | 121 |
| 6 | 3300005331 | Ga0070670_100425650 | Ga0070670_1004256501 | 123 |
| 7 | 3300005337 | Ga0070682_100000061 | Ga0070682_10000006135 | 123 |
| 8 | 3300005338 | Ga0068868_100000104 | Ga0068868_10000010437 | 123 |
| 9 | 3300005341 | Ga0070691_10024493 | Ga0070691_100244934 | 123 |
| 10 | 3300005347 | Ga0070668_100006928 | Ga0070668_1000069282 | 123 |
| 11 | 3300005353 | Ga0070669_100507436 | Ga0070669_1005074362 | 123 |
| 12 | 3300005354 | Ga0070675_100000069 | Ga0070675_10000006953 | 123 |
| 13 | 3300005356 | Ga0070674_100000019 | Ga0070674_10000001982 | 123 |
| 14 | 3300005364 | Ga0070673_100006768 | Ga0070673_1000067682 | 123 |
| 15 | 3300005367 | Ga0070667_100002266 | Ga0070667_10000226611 | 123 |
| 16 | 3300005367 | Ga0070667_101546503 | Ga0070667_1015465031 | 123 |
| 17 | 3300005406 | Ga0070703_10169785 | Ga0070703_101697852 | 123 |
| 18 | 3300005435 | Ga0070714_100036362 | Ga0070714_1000363623 | 123 |
| 19 | 3300005438 | Ga0070701_10188915 | Ga0070701_101889151 | 123 |
| 20 | 3300005444 | Ga0070694_101460428 | Ga0070694_1014604281 | 123 |
| 21 | 3300005455 | Ga0070663_100635651 | Ga0070663_1006356512 | 123 |
| 22 | 3300005457 | Ga0070662_100000001 | Ga0070662_100000001191 | 123 |
| 23 | 3300005466 | Ga0070685_10000032 | Ga0070685_1000003232 | 123 |
| 24 | 3300005539 | Ga0068853_100615476 | Ga0068853_1006154762 | 123 |
| 25 | 3300005547 | Ga0070693_100000638 | Ga0070693_1000006387 | 123 |
| 26 | 3300005548 | Ga0070665_100216008 | Ga0070665_1002160083 | 123 |
| 27 | 3300005563 | Ga0068855_102542366 | Ga0068855_1025423661 | 123 |
| 28 | 3300005578 | Ga0068854_100000345 | Ga0068854_10000034520 | 123 |
| 29 | 3300005614 | Ga0068856_100003669 | Ga0068856_10000366912 | 123 |
| 30 | 3300005614 | Ga0068856_100026420 | Ga0068856_1000264202 | 123 |
| 31 | 3300005614 | Ga0068856_100193441 | Ga0068856_1001934412 | 123 |
| 32 | 3300005614 | Ga0068856_100829457 | Ga0068856_1008294572 | 123 |
| 33 | 3300005615 | Ga0070702_101253603 | Ga0070702_1012536031 | 123 |
| 34 | 3300005616 | Ga0068852_100000037 | Ga0068852_10000003791 | 123 |
| 35 | 3300005718 | Ga0068866_10000005 | Ga0068866_10000005111 | 123 |
| 36 | 3300005834 | Ga0068851_10005227 | Ga0068851_100052277 | 123 |
| 37 | 3300005842 | Ga0068858_100093347 | Ga0068858_1000933472 | 123 |
| 38 | 3300005843 | Ga0068860_100421948 | Ga0068860_1004219482 | 123 |
| 39 | 3300005844 | Ga0068862_100020486 | Ga0068862_1000204862 | 123 |
| 40 | 3300005937 | Ga0081455_10001231 | Ga0081455_100012312 | 123 |
| 41 | 3300006058 | Ga0075432_10332856 | Ga0075432_103328561 | 123 |
| 42 | 3300006163 | Ga0070715_10000008 | Ga0070715_10000008175 | 123 |
| 43 | 3300006237 | Ga0097621_100804729 | Ga0097621_1008047292 | 123 |
| 44 | 3300006881 | Ga0068865_100000081 | Ga0068865_10000008121 | 123 |
| 45 | 3300009098 | Ga0105245_10000249 | Ga0105245_100002492 | 123 |
| 46 | 3300009098 | Ga0105245_10019398 | Ga0105245_100193987 | 123 |
| 47 | 3300009101 | Ga0105247_10345466 | Ga0105247_103454661 | 123 |
| 48 | 3300009174 | Ga0105241_10124872 | Ga0105241_101248723 | 123 |
| 49 | 3300009177 | Ga0105248_10000017 | Ga0105248_10000017217 | 123 |
| 50 | 3300009551 | Ga0105238_10000016 | Ga0105238_10000016181 | 123 |
| 51 | 3300009553 | Ga0105249_10005341 | Ga0105249_100053418 | 123 |
| 52 | 3300010375 | Ga0105239_10217724 | Ga0105239_102177242 | 123 |
| 53 | 3300010375 | Ga0105239_12098155 | Ga0105239_120981552 | 123 |
| 54 | 3300013104 | Ga0157370_10228969 | Ga0157370_102289693 | 123 |
| 55 | 3300013105 | Ga0157369_10000105 | Ga0157369_1000010588 | 123 |
| 56 | 3300013296 | Ga0157374_10085714 | Ga0157374_100857141 | 123 |
| 57 | 3300013296 | Ga0157374_10715480 | Ga0157374_107154802 | 123 |
| 58 | 3300013306 | Ga0163162_10302474 | Ga0163162_103024742 | 123 |
| 59 | 3300013307 | Ga0157372_10000284 | Ga0157372_1000028429 | 123 |
| 60 | 3300014325 | Ga0163163_10365762 | Ga0163163_103657622 | 123 |
| 61 | 3300014968 | Ga0157379_10024043 | Ga0157379_100240436 | 123 |
| 62 | 3300014968 | Ga0157379_10195594 | Ga0157379_101955942 | 123 |
| 63 | 3300017792 | Ga0163161_10000240 | Ga0163161_1000024051 | 123 |
| 64 | 3300017792 | Ga0163161_10438438 | Ga0163161_104384381 | 123 |
| 65 | 3300025321 | Ga0207656_10002224 | Ga0207656_100022248 | 123 |
| 66 | 3300025885 | Ga0207653_10042538 | Ga0207653_100425382 | 123 |
| 67 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005316 | 123 |
| 68 | 3300025901 | Ga0207688_10415841 | Ga0207688_104158412 | 123 |
| 69 | 3300025905 | Ga0207685_10000012 | Ga0207685_10000012173 | 123 |
| 70 | 3300025911 | Ga0207654_10117527 | Ga0207654_101175272 | 123 |
| 71 | 3300025923 | Ga0207681_11262422 | Ga0207681_112624221 | 123 |
| 72 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012241 | 123 |
| 73 | 3300025925 | Ga0207650_10120890 | Ga0207650_101208901 | 123 |
| 74 | 3300025926 | Ga0207659_10001302 | Ga0207659_1000130211 | 123 |
| 75 | 3300025927 | Ga0207687_10000106 | Ga0207687_100001062 | 123 |
| 76 | 3300025927 | Ga0207687_10010977 | Ga0207687_100109772 | 123 |
| 77 | 3300025929 | Ga0207664_10676386 | Ga0207664_106763861 | 123 |
| 78 | 3300025933 | Ga0207706_10000003 | Ga0207706_10000003140 | 123 |
| 79 | 3300025937 | Ga0207669_10000047 | Ga0207669_1000004733 | 123 |
| 80 | 3300025938 | Ga0207704_10000018 | Ga0207704_1000001865 | 123 |
| 81 | 3300025938 | Ga0207704_10140066 | Ga0207704_101400661 | 123 |
| 82 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011264 | 123 |
| 83 | 3300025960 | Ga0207651_10004033 | Ga0207651_100040332 | 123 |
| 84 | 3300025961 | Ga0207712_10007217 | Ga0207712_100072172 | 123 |
| 85 | 3300025972 | Ga0207668_10080861 | Ga0207668_100808612 | 123 |
| 86 | 3300025981 | Ga0207640_10000077 | Ga0207640_1000007719 | 123 |
