F468202

General Info

Members Datasets Scaffolds Average Seq Length
602 296 602 124

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0034123|Ga0495638_0034123_2673_3044
Length 123
Sequence MEKGYSIKHRDAFERMEGSGESTWLLARKALGTDAFGYNLVEIGPGGKIPEHAESGGQVELYVILEGEAVFVMDGEELVAPAGTFASIEPAVSRSIHNRSAGKVTAMLIGVDPSGNYEPMSWG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
181 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
182 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
265 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
291 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
292 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
293 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 11.13
Rhizosphere 86.21
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000566 3300001977 Bacteria 5583
2 JGI24740J21852_10002767 3300001979 Bacteria 7845
3 JGI24743J22301_10134867 3300001991 Bacteria 547
4 JGI24748J21848_1000241 3300002074 Bacteria 6544
5 JGI24034J26672_10000120 3300002239 Bacteria 11999
6 JGI24742J22300_10010826 3300002244 Bacteria 1511
7 Ga0070683_100007274 3300005329 Bacteria 9338
8 Ga0070683_100010609 3300005329 Bacteria 7919
9 Ga0070683_100015665 3300005329 Bacteria 6665
10 Ga0070683_100112957 3300005329 Bacteria 2563
11 Ga0070683_100126241 3300005329 Bacteria 2419
12 Ga0070683_100134601 3300005329 Bacteria 2340
13 Ga0070670_100425650 3300005331 Unclassified 1174
14 Ga0070677_10000085 3300005333 Bacteria 29927
15 Ga0070680_100215276 3300005336 Unclassified 1621
16 Ga0070682_100000009 3300005337 Bacteria 291635
17 Ga0070682_100000061 3300005337 Bacteria 105134
18 Ga0070682_100435064 3300005337 Bacteria 1001
19 Ga0068868_100000104 3300005338 Bacteria 52249
20 Ga0068868_100000220 3300005338 Bacteria 38739
21 Ga0070689_100071524 3300005340 Bacteria 2710
22 Ga0070689_100105239 3300005340 Bacteria 2238
23 Ga0070691_10000275 3300005341 Bacteria 17919
24 Ga0070691_10001199 3300005341 Bacteria 10870
25 Ga0070691_10024493 3300005341 Unclassified 2805
26 Ga0070668_100006928 3300005347 Bacteria 8398
27 Ga0070668_100351240 3300005347 Unclassified 1248
28 Ga0070669_100507436 3300005353 Bacteria 1001
29 Ga0070675_100000069 3300005354 Bacteria 59717
30 Ga0070671_100237787 3300005355 Bacteria 1546
31 Ga0070674_100000019 3300005356 Bacteria 89350
32 Ga0070674_100000030 3300005356 Bacteria 69481
33 Ga0070673_100006768 3300005364 Bacteria 7480
34 Ga0070688_100000053 3300005365 Bacteria 55064
35 Ga0070688_100122084 3300005365 Bacteria 1746
36 Ga0070688_100908241 3300005365 Bacteria 695
37 Ga0070659_100015340 3300005366 Bacteria 5738
38 Ga0070659_100155757 3300005366 Bacteria 1866
39 Ga0070659_101140284 3300005366 Unclassified 688
40 Ga0070667_100002266 3300005367 Bacteria 16947
41 Ga0070667_101546503 3300005367 Bacteria 623
42 Ga0070703_10169785 3300005406 Bacteria 834
43 Ga0070714_100036362 3300005435 Bacteria 4130
44 Ga0070714_100037035 3300005435 Bacteria 4097
45 Ga0070713_100000023 3300005436 Bacteria 98528
46 Ga0070710_10409277 3300005437 Bacteria 911
47 Ga0070701_10188915 3300005438 Bacteria 1211
48 Ga0070701_10719961 3300005438 Unclassified 673
49 Ga0070711_100004129 3300005439 Bacteria 8536
50 Ga0070711_100628171 3300005439 Unclassified 898