| 87 | 3300025986 | Ga0207658_10002876 | Ga0207658_100028762 | 123 |
| 88 | 3300026023 | Ga0207677_10000479 | Ga0207677_1000047917 | 123 |
| 89 | 3300026035 | Ga0207703_10067575 | Ga0207703_100675752 | 123 |
| 90 | 3300026041 | Ga0207639_10067249 | Ga0207639_100672493 | 123 |
| 91 | 3300026041 | Ga0207639_10633883 | Ga0207639_106338831 | 123 |
| 92 | 3300026067 | Ga0207678_11007096 | Ga0207678_110070961 | 123 |
| 93 | 3300026078 | Ga0207702_10000419 | Ga0207702_1000041934 | 123 |
| 94 | 3300026078 | Ga0207702_10003965 | Ga0207702_1000396512 | 123 |
| 95 | 3300026078 | Ga0207702_10603808 | Ga0207702_106038082 | 123 |
| 96 | 3300026078 | Ga0207702_10666544 | Ga0207702_106665442 | 123 |
| 97 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015213 | 123 |
| 98 | 3300028379 | Ga0268266_10210857 | Ga0268266_102108572 | 123 |
| 99 | 3300028380 | Ga0268265_10029147 | Ga0268265_100291472 | 123 |
| 100 | 3300028381 | Ga0268264_10293288 | Ga0268264_102932882 | 123 |
| 101 | 3300028381 | Ga0268264_12077223 | Ga0268264_120772231 | 123 |
| 102 | 3300035398 | Ga0316574_0672238 | Ga0316574_0672238_57_428 | 123 |
| 103 | 3300041505 | Ga0451849_1502250 | Ga0451849_1502250_47_418 | 123 |
| 104 | 3300045976 | Ga0466967_0000012 | Ga0466967_0000012_44491_44862 | 123 |
| 105 | 3300045976 | Ga0466967_2037144 | Ga0466967_2037144_149_520 | 123 |
| 106 | 3300046454 | Ga0495592_0001189 | Ga0495592_0001189_7171_7542 | 123 |
| 107 | 3300046459 | Ga0495629_0000421 | Ga0495629_0000421_33373_33744 | 123 |
| 108 | 3300046460 | Ga0495638_0034123 | Ga0495638_0034123_2673_3044 | 123 |
| 109 | 3300046461 | Ga0495641_0065757 | Ga0495641_0065757_65_436 | 123 |
| 110 | 3300046462 | Ga0495651_0165995 | Ga0495651_0165995_564_935 | 123 |
| 111 | 3300046463 | Ga0495653_0013286 | Ga0495653_0013286_5494_5865 | 123 |
| 112 | 3300046463 | Ga0495653_0188759 | Ga0495653_0188759_1003_1374 | 123 |
| 113 | 3300046473 | Ga0495582_0000002 | Ga0495582_0000002_138733_139104 | 123 |
| 114 | 3300046507 | Ga0495606_0000908 | Ga0495606_0000908_31959_32330 | 123 |
| 115 | 3300046511 | Ga0495608_0000346 | Ga0495608_0000346_7217_7588 | 123 |
| 116 | 3300046511 | Ga0495608_0010058 | Ga0495608_0010058_3275_3646 | 123 |
| 117 | 3300046515 | Ga0495620_0000466 | Ga0495620_0000466_15733_16104 | 123 |
| 118 | 3300046516 | Ga0495628_0264828 | Ga0495628_0264828_53_424 | 123 |
| 119 | 3300046523 | Ga0495644_0001063 | Ga0495644_0001063_9456_9827 | 123 |
| 120 | 3300046533 | Ga0495640_0020319 | Ga0495640_0020319_922_1293 | 123 |
| 121 | 3300046642 | Ga0495634_0220485 | Ga0495634_0220485_462_833 | 123 |
| 122 | 3300046660 | Ga0495625_0535240 | Ga0495625_0535240_39_410 | 123 |
| 123 | 3300046674 | Ga0495588_0000247 | Ga0495588_0000247_25064_25435 | 123 |
| 124 | 3300046678 | Ga0495599_0249467 | Ga0495599_0249467_396_767 | 123 |
| 125 | 3300046681 | Ga0495647_0000028 | Ga0495647_0000028_7265_7636 | 123 |
| 126 | 3300046681 | Ga0495647_0002875 | Ga0495647_0002875_4561_4932 | 123 |
| 127 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_253164_253535 | 123 |
| 128 | 3300046683 | Ga0495658_0015227 | Ga0495658_0015227_3493_3864 | 123 |
| 129 | 3300046689 | Ga0495613_0000132 | Ga0495613_0000132_34749_35120 | 123 |
| 130 | 3300046689 | Ga0495613_0000690 | Ga0495613_0000690_18913_19284 | 123 |
| 131 | 3300046690 | Ga0495624_0000196 | Ga0495624_0000196_24844_25215 | 123 |
| 132 | 3300046809 | Ga0495600_0000652 | Ga0495600_0000652_627_998 | 123 |
| 133 | 3300047321 | Ga0495676_0006298 | Ga0495676_0006298_3421_3792 | 123 |
| 134 | 3300047321 | Ga0495676_0138708 | Ga0495676_0138708_343_714 | 123 |
| 135 | 3300047471 | Ga0495684_0604571 | Ga0495684_0604571_211_582 | 123 |
| 136 | 3300047673 | Ga0495593_0139664 | Ga0495593_0139664_280_651 | 123 |
| 137 | 3300048088 | Ga0495602_0667342 | Ga0495602_0667342_302_673 | 123 |
| 138 | 3300048089 | Ga0495614_0169057 | Ga0495614_0169057_307_678 | 123 |
| 139 | 3300048903 | Ga0496100_0956553 | Ga0496100_0956553_265_636 | 123 |
| 140 | 3300048911 | Ga0496108_0000349 | Ga0496108_0000349_10665_11036 | 123 |
| 141 | 3300048911 | Ga0496108_0007713 | Ga0496108_0007713_524_895 | 123 |
| 142 | 3300048912 | Ga0496109_0000307 | Ga0496109_0000307_10656_11027 | 123 |
| 143 | 3300048912 | Ga0496109_2071452 | Ga0496109_2071452_98_469 | 123 |
| 144 | 3300048913 | Ga0496110_0000166 | Ga0496110_0000166_5383_5754 | 123 |
| 145 | 3300048914 | Ga0496111_0000046 | Ga0496111_0000046_46199_46570 | 123 |
| 146 | 3300048915 | Ga0496112_0025758 | Ga0496112_0025758_2506_2877 | 123 |
| 147 | 3300048916 | Ga0496113_0000017 | Ga0496113_0000017_10361_10732 | 123 |
| 148 | 3300048916 | Ga0496113_0064188 | Ga0496113_0064188_32_403 | 123 |
| 149 | 3300049578 | Ga0501042_0140933 | Ga0501042_0140933_230_601 | 123 |
| 150 | 3300053077 | Ga0495601_1070113 | Ga0495601_1070113_58_429 | 123 |
| 151 | 3300053078 | Ga0495612_0404223 | Ga0495612_0404223_236_607 | 123 |
| 152 | 3300053084 | Ga0495595_0585974 | Ga0495595_0585974_79_450 | 123 |
| 153 | 3300053085 | Ga0495619_0010884 | Ga0495619_0010884_502_873 | 123 |
| 154 | 3300053098 | Ga0500650_0317058 | Ga0500650_0317058_58_429 | 123 |
| 155 | 3300001977 | JGI24746J21847_1000566 | JGI24746J21847_10005662 | 124 |
| 156 | 3300001979 | JGI24740J21852_10002767 | JGI24740J21852_100027673 | 124 |
| 157 | 3300001991 | JGI24743J22301_10134867 | JGI24743J22301_101348671 | 124 |
| 158 | 3300002074 | JGI24748J21848_1000241 | JGI24748J21848_10002412 | 124 |
| 159 | 3300002239 | JGI24034J26672_10000120 | JGI24034J26672_100001205 | 124 |
| 160 | 3300002244 | JGI24742J22300_10010826 | JGI24742J22300_100108261 | 124 |
| 161 | 3300005329 | Ga0070683_100007274 | Ga0070683_1000072747 | 124 |
| 162 | 3300005329 | Ga0070683_100010609 | Ga0070683_1000106092 | 124 |
| 163 | 3300005329 | Ga0070683_100015665 | Ga0070683_1000156652 | 124 |
| 164 | 3300005329 | Ga0070683_100112957 | Ga0070683_1001129573 | 124 |
| 165 | 3300005329 | Ga0070683_100126241 | Ga0070683_1001262414 | 124 |
| 166 | 3300005329 | Ga0070683_100134601 | Ga0070683_1001346013 | 124 |
| 167 | 3300005333 | Ga0070677_10000085 | Ga0070677_1000008522 | 124 |
| 168 | 3300005336 | Ga0070680_100215276 | Ga0070680_1002152762 | 124 |
| 169 | 3300005337 | Ga0070682_100000009 | Ga0070682_10000000948 | 124 |
| 170 | 3300005337 | Ga0070682_100435064 | Ga0070682_1004350642 | 124 |
| 171 | 3300005338 | Ga0068868_100000220 | Ga0068868_10000022010 | 124 |
| 172 | 3300005340 | Ga0070689_100071524 | Ga0070689_1000715242 | 124 |
| 173 | 3300005340 | Ga0070689_100105239 | Ga0070689_1001052392 | 124 |
| 174 | 3300005341 | Ga0070691_10000275 | Ga0070691_100002752 | 124 |
| 175 | 3300005341 | Ga0070691_10001199 | Ga0070691_100011999 | 124 |
| 176 | 3300005347 | Ga0070668_100351240 | Ga0070668_1003512402 | 124 |
| 177 | 3300005355 | Ga0070671_100237787 | Ga0070671_1002377872 | 124 |
| 178 | 3300005356 | Ga0070674_100000030 | Ga0070674_10000003041 | 124 |
| 179 | 3300005365 | Ga0070688_100000053 | Ga0070688_10000005335 | 124 |
| 180 | 3300005365 | Ga0070688_100122084 | Ga0070688_1001220842 | 124 |
| 181 | 3300005365 | Ga0070688_100908241 | Ga0070688_1009082412 | 124 |
| 182 | 3300005366 | Ga0070659_100015340 | Ga0070659_1000153406 | 124 |
| 183 | 3300005366 | Ga0070659_100155757 | Ga0070659_1001557572 | 124 |
| 184 | 3300005366 | Ga0070659_101140284 | Ga0070659_1011402841 | 124 |
| 185 | 3300005435 | Ga0070714_100037035 | Ga0070714_1000370352 | 124 |
| 186 | 3300005436 | Ga0070713_100000023 | Ga0070713_10000002370 | 124 |
| 187 | 3300005437 | Ga0070710_10409277 | Ga0070710_104092772 | 124 |
| 188 | 3300005438 | Ga0070701_10719961 | Ga0070701_107199612 | 124 |
| 189 | 3300005439 | Ga0070711_100004129 | Ga0070711_1000041295 | 124 |
| 190 | 3300005439 | Ga0070711_100628171 | Ga0070711_1006281711 | 124 |
| 191 | 3300005441 | Ga0070700_100167973 | Ga0070700_1001679732 | 124 |
| 192 | 3300005455 | Ga0070663_100626614 | Ga0070663_1006266142 | 124 |
| 193 | 3300005458 | Ga0070681_10042499 | Ga0070681_100424992 | 124 |
| 194 | 3300005466 | Ga0070685_10000086 | Ga0070685_1000008625 | 124 |
| 195 | 3300005466 | Ga0070685_10132387 | Ga0070685_101323872 | 124 |
| 196 | 3300005466 | Ga0070685_10407577 | Ga0070685_104075772 | 124 |
| 197 | 3300005530 | Ga0070679_100000258 | Ga0070679_10000025824 | 124 |
| 198 | 3300005535 | Ga0070684_100008110 | Ga0070684_1000081104 | 124 |
| 199 | 3300005535 | Ga0070684_100044980 | Ga0070684_1000449802 | 124 |
| 200 | 3300005535 | Ga0070684_100080941 | Ga0070684_1000809412 | 124 |
| 201 | 3300005535 | Ga0070684_101549075 | Ga0070684_1015490751 | 124 |
| 202 | 3300005539 | Ga0068853_100021670 | Ga0068853_1000216702 | 124 |
| 203 | 3300005543 | Ga0070672_100000005 | Ga0070672_10000000540 | 124 |
| 204 | 3300005544 | Ga0070686_101896915 | Ga0070686_1018969151 | 124 |
| 205 | 3300005545 | Ga0070695_101231057 | Ga0070695_1012310571 | 124 |
| 206 | 3300005548 | Ga0070665_100000022 | Ga0070665_100000022134 | 124 |
| 207 | 3300005548 | Ga0070665_100017640 | Ga0070665_1000176408 | 124 |
| 208 | 3300005548 | Ga0070665_100094251 | Ga0070665_1000942514 | 124 |
| 209 | 3300005549 | Ga0070704_100331076 | Ga0070704_1003310762 | 124 |
| 210 | 3300005564 | Ga0070664_100014728 | Ga0070664_1000147282 | 124 |
| 211 | 3300005564 | Ga0070664_100835820 | Ga0070664_1008358202 | 124 |
| 212 | 3300005578 | Ga0068854_100029725 | Ga0068854_1000297252 | 124 |
| 213 | 3300005614 | Ga0068856_100195633 | Ga0068856_1001956332 | 124 |
| 214 | 3300005614 | Ga0068856_101994131 | Ga0068856_1019941311 | 124 |
| 215 | 3300005615 | Ga0070702_100198963 | Ga0070702_1001989632 | 124 |
| 216 | 3300005615 | Ga0070702_101005917 | Ga0070702_1010059172 | 124 |
| 217 | 3300005616 | Ga0068852_100008636 | Ga0068852_1000086362 | 124 |
| 218 | 3300005618 | Ga0068864_100000043 | Ga0068864_10000004368 | 124 |
| 219 | 3300005718 | Ga0068866_10000382 | Ga0068866_1000038220 | 124 |
| 220 | 3300005718 | Ga0068866_10521183 | Ga0068866_105211832 | 124 |
| 221 | 3300005718 | Ga0068866_10534891 | Ga0068866_105348912 | 124 |
| 222 | 3300005834 | Ga0068851_10020425 | Ga0068851_100204252 | 124 |
| 223 | 3300005840 | Ga0068870_10397359 | Ga0068870_103973592 | 124 |
| 224 | 3300005841 | Ga0068863_100000229 | Ga0068863_1000002292 | 124 |
| 225 | 3300005841 | Ga0068863_100002888 | Ga0068863_1000028882 | 124 |
| 226 | 3300005841 | Ga0068863_100268768 | Ga0068863_1002687683 | 124 |
| 227 | 3300005842 | Ga0068858_100000017 | Ga0068858_100000017131 | 124 |
| 228 | 3300005842 | Ga0068858_100000140 | Ga0068858_1000001402 | 124 |
| 229 | 3300005842 | Ga0068858_100045457 | Ga0068858_1000454572 | 124 |
| 230 | 3300005843 | Ga0068860_100001002 | Ga0068860_1000010029 | 124 |
| 231 | 3300005843 | Ga0068860_100154024 | Ga0068860_1001540241 | 124 |
| 232 | 3300005937 | Ga0081455_10374976 | Ga0081455_103749762 | 124 |
| 233 | 3300005983 | Ga0081540_1000046 | Ga0081540_100004633 | 124 |
| 234 | 3300005983 | Ga0081540_1216159 | Ga0081540_12161591 | 124 |
| 235 | 3300005985 | Ga0081539_10001074 | Ga0081539_1000107424 | 124 |
| 236 | 3300006237 | Ga0097621_100958826 | Ga0097621_1009588262 | 124 |
| 237 | 3300006358 | Ga0068871_100085751 | Ga0068871_1000857515 | 124 |
| 238 | 3300006852 | Ga0075433_10007173 | Ga0075433_100071737 | 124 |
| 239 | 3300009098 | Ga0105245_10000330 | Ga0105245_100003302 | 124 |
| 240 | 3300009098 | Ga0105245_10019372 | Ga0105245_100193726 | 124 |