51 Ga0070700_100167973 3300005441 Bacteria 1517
52 Ga0070694_101460428 3300005444 Bacteria 578
53 Ga0070663_100626614 3300005455 Bacteria 907
54 Ga0070663_100635651 3300005455 Bacteria 901
55 Ga0070662_100000001 3300005457 Bacteria 317995
56 Ga0070681_10042499 3300005458 Bacteria 4554
57 Ga0070685_10000032 3300005466 Bacteria 84253
58 Ga0070685_10000086 3300005466 Bacteria 57017
59 Ga0070685_10132387 3300005466 Unclassified 1561
60 Ga0070685_10407577 3300005466 Bacteria 943
61 Ga0070679_100000258 3300005530 Bacteria 44384
62 Ga0070684_100008110 3300005535 Bacteria 8198
63 Ga0070684_100044980 3300005535 Bacteria 3821
64 Ga0070684_100080941 3300005535 Bacteria 2873
65 Ga0070684_101549075 3300005535 Unclassified 625
66 Ga0068853_100021670 3300005539 Bacteria 5361
67 Ga0068853_100615476 3300005539 Bacteria 1032
68 Ga0070672_100000005 3300005543 Bacteria 121014
69 Ga0070686_101896915 3300005544 Bacteria 508
70 Ga0070695_101231057 3300005545 Bacteria 617
71 Ga0070693_100000638 3300005547 Bacteria 15431
72 Ga0070665_100000022 3300005548 Bacteria 379286
73 Ga0070665_100017640 3300005548 Bacteria 7168
74 Ga0070665_100094251 3300005548 Bacteria 2999
75 Ga0070665_100216008 3300005548 Unclassified 1918
76 Ga0070704_100331076 3300005549 Bacteria 1279
77 Ga0068855_102542366 3300005563 Unclassified 509
78 Ga0070664_100014728 3300005564 Bacteria 6386
79 Ga0070664_100835820 3300005564 Bacteria 862
80 Ga0068854_100000345 3300005578 Bacteria 29913
81 Ga0068854_100029725 3300005578 Bacteria 3785
82 Ga0068856_100003669 3300005614 Bacteria 15395
83 Ga0068856_100026420 3300005614 Bacteria 5662
84 Ga0068856_100193441 3300005614 Unclassified 2048
85 Ga0068856_100195633 3300005614 Bacteria 2036
86 Ga0068856_100829457 3300005614 Unclassified 944
87 Ga0068856_101994131 3300005614 Unclassified 591
88 Ga0070702_100198963 3300005615 Unclassified 1325
89 Ga0070702_101005917 3300005615 Unclassified 660
90 Ga0070702_101253603 3300005615 Unclassified 600
91 Ga0068852_100000037 3300005616 Bacteria 97602
92 Ga0068852_100008636 3300005616 Bacteria 7526
93 Ga0068864_100000043 3300005618 Bacteria 162928
94 Ga0068866_10000005 3300005718 Bacteria 196339
95 Ga0068866_10000382 3300005718 Bacteria 20838
96 Ga0068866_10521183 3300005718 Unclassified 790
97 Ga0068866_10534891 3300005718 Unclassified 781
98 Ga0068851_10005227 3300005834 Bacteria 5890
99 Ga0068851_10020425 3300005834 Bacteria 3208
100 Ga0068870_10397359 3300005840 Unclassified 896
101 Ga0068863_100000229 3300005841 Bacteria 59324
102 Ga0068863_100002888 3300005841 Bacteria 17015
103 Ga0068863_100268768 3300005841 Bacteria 1650
104 Ga0068858_100000017 3300005842 Bacteria 186913
105 Ga0068858_100000140 3300005842 Bacteria 76446
106 Ga0068858_100045457 3300005842 Bacteria 4070
107 Ga0068858_100093347 3300005842 Bacteria 2802
108 Ga0068860_100001002 3300005843 Bacteria 31259
109 Ga0068860_100154024 3300005843 Bacteria 2215
110 Ga0068860_100421948 3300005843 Bacteria 1322
111 Ga0068862_100020486 3300005844 Bacteria 5524
112 Ga0081455_10001231 3300005937 Bacteria 31996
113 Ga0081455_10374976 3300005937 Unclassified 996
114 Ga0081540_1000046 3300005983 Bacteria 131375
115 Ga0081540_1216159 3300005983 Unclassified 685
116 Ga0081539_10001074 3300005985 Bacteria 49797