| 241 | 3300009098 | Ga0105245_11347658 | Ga0105245_113476582 | 124 |
| 242 | 3300009101 | Ga0105247_10002606 | Ga0105247_1000260611 | 124 |
| 243 | 3300009101 | Ga0105247_10828813 | Ga0105247_108288131 | 124 |
| 244 | 3300009148 | Ga0105243_10006390 | Ga0105243_100063903 | 124 |
| 245 | 3300009174 | Ga0105241_10216916 | Ga0105241_102169163 | 124 |
| 246 | 3300009176 | Ga0105242_10000052 | Ga0105242_100000527 | 124 |
| 247 | 3300009176 | Ga0105242_10035964 | Ga0105242_100359644 | 124 |
| 248 | 3300009176 | Ga0105242_10049788 | Ga0105242_100497882 | 124 |
| 249 | 3300009176 | Ga0105242_10249527 | Ga0105242_102495272 | 124 |
| 250 | 3300009553 | Ga0105249_10000054 | Ga0105249_100000542 | 124 |
| 251 | 3300010375 | Ga0105239_10332280 | Ga0105239_103322802 | 124 |
| 252 | 3300011119 | Ga0105246_10269439 | Ga0105246_102694392 | 124 |
| 253 | 3300011119 | Ga0105246_10475227 | Ga0105246_104752272 | 124 |
| 254 | 3300013104 | Ga0157370_10046483 | Ga0157370_100464832 | 124 |
| 255 | 3300013296 | Ga0157374_10000242 | Ga0157374_1000024252 | 124 |
| 256 | 3300013297 | Ga0157378_10046947 | Ga0157378_100469472 | 124 |
| 257 | 3300013297 | Ga0157378_10052908 | Ga0157378_100529085 | 124 |
| 258 | 3300013297 | Ga0157378_10064214 | Ga0157378_100642142 | 124 |
| 259 | 3300013308 | Ga0157375_10000620 | Ga0157375_100006202 | 124 |
| 260 | 3300013308 | Ga0157375_12661401 | Ga0157375_126614011 | 124 |
| 261 | 3300014325 | Ga0163163_10059017 | Ga0163163_100590173 | 124 |
| 262 | 3300014326 | Ga0157380_10000178 | Ga0157380_1000017836 | 124 |
| 263 | 3300014326 | Ga0157380_10000838 | Ga0157380_1000083819 | 124 |
| 264 | 3300014326 | Ga0157380_10102618 | Ga0157380_101026182 | 124 |
| 265 | 3300014326 | Ga0157380_10959792 | Ga0157380_109597922 | 124 |
| 266 | 3300014745 | Ga0157377_10610981 | Ga0157377_106109811 | 124 |
| 267 | 3300014745 | Ga0157377_10632059 | Ga0157377_106320591 | 124 |
| 268 | 3300014968 | Ga0157379_10039602 | Ga0157379_100396022 | 124 |
| 269 | 3300014969 | Ga0157376_10111428 | Ga0157376_101114283 | 124 |
| 270 | 3300014969 | Ga0157376_11151965 | Ga0157376_111519652 | 124 |
| 271 | 3300017792 | Ga0163161_10243456 | Ga0163161_102434562 | 124 |
| 272 | 3300020070 | Ga0206356_10206281 | Ga0206356_102062813 | 124 |
| 273 | 3300025321 | Ga0207656_10008896 | Ga0207656_100088962 | 124 |
| 274 | 3300025893 | Ga0207682_10000060 | Ga0207682_1000006037 | 124 |
| 275 | 3300025898 | Ga0207692_10563027 | Ga0207692_105630272 | 124 |
| 276 | 3300025899 | Ga0207642_10000500 | Ga0207642_100005002 | 124 |
| 277 | 3300025899 | Ga0207642_10510342 | Ga0207642_105103422 | 124 |
| 278 | 3300025900 | Ga0207710_10000096 | Ga0207710_1000009671 | 124 |
| 279 | 3300025900 | Ga0207710_10402869 | Ga0207710_104028691 | 124 |
| 280 | 3300025911 | Ga0207654_10165808 | Ga0207654_101658083 | 124 |
| 281 | 3300025912 | Ga0207707_10022249 | Ga0207707_100222493 | 124 |
| 282 | 3300025915 | Ga0207693_10358157 | Ga0207693_103581572 | 124 |
| 283 | 3300025916 | Ga0207663_10002802 | Ga0207663_100028022 | 124 |
| 284 | 3300025916 | Ga0207663_10030099 | Ga0207663_100300994 | 124 |
| 285 | 3300025917 | Ga0207660_10214982 | Ga0207660_102149822 | 124 |
| 286 | 3300025920 | Ga0207649_10000015 | Ga0207649_10000015183 | 124 |
| 287 | 3300025921 | Ga0207652_10000196 | Ga0207652_1000019622 | 124 |
| 288 | 3300025927 | Ga0207687_10000094 | Ga0207687_1000009459 | 124 |
| 289 | 3300025927 | Ga0207687_10011714 | Ga0207687_100117142 | 124 |
| 290 | 3300025927 | Ga0207687_10885573 | Ga0207687_108855732 | 124 |
| 291 | 3300025928 | Ga0207700_10000003 | Ga0207700_1000000370 | 124 |
| 292 | 3300025929 | Ga0207664_10030260 | Ga0207664_100302605 | 124 |
| 293 | 3300025931 | Ga0207644_10287996 | Ga0207644_102879962 | 124 |
| 294 | 3300025932 | Ga0207690_10010639 | Ga0207690_100106391 | 124 |
| 295 | 3300025932 | Ga0207690_10104900 | Ga0207690_101049003 | 124 |
| 296 | 3300025934 | Ga0207686_10000035 | Ga0207686_10000035123 | 124 |
| 297 | 3300025934 | Ga0207686_10003508 | Ga0207686_100035087 | 124 |
| 298 | 3300025934 | Ga0207686_10285331 | Ga0207686_102853312 | 124 |
| 299 | 3300025934 | Ga0207686_10549287 | Ga0207686_105492872 | 124 |
| 300 | 3300025935 | Ga0207709_10019786 | Ga0207709_100197862 | 124 |
| 301 | 3300025936 | Ga0207670_10023085 | Ga0207670_100230852 | 124 |
| 302 | 3300025936 | Ga0207670_10088689 | Ga0207670_100886893 | 124 |
| 303 | 3300025937 | Ga0207669_10000029 | Ga0207669_100000297 | 124 |
| 304 | 3300025940 | Ga0207691_10000028 | Ga0207691_1000002890 | 124 |
| 305 | 3300025944 | Ga0207661_10005996 | Ga0207661_100059967 | 124 |
| 306 | 3300025944 | Ga0207661_10013598 | Ga0207661_100135982 | 124 |
| 307 | 3300025944 | Ga0207661_10099391 | Ga0207661_100993911 | 124 |
| 308 | 3300025944 | Ga0207661_10101096 | Ga0207661_101010963 | 124 |
| 309 | 3300025944 | Ga0207661_10177052 | Ga0207661_101770522 | 124 |
| 310 | 3300025945 | Ga0207679_10013592 | Ga0207679_100135924 | 124 |
| 311 | 3300025945 | Ga0207679_10700427 | Ga0207679_107004272 | 124 |
| 312 | 3300025949 | Ga0207667_10771052 | Ga0207667_107710522 | 124 |
| 313 | 3300025961 | Ga0207712_10000032 | Ga0207712_10000032162 | 124 |
| 314 | 3300025972 | Ga0207668_10666277 | Ga0207668_106662771 | 124 |
| 315 | 3300025981 | Ga0207640_10010886 | Ga0207640_100108867 | 124 |
| 316 | 3300025986 | Ga0207658_10570280 | Ga0207658_105702802 | 124 |
| 317 | 3300026023 | Ga0207677_10001833 | Ga0207677_100018332 | 124 |
| 318 | 3300026035 | Ga0207703_10000020 | Ga0207703_10000020187 | 124 |
| 319 | 3300026035 | Ga0207703_10000030 | Ga0207703_10000030129 | 124 |
| 320 | 3300026035 | Ga0207703_10039734 | Ga0207703_100397342 | 124 |
| 321 | 3300026041 | Ga0207639_10987106 | Ga0207639_109871062 | 124 |
| 322 | 3300026067 | Ga0207678_11676297 | Ga0207678_116762972 | 124 |
| 323 | 3300026075 | Ga0207708_10189714 | Ga0207708_101897142 | 124 |
| 324 | 3300026075 | Ga0207708_10933949 | Ga0207708_109339492 | 124 |
| 325 | 3300026078 | Ga0207702_10031122 | Ga0207702_100311222 | 124 |
| 326 | 3300026088 | Ga0207641_10001796 | Ga0207641_1000179619 | 124 |
| 327 | 3300026088 | Ga0207641_10002314 | Ga0207641_100023147 | 124 |
| 328 | 3300026088 | Ga0207641_10034705 | Ga0207641_100347055 | 124 |
| 329 | 3300026089 | Ga0207648_10001072 | Ga0207648_1000107212 | 124 |
| 330 | 3300026095 | Ga0207676_10000042 | Ga0207676_1000004299 | 124 |
| 331 | 3300026118 | Ga0207675_100061701 | Ga0207675_1000617012 | 124 |
| 332 | 3300026121 | Ga0207683_10013197 | Ga0207683_100131973 | 124 |
| 333 | 3300026121 | Ga0207683_10356576 | Ga0207683_103565761 | 124 |
| 334 | 3300026142 | Ga0207698_10008081 | Ga0207698_100080812 | 124 |
| 335 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029317 | 124 |
| 336 | 3300028379 | Ga0268266_10001186 | Ga0268266_100011868 | 124 |
| 337 | 3300028379 | Ga0268266_10038746 | Ga0268266_100387462 | 124 |
| 338 | 3300028379 | Ga0268266_10986753 | Ga0268266_109867531 | 124 |
| 339 | 3300028381 | Ga0268264_10003675 | Ga0268264_100036758 | 124 |
| 340 | 3300028381 | Ga0268264_10072728 | Ga0268264_100727284 | 124 |
| 341 | 3300028556 | Ga0265337_1000101 | Ga0265337_100010117 | 124 |
| 342 | 3300028558 | Ga0265326_10000033 | Ga0265326_1000003390 | 124 |
| 343 | 3300028563 | Ga0265319_1000010 | Ga0265319_1000010164 | 124 |
| 344 | 3300028573 | Ga0265334_10098676 | Ga0265334_100986762 | 124 |
| 345 | 3300028653 | Ga0265323_10263201 | Ga0265323_102632011 | 124 |
| 346 | 3300028654 | Ga0265322_10000005 | Ga0265322_1000000544 | 124 |
| 347 | 3300028800 | Ga0265338_10000051 | Ga0265338_1000005157 | 124 |
| 348 | 3300028800 | Ga0265338_11001490 | Ga0265338_110014901 | 124 |
| 349 | 3300029957 | Ga0265324_10000207 | Ga0265324_1000020728 | 124 |
| 350 | 3300029957 | Ga0265324_10075613 | Ga0265324_100756132 | 124 |
| 351 | 3300031238 | Ga0265332_10034937 | Ga0265332_100349372 | 124 |
| 352 | 3300031239 | Ga0265328_10001194 | Ga0265328_1000119412 | 124 |
| 353 | 3300031240 | Ga0265320_10000010 | Ga0265320_1000001090 | 124 |
| 354 | 3300031241 | Ga0265325_10005471 | Ga0265325_100054715 | 124 |
| 355 | 3300031242 | Ga0265329_10008633 | Ga0265329_100086332 | 124 |
| 356 | 3300031249 | Ga0265339_10016352 | Ga0265339_100163527 | 124 |
| 357 | 3300031250 | Ga0265331_10000869 | Ga0265331_1000086923 | 124 |
| 358 | 3300031250 | Ga0265331_10188553 | Ga0265331_101885532 | 124 |
| 359 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040217 | 124 |
| 360 | 3300031344 | Ga0265316_10068127 | Ga0265316_100681274 | 124 |
| 361 | 3300031711 | Ga0265314_10000208 | Ga0265314_1000020824 | 124 |
| 362 | 3300031712 | Ga0265342_10378692 | Ga0265342_103786922 | 124 |
| 363 | 3300031712 | Ga0265342_10628040 | Ga0265342_106280402 | 124 |
| 364 | 3300032126 | Ga0307415_100020148 | Ga0307415_1000201482 | 124 |
| 365 | 3300035117 | Ga0373953_0182304 | Ga0373953_0182304_466_840 | 124 |
| 366 | 3300035118 | Ga0373954_0157931 | Ga0373954_0157931_631_1005 | 124 |
| 367 | 3300035119 | Ga0373956_0327061 | Ga0373956_0327061_129_518 | 124 |
| 368 | 3300035170 | Ga0373943_0791806 | Ga0373943_0791806_37_426 | 124 |
| 369 | 3300035172 | Ga0373955_0129684 | Ga0373955_0129684_912_1286 | 124 |
| 370 | 3300035692 | Ga0373935_0848864 | Ga0373935_0848864_112_486 | 124 |
| 371 | 3300036401 | Ga0373937_0015203 | Ga0373937_0015203_6247_6621 | 124 |
| 372 | 3300036401 | Ga0373937_0463516 | Ga0373937_0463516_699_1073 | 124 |
| 373 | 3300036401 | Ga0373937_0595463 | Ga0373937_0595463_661_1035 | 124 |
| 374 | 3300036401 | Ga0373937_0759043 | Ga0373937_0759043_107_487 | 124 |
| 375 | 3300036401 | Ga0373937_1195500 | Ga0373937_1195500_114_488 | 124 |
| 376 | 3300037466 | Ga0395898_1290253 | Ga0395898_1290253_82_507 | 124 |
| 377 | 3300041451 | Ga0451791_0052506 | Ga0451791_0052506_728_1102 | 124 |
| 378 | 3300041459 | Ga0451800_0357192 | Ga0451800_0357192_117_491 | 124 |
| 379 | 3300041459 | Ga0451800_0629083 | Ga0451800_0629083_51_425 | 124 |
| 380 | 3300041463 | Ga0451804_0369380 | Ga0451804_0369380_163_537 | 124 |
| 381 | 3300041486 | Ga0451807_0497514 | Ga0451807_0497514_1193_1567 | 124 |
| 382 | 3300041486 | Ga0451807_1858638 | Ga0451807_1858638_428_802 | 124 |
| 383 | 3300041492 | Ga0451835_0782939 | Ga0451835_0782939_171_545 | 124 |
| 384 | 3300041501 | Ga0451845_0189617 | Ga0451845_0189617_21_395 | 124 |
| 385 | 3300041505 | Ga0451849_0745045 | Ga0451849_0745045_207_581 | 124 |
| 386 | 3300041512 | Ga0451853_1500978 | Ga0451853_1500978_905_1279 | 124 |
| 387 | 3300041512 | Ga0451853_1723538 | Ga0451853_1723538_2275_2649 | 124 |
| 388 | 3300041512 | Ga0451853_3840077 | Ga0451853_3840077_755_1129 | 124 |
| 389 | 3300044694 | Ga0466963_0000012 | Ga0466963_0000012_9251_9625 | 124 |
| 390 | 3300044694 | Ga0466963_0044188 | Ga0466963_0044188_904_1278 | 124 |
| 391 | 3300044901 | Ga0466960_0163099 | Ga0466960_0163099_579_953 | 124 |
| 392 | 3300044901 | Ga0466960_0208636 | Ga0466960_0208636_664_1038 | 124 |
| 393 | 3300045976 | Ga0466967_0027403 | Ga0466967_0027403_3113_3487 | 124 |
| 394 | 3300046454 | Ga0495592_0374756 | Ga0495592_0374756_395_769 | 124 |
| 395 | 3300046454 | Ga0495592_0696854 | Ga0495592_0696854_24_398 | 124 |
| 396 | 3300046455 | Ga0495603_0000861 | Ga0495603_0000861_9512_9886 | 124 |
| 397 | 3300046455 | Ga0495603_0007243 | Ga0495603_0007243_5370_5744 | 124 |
| 398 | 3300046459 | Ga0495629_0018857 | Ga0495629_0018857_1628_2002 | 124 |
| 399 | 3300046459 | Ga0495629_0033550 | Ga0495629_0033550_2355_2744 | 124 |