117 Ga0075432_10332856 3300006058 Unclassified 639
118 Ga0070715_10000008 3300006163 Bacteria 189899
119 Ga0097621_100804729 3300006237 Archaea 871
120 Ga0097621_100958826 3300006237 Bacteria 799
121 Ga0068871_100085751 3300006358 Unclassified 2616
122 Ga0075433_10007173 3300006852 Bacteria 8827
123 Ga0075433_10939506 3300006852 Unclassified 754
124 Ga0068865_100000081 3300006881 Bacteria 51047
125 Ga0105245_10000249 3300009098 Bacteria 51282
126 Ga0105245_10000330 3300009098 Bacteria 44516
127 Ga0105245_10019372 3300009098 Bacteria 5959
128 Ga0105245_10019398 3300009098 Bacteria 5956
129 Ga0105245_11347658 3300009098 Bacteria 763
130 Ga0105247_10002606 3300009101 Bacteria 12180
131 Ga0105247_10345466 3300009101 Bacteria 1045
132 Ga0105247_10828813 3300009101 Bacteria 708
133 Ga0105243_10006390 3300009148 Bacteria 9104
134 Ga0105243_11699923 3300009148 Unclassified 660
135 Ga0105241_10124872 3300009174 Bacteria 2077
136 Ga0105241_10216916 3300009174 Unclassified 1606
137 Ga0105242_10000052 3300009176 Bacteria 79244
138 Ga0105242_10035964 3300009176 Bacteria 3971
139 Ga0105242_10049788 3300009176 Bacteria 3410
140 Ga0105242_10249527 3300009176 Bacteria 1599
141 Ga0105248_10000017 3300009177 Bacteria 298089
142 Ga0105238_10000016 3300009551 Bacteria 236218
143 Ga0105249_10000054 3300009553 Bacteria 162883
144 Ga0105249_10005341 3300009553 Bacteria 11082
145 Ga0105239_10217724 3300010375 Bacteria 2141
146 Ga0105239_10332280 3300010375 Bacteria 1714
147 Ga0105239_12098155 3300010375 Bacteria 657
148 Ga0105246_10269439 3300011119 Bacteria 1360
149 Ga0105246_10475227 3300011119 Bacteria 1056
150 Ga0157370_10046483 3300013104 Bacteria 4162
151 Ga0157370_10228969 3300013104 Bacteria 1721
152 Ga0157369_10000105 3300013105 Bacteria 117996
153 Ga0157374_10000242 3300013296 Bacteria 50857
154 Ga0157374_10085714 3300013296 Bacteria 2996
155 Ga0157374_10715480 3300013296 Bacteria 1015
156 Ga0157378_10046947 3300013297 Bacteria 3839
157 Ga0157378_10052908 3300013297 Bacteria 3613
158 Ga0157378_10064214 3300013297 Bacteria 3283
159 Ga0163162_10302474 3300013306 Unclassified 1732
160 Ga0157372_10000284 3300013307 Bacteria 56386
161 Ga0157375_10000620 3300013308 Bacteria 31506
162 Ga0157375_12661401 3300013308 Unclassified 598
163 Ga0163163_10059017 3300014325 Bacteria 3794
164 Ga0163163_10365762 3300014325 Unclassified 1499
165 Ga0157380_10000178 3300014326 Bacteria 36761
166 Ga0157380_10000838 3300014326 Bacteria 19239
167 Ga0157380_10102618 3300014326 Bacteria 2385
168 Ga0157380_10959792 3300014326 Unclassified 885
169 Ga0157377_10610981 3300014745 Unclassified 779
170 Ga0157377_10632059 3300014745 Bacteria 768
171 Ga0157379_10024043 3300014968 Bacteria 5407
172 Ga0157379_10039602 3300014968 Bacteria 4205
173 Ga0157379_10195594 3300014968 Unclassified 1827
174 Ga0157376_10111428 3300014969 Bacteria 2409
175 Ga0157376_11151965 3300014969 Unclassified 802
176 Ga0163161_10000240 3300017792 Bacteria 49520
177 Ga0163161_10243456 3300017792 Bacteria 1399
178 Ga0163161_10438438 3300017792 Bacteria 1054
179 Ga0206356_10206281 3300020070 Unclassified 1890
180 Ga0207656_10002224 3300025321 Bacteria 6496
181 Ga0207656_10008896 3300025321 Bacteria 3718