| 400 | 3300046459 | Ga0495629_0519749 | Ga0495629_0519749_107_481 | 124 |
| 401 | 3300046461 | Ga0495641_0000440 | Ga0495641_0000440_530_904 | 124 |
| 402 | 3300046461 | Ga0495641_0207533 | Ga0495641_0207533_107_481 | 124 |
| 403 | 3300046463 | Ga0495653_0093416 | Ga0495653_0093416_1474_1848 | 124 |
| 404 | 3300046463 | Ga0495653_0165543 | Ga0495653_0165543_33_407 | 124 |
| 405 | 3300046463 | Ga0495653_0259344 | Ga0495653_0259344_656_1030 | 124 |
| 406 | 3300046475 | Ga0495639_0027611 | Ga0495639_0027611_1779_2153 | 124 |
| 407 | 3300046476 | Ga0495662_0000130 | Ga0495662_0000130_7199_7573 | 124 |
| 408 | 3300046476 | Ga0495662_0002551 | Ga0495662_0002551_4790_5164 | 124 |
| 409 | 3300046476 | Ga0495662_0061446 | Ga0495662_0061446_1170_1544 | 124 |
| 410 | 3300046477 | Ga0495664_0312191 | Ga0495664_0312191_145_519 | 124 |
| 411 | 3300046499 | Ga0495594_0000012 | Ga0495594_0000012_9800_10174 | 124 |
| 412 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_214189_214563 | 124 |
| 413 | 3300046511 | Ga0495608_0052814 | Ga0495608_0052814_1672_2046 | 124 |
| 414 | 3300046514 | Ga0495618_0000218 | Ga0495618_0000218_16153_16527 | 124 |
| 415 | 3300046516 | Ga0495628_0001008 | Ga0495628_0001008_3372_3746 | 124 |
| 416 | 3300046516 | Ga0495628_0014578 | Ga0495628_0014578_2382_2756 | 124 |
| 417 | 3300046516 | Ga0495628_0051007 | Ga0495628_0051007_2558_2932 | 124 |
| 418 | 3300046516 | Ga0495628_0126513 | Ga0495628_0126513_1160_1552 | 124 |
| 419 | 3300046516 | Ga0495628_0137629 | Ga0495628_0137629_734_1108 | 124 |
| 420 | 3300046516 | Ga0495628_0233724 | Ga0495628_0233724_38_427 | 124 |
| 421 | 3300046517 | Ga0495630_0001724 | Ga0495630_0001724_7562_7936 | 124 |
| 422 | 3300046517 | Ga0495630_0003792 | Ga0495630_0003792_9422_9811 | 124 |
| 423 | 3300046517 | Ga0495630_0028143 | Ga0495630_0028143_515_889 | 124 |
| 424 | 3300046517 | Ga0495630_0172751 | Ga0495630_0172751_1175_1549 | 124 |
| 425 | 3300046517 | Ga0495630_0360763 | Ga0495630_0360763_564_938 | 124 |
| 426 | 3300046518 | Ga0495631_0104808 | Ga0495631_0104808_462_836 | 124 |
| 427 | 3300046520 | Ga0495637_0062760 | Ga0495637_0062760_44_418 | 124 |
| 428 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_5058_5432 | 124 |
| 429 | 3300046529 | Ga0495652_0040087 | Ga0495652_0040087_3504_3878 | 124 |
| 430 | 3300046529 | Ga0495652_0551287 | Ga0495652_0551287_168_557 | 124 |
| 431 | 3300046531 | Ga0495665_0343336 | Ga0495665_0343336_14_424 | 124 |
| 432 | 3300046533 | Ga0495640_0569502 | Ga0495640_0569502_213_587 | 124 |
| 433 | 3300046535 | Ga0495586_0000359 | Ga0495586_0000359_991_1365 | 124 |
| 434 | 3300046535 | Ga0495586_0229640 | Ga0495586_0229640_263_652 | 124 |
| 435 | 3300046536 | Ga0495587_0011918 | Ga0495587_0011918_3284_3658 | 124 |
| 436 | 3300046536 | Ga0495587_0042253 | Ga0495587_0042253_627_1001 | 124 |
| 437 | 3300046536 | Ga0495587_0115195 | Ga0495587_0115195_735_1109 | 124 |
| 438 | 3300046539 | Ga0495621_0025134 | Ga0495621_0025134_1503_1877 | 124 |
| 439 | 3300046543 | Ga0495645_0027561 | Ga0495645_0027561_207_581 | 124 |
| 440 | 3300046543 | Ga0495645_0054850 | Ga0495645_0054850_28_408 | 124 |
| 441 | 3300046557 | Ga0495622_0000076 | Ga0495622_0000076_43048_43422 | 124 |
| 442 | 3300046558 | Ga0495633_0305168 | Ga0495633_0305168_267_641 | 124 |
| 443 | 3300046559 | Ga0495667_0000019 | Ga0495667_0000019_148788_149162 | 124 |
| 444 | 3300046559 | Ga0495667_0128417 | Ga0495667_0128417_220_594 | 124 |
| 445 | 3300046615 | Ga0495656_0000151 | Ga0495656_0000151_18412_18786 | 124 |
| 446 | 3300046642 | Ga0495634_0001012 | Ga0495634_0001012_21809_22183 | 124 |
| 447 | 3300046642 | Ga0495634_0022565 | Ga0495634_0022565_3453_3827 | 124 |
| 448 | 3300046642 | Ga0495634_0033575 | Ga0495634_0033575_1288_1677 | 124 |
| 449 | 3300046642 | Ga0495634_0073488 | Ga0495634_0073488_1789_2163 | 124 |
| 450 | 3300046660 | Ga0495625_0000395 | Ga0495625_0000395_26615_26989 | 124 |
| 451 | 3300046663 | Ga0495635_0000017 | Ga0495635_0000017_144530_144910 | 124 |
| 452 | 3300046663 | Ga0495635_0282436 | Ga0495635_0282436_358_732 | 124 |
| 453 | 3300046663 | Ga0495635_0469335 | Ga0495635_0469335_240_614 | 124 |
| 454 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_265388_265762 | 124 |
| 455 | 3300046675 | Ga0495657_0055870 | Ga0495657_0055870_188_562 | 124 |
| 456 | 3300046675 | Ga0495657_0064266 | Ga0495657_0064266_53_442 | 124 |
| 457 | 3300046675 | Ga0495657_0223041 | Ga0495657_0223041_521_895 | 124 |
| 458 | 3300046678 | Ga0495599_0031576 | Ga0495599_0031576_848_1222 | 124 |
| 459 | 3300046678 | Ga0495599_0670832 | Ga0495599_0670832_114_488 | 124 |
| 460 | 3300046678 | Ga0495599_0688971 | Ga0495599_0688971_187_561 | 124 |
| 461 | 3300046679 | Ga0495623_0125714 | Ga0495623_0125714_208_582 | 124 |
| 462 | 3300046681 | Ga0495647_0029830 | Ga0495647_0029830_204_578 | 124 |
| 463 | 3300046684 | Ga0495669_0000181 | Ga0495669_0000181_33568_33942 | 124 |
| 464 | 3300046684 | Ga0495669_0009025 | Ga0495669_0009025_3079_3453 | 124 |
| 465 | 3300046689 | Ga0495613_0040693 | Ga0495613_0040693_2658_3032 | 124 |
| 466 | 3300046689 | Ga0495613_0082962 | Ga0495613_0082962_958_1347 | 124 |
| 467 | 3300046690 | Ga0495624_0002294 | Ga0495624_0002294_4943_5317 | 124 |
| 468 | 3300046690 | Ga0495624_0064053 | Ga0495624_0064053_1756_2145 | 124 |
| 469 | 3300046690 | Ga0495624_0190003 | Ga0495624_0190003_168_542 | 124 |
| 470 | 3300046691 | Ga0495670_0010732 | Ga0495670_0010732_3783_4157 | 124 |
| 471 | 3300046809 | Ga0495600_0047087 | Ga0495600_0047087_2151_2525 | 124 |
| 472 | 3300046809 | Ga0495600_0100908 | Ga0495600_0100908_542_916 | 124 |
| 473 | 3300046809 | Ga0495600_0426297 | Ga0495600_0426297_134_508 | 124 |