182 Ga0207653_10042538 3300025885 Bacteria 1494
183 Ga0207682_10000060 3300025893 Bacteria 46992
184 Ga0207692_10563027 3300025898 Bacteria 729
185 Ga0207642_10000005 3300025899 Bacteria 401934
186 Ga0207642_10000500 3300025899 Bacteria 12040
187 Ga0207642_10510342 3300025899 Unclassified 737
188 Ga0207710_10000096 3300025900 Bacteria 116063
189 Ga0207710_10402869 3300025900 Unclassified 702
190 Ga0207688_10415841 3300025901 Unclassified 835
191 Ga0207685_10000012 3300025905 Bacteria 189900
192 Ga0207654_10117527 3300025911 Bacteria 1664
193 Ga0207654_10165808 3300025911 Unclassified 1430
194 Ga0207707_10022249 3300025912 Bacteria 5543
195 Ga0207693_10358157 3300025915 Bacteria 1141
196 Ga0207663_10002802 3300025916 Bacteria 8403
197 Ga0207663_10030099 3300025916 Bacteria 3198
198 Ga0207660_10214982 3300025917 Unclassified 1507
199 Ga0207649_10000015 3300025920 Bacteria 245662
200 Ga0207652_10000196 3300025921 Bacteria 63727
201 Ga0207681_11262422 3300025923 Unclassified 620
202 Ga0207694_10000012 3300025924 Bacteria 411218
203 Ga0207650_10120890 3300025925 Unclassified 2039
204 Ga0207659_10001302 3300025926 Bacteria 14889
205 Ga0207687_10000094 3300025927 Bacteria 64753
206 Ga0207687_10000106 3300025927 Bacteria 61275
207 Ga0207687_10010977 3300025927 Bacteria 5919
208 Ga0207687_10011714 3300025927 Bacteria 5736
209 Ga0207687_10885573 3300025927 Bacteria 763
210 Ga0207687_11676517 3300025927 Unclassified 545
211 Ga0207700_10000003 3300025928 Bacteria 500797
212 Ga0207664_10030260 3300025929 Bacteria 4134
213 Ga0207664_10676386 3300025929 Unclassified 928
214 Ga0207644_10287996 3300025931 Unclassified 1320
215 Ga0207690_10010639 3300025932 Bacteria 5481
216 Ga0207690_10104900 3300025932 Bacteria 2026
217 Ga0207706_10000003 3300025933 Bacteria 345011
218 Ga0207686_10000035 3300025934 Bacteria 130483
219 Ga0207686_10003508 3300025934 Bacteria 8424
220 Ga0207686_10285331 3300025934 Bacteria 1220
221 Ga0207686_10549287 3300025934 Bacteria 903
222 Ga0207709_10019786 3300025935 Bacteria 3789
223 Ga0207670_10023085 3300025936 Bacteria 3866
224 Ga0207670_10088689 3300025936 Bacteria 2182
225 Ga0207669_10000029 3300025937 Bacteria 88351
226 Ga0207669_10000047 3300025937 Bacteria 60937
227 Ga0207704_10000018 3300025938 Bacteria 153994
228 Ga0207704_10140066 3300025938 Bacteria 1691
229 Ga0207691_10000028 3300025940 Bacteria 121090
230 Ga0207711_10000011 3300025941 Bacteria 518817
231 Ga0207661_10005996 3300025944 Bacteria 8582
232 Ga0207661_10013598 3300025944 Bacteria 5944
233 Ga0207661_10099391 3300025944 Bacteria 2440
234 Ga0207661_10101096 3300025944 Bacteria 2421
235 Ga0207661_10177052 3300025944 Bacteria 1860
236 Ga0207679_10013592 3300025945 Bacteria 5336
237 Ga0207679_10700427 3300025945 Unclassified 919
238 Ga0207667_10771052 3300025949 Unclassified 960
239 Ga0207651_10004033 3300025960 Bacteria 7309
240 Ga0207712_10000032 3300025961 Bacteria 210628
241 Ga0207712_10007217 3300025961 Bacteria 7008
242 Ga0207668_10080861 3300025972 Unclassified 2355
243 Ga0207668_10666277 3300025972 Unclassified 912
244 Ga0207640_10000077 3300025981 Bacteria 76155
245 Ga0207640_10010886 3300025981 Bacteria 5131
246 Ga0207658_10002876 3300025986 Bacteria 12335
247 Ga0207658_10570280 3300025