| 474 | 3300047315 | Ga0495581_0045133 | Ga0495581_0045133_410_784 | 124 |
| 475 | 3300047317 | Ga0495604_0000104 | Ga0495604_0000104_38579_38953 | 124 |
| 476 | 3300047317 | Ga0495604_0000527 | Ga0495604_0000527_31107_31481 | 124 |
| 477 | 3300047319 | Ga0495674_0000024 | Ga0495674_0000024_21811_22185 | 124 |
| 478 | 3300047319 | Ga0495674_0319263 | Ga0495674_0319263_186_575 | 124 |
| 479 | 3300047320 | Ga0495672_0101297 | Ga0495672_0101297_904_1278 | 124 |
| 480 | 3300047321 | Ga0495676_0031967 | Ga0495676_0031967_969_1343 | 124 |
| 481 | 3300047322 | Ga0495680_0001363 | Ga0495680_0001363_16782_17156 | 124 |
| 482 | 3300047322 | Ga0495680_0007564 | Ga0495680_0007564_7126_7500 | 124 |
| 483 | 3300047322 | Ga0495680_0011541 | Ga0495680_0011541_4905_5291 | 124 |
| 484 | 3300047322 | Ga0495680_0193046 | Ga0495680_0193046_131_520 | 124 |
| 485 | 3300047322 | Ga0495680_0254627 | Ga0495680_0254627_523_897 | 124 |
| 486 | 3300047322 | Ga0495680_0470572 | Ga0495680_0470572_343_717 | 124 |
| 487 | 3300047322 | Ga0495680_0527743 | Ga0495680_0527743_346_720 | 124 |
| 488 | 3300047444 | Ga0495675_0000094 | Ga0495675_0000094_13919_14293 | 124 |
| 489 | 3300047446 | Ga0495679_012187 | Ga0495679_012187_2237_2611 | 124 |
| 490 | 3300047446 | Ga0495679_083779 | Ga0495679_083779_122_532 | 124 |
| 491 | 3300047447 | Ga0495685_074866 | Ga0495685_074866_633_1019 | 124 |
| 492 | 3300047472 | Ga0495686_0022374 | Ga0495686_0022374_1059_1433 | 124 |
| 493 | 3300047673 | Ga0495593_0048881 | Ga0495593_0048881_1122_1496 | 124 |
| 494 | 3300048088 | Ga0495602_0001025 | Ga0495602_0001025_26264_26671 | 124 |
| 495 | 3300048903 | Ga0496100_0000006 | Ga0496100_0000006_72917_73291 | 124 |
| 496 | 3300048903 | Ga0496100_0000019 | Ga0496100_0000019_30223_30597 | 124 |
| 497 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_30223_30597 | 124 |
| 498 | 3300048904 | Ga0496101_0000009 | Ga0496101_0000009_72917_73291 | 124 |
| 499 | 3300048905 | Ga0496102_0000438 | Ga0496102_0000438_42269_42643 | 124 |
| 500 | 3300048905 | Ga0496102_0025372 | Ga0496102_0025372_3162_3536 | 124 |
| 501 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_638186_638560 | 124 |
| 502 | 3300048906 | Ga0496103_0470968 | Ga0496103_0470968_156_530 | 124 |
| 503 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_259841_260221 | 124 |
| 504 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_405932_406306 | 124 |
| 505 | 3300048907 | Ga0496104_0015865 | Ga0496104_0015865_2018_2392 | 124 |
| 506 | 3300048907 | Ga0496104_0059279 | Ga0496104_0059279_1569_1943 | 124 |
| 507 | 3300048907 | Ga0496104_0077504 | Ga0496104_0077504_130_504 | 124 |
| 508 | 3300048907 | Ga0496104_0798945 | Ga0496104_0798945_283_657 | 124 |
| 509 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_259841_260221 | 124 |
| 510 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_405932_406306 | 124 |
| 511 | 3300048908 | Ga0496105_0000386 | Ga0496105_0000386_22504_22878 | 124 |
| 512 | 3300048908 | Ga0496105_0153180 | Ga0496105_0153180_1242_1616 | 124 |
| 513 | 3300048909 | Ga0496106_0000064 | Ga0496106_0000064_53815_54189 | 124 |
| 514 | 3300048909 | Ga0496106_0000137 | Ga0496106_0000137_29381_29755 | 124 |
| 515 | 3300048909 | Ga0496106_0000156 | Ga0496106_0000156_30514_30888 | 124 |
| 516 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_289842_290216 | 124 |
| 517 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_30440_30814 | 124 |
| 518 | 3300048910 | Ga0496107_1312216 | Ga0496107_1312216_54_428 | 124 |
| 519 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_312032_312406 | 124 |
| 520 | 3300048911 | Ga0496108_0009268 | Ga0496108_0009268_2066_2440 | 124 |
| 521 | 3300048911 | Ga0496108_0047519 | Ga0496108_0047519_2736_3110 | 124 |
| 522 | 3300048911 | Ga0496108_0499702 | Ga0496108_0499702_155_529 | 124 |
| 523 | 3300048912 | Ga0496109_0000011 | Ga0496109_0000011_83295_83669 | 124 |
| 524 | 3300048912 | Ga0496109_0000031 | Ga0496109_0000031_158245_158619 | 124 |
| 525 | 3300048912 | Ga0496109_0006693 | Ga0496109_0006693_2061_2435 | 124 |
| 526 | 3300048912 | Ga0496109_0276207 | Ga0496109_0276207_429_803 | 124 |
| 527 | 3300048912 | Ga0496109_0319107 | Ga0496109_0319107_178_552 | 124 |
| 528 | 3300048912 | Ga0496109_0827302 | Ga0496109_0827302_84_458 | 124 |
| 529 | 3300048913 | Ga0496110_0028735 | Ga0496110_0028735_2899_3273 | 124 |
| 530 | 3300048913 | Ga0496110_0035382 | Ga0496110_0035382_2199_2573 | 124 |
| 531 | 3300048913 | Ga0496110_0105349 | Ga0496110_0105349_1645_2019 | 124 |
| 532 | 3300048914 | Ga0496111_0457959 | Ga0496111_0457959_395_769 | 124 |
| 533 | 3300048914 | Ga0496111_0500529 | Ga0496111_0500529_461_835 | 124 |
| 534 | 3300048914 | Ga0496111_0706136 | Ga0496111_0706136_226_600 | 124 |
| 535 | 3300048915 | Ga0496112_0000026 | Ga0496112_0000026_143189_143563 | 124 |
| 536 | 3300048915 | Ga0496112_0147714 | Ga0496112_0147714_606_980 | 124 |
| 537 | 3300048915 | Ga0496112_1414648 | Ga0496112_1414648_116_490 | 124 |
| 538 | 3300048916 | Ga0496113_0013671 | Ga0496113_0013671_1271_1645 | 124 |
| 539 | 3300048916 | Ga0496113_0312440 | Ga0496113_0312440_470_844 | 124 |
| 540 | 3300048916 | Ga0496113_0521745 | Ga0496113_0521745_341_715 | 124 |
| 541 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_386329_386733 | 124 |
| 542 | 3300048917 | Ga0496114_0115091 | Ga0496114_0115091_1554_1928 | 124 |
| 543 | 3300048917 | Ga0496114_0405934 | Ga0496114_0405934_256_630 | 124 |
| 544 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_83539_83913 | 124 |
| 545 | 3300048918 | Ga0496115_0000027 | Ga0496115_0000027_112616_113020 | 124 |
| 546 | 3300048922 | Ga0496119_0064063 | Ga0496119_0064063_649_1023 | 124 |
| 547 | 3300048923 | Ga0496120_0027513 | Ga0496120_0027513_1670_2044 | 124 |
| 548 | 3300048928 | Ga0496125_0087147 | Ga0496125_0087147_692_1066 | 124 |
| 549 | 3300049572 | Ga0501036_0838948 | Ga0501036_0838948_209_583 | 124 |
| 550 | 3300049574 | Ga0501038_0893710 | Ga0501038_0893710_162_536 | 124 |
| 551 | 3300049575 | Ga0501039_0070081 | Ga0501039_0070081_586_960 | 124 |
| 552 | 3300049576 | Ga0501040_0776095 | Ga0501040_0776095_193_567 | 124 |
| 553 | 3300049578 | Ga0501042_0034840 | Ga0501042_0034840_3072_3491 | 124 |
| 554 | 3300049582 | Ga0501048_0744711 | Ga0501048_0744711_83_457 | 124 |
| 555 | 3300049584 | Ga0501068_0247227 | Ga0501068_0247227_662_1036 | 124 |
| 556 | 3300049587 | Ga0501071_1039736 | Ga0501071_1039736_37_423 | 124 |
| 557 | 3300049588 | Ga0501072_0297739 | Ga0501072_0297739_883_1257 | 124 |
| 558 | 3300049591 | Ga0501075_0206157 | Ga0501075_0206157_1064_1438 | 124 |
| 559 | 3300049592 | Ga0501076_1024948 | Ga0501076_1024948_127_501 | 124 |
| 560 | 3300049741 | Ga0501079_0675985 | Ga0501079_0675985_147_521 | 124 |
| 561 | 3300049741 | Ga0501079_0929334 | Ga0501079_0929334_95_469 | 124 |
| 562 | 3300049743 | Ga0501081_0167588 | Ga0501081_0167588_413_787 | 124 |
| 563 | 3300049743 | Ga0501081_0330962 | Ga0501081_0330962_541_915 | 124 |
| 564 | 3300049769 | Ga0501272_045735 | Ga0501272_045735_42_416 | 124 |
| 565 | 3300050515 | nmdc:mga0a205_1461_c1 | nmdc:mga0a205_1461_c1_11037_11411 | 124 |
| 566 | 3300050515 | nmdc:mga0a205_4_c1 | nmdc:mga0a205_4_c1_38829_39239 | 124 |
| 567 | 3300053077 | Ga0495601_0000029 | Ga0495601_0000029_15367_15741 | 124 |
| 568 | 3300053077 | Ga0495601_0000179 | Ga0495601_0000179_32384_32758 | 124 |
| 569 | 3300053077 | Ga0495601_0006771 | Ga0495601_0006771_4222_4611 | 124 |
| 570 | 3300053077 | Ga0495601_0041695 | Ga0495601_0041695_576_950 | 124 |
| 571 | 3300053077 | Ga0495601_0042388 | Ga0495601_0042388_2188_2562 | 124 |
| 572 | 3300053077 | Ga0495601_0227202 | Ga0495601_0227202_394_768 | 124 |
| 573 | 3300053077 | Ga0495601_0516998 | Ga0495601_0516998_122_496 | 124 |
| 574 | 3300053078 | Ga0495612_0000115 | Ga0495612_0000115_4754_5128 | 124 |
| 575 | 3300053078 | Ga0495612_0002233 | Ga0495612_0002233_2153_2545 | 124 |
| 576 | 3300053078 | Ga0495612_0008755 | Ga0495612_0008755_2445_2819 | 124 |
| 577 | 3300053078 | Ga0495612_0020013 | Ga0495612_0020013_1361_1735 | 124 |
| 578 | 3300053078 | Ga0495612_0090788 | Ga0495612_0090788_482_856 | 124 |
| 579 | 3300053078 | Ga0495612_0351598 | Ga0495612_0351598_18_392 | 124 |
| 580 | 3300053083 | Ga0495655_0000010 | Ga0495655_0000010_26919_27293 | 124 |
| 581 | 3300053083 | Ga0495655_0106099 | Ga0495655_0106099_436_810 | 124 |
| 582 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_214212_214586 | 124 |
| 583 | 3300053084 | Ga0495595_0001355 | Ga0495595_0001355_7327_7701 | 124 |
| 584 | 3300053084 | Ga0495595_0007157 | Ga0495595_0007157_322_729 | 124 |
| 585 | 3300053084 | Ga0495595_0231618 | Ga0495595_0231618_292_666 | 124 |
| 586 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_302096_302470 | 124 |
| 587 | 3300053085 | Ga0495619_0000233 | Ga0495619_0000233_16549_16950 | 124 |
| 588 | 3300053085 | Ga0495619_0000413 | Ga0495619_0000413_24432_24821 | 124 |
| 589 | 3300053085 | Ga0495619_0001241 | Ga0495619_0001241_2414_2788 | 124 |
| 590 | 3300053085 | Ga0495619_0033178 | Ga0495619_0033178_1722_2111 | 124 |
| 591 | 3300053085 | Ga0495619_0078447 | Ga0495619_0078447_949_1323 | 124 |
| 592 | 3300053085 | Ga0495619_0137018 | Ga0495619_0137018_902_1276 | 124 |
| 593 | 3300053094 | Ga0500566_0009429 | Ga0500566_0009429_2744_3118 | 124 |
| 594 | 3300053096 | Ga0500641_0001760 | Ga0500641_0001760_3898_4272 | 124 |
| 595 | 3300053102 | Ga0500554_022360 | Ga0500554_022360_1238_1711 | 124 |
| 596 | 3300053123 | Ga0500614_002080 | Ga0500614_002080_3697_4071 | 124 |
| 597 | 3300053129 | Ga0500628_000039 | Ga0500628_000039_17562_17936 | 124 |
| 598 | 3300054114 | Ga0501084_0722328 | Ga0501084_0722328_288_662 | 124 |
| 599 | 3300060353 | Ga0501082_0579950 | Ga0501082_0579950_588_962 | 124 |
| 600 | 3300060353 | Ga0501082_1917150 | Ga0501082_1917150_71_460 | 124 |
| 601 | 3300061734 | Ga0530510_0083074 | Ga0530510_0083074_1678_2052 | 124 |
| 602 | 3300061734 | Ga0530510_0476894 | Ga0530510_0476894_398_787 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dct-assembly1.cif.gz_A | crystal structure of the tt1209 from thermus thermophilus hb8 | 0.8987 | 33 | 112 |
| 8awp-assembly1.cif.gz_A | crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) | 0.8925 | 6 | 111 |
| 8awp-assembly1.cif.gz_B | crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) | 0.8853 | 6 | 110 |
| 5wse-assembly1.cif.gz_D | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.8819 | 6 | 116 |
| 6o2d-assembly1.cif.gz_A | schizosaccharomyces pombe cnp3 cupin domain | 0.8801 | 11 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9048 | 33 | 112 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8922 | 18 | 112 | 2.60.120.10 |
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8874 | 21 | 112 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.885 | 32 | 112 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8742 | 18 | 112 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3BCV7-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9698 | 16 | 124 |
|
| AF-A0A1M3BCV7-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9612 | 16 | 124 |
|
| AF-I4EK96-F1-model_v4 | Cupin 2 conserved barrel domain protein | 0.9571 | 36 | 111 |
|
| AF-A0A538K3L0-F1-model_v4 | Cupin domain-containing protein | 0.943 | 24 | 124 |
|
| AF-A0A2V6W9G6-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9373 | 33 | 115 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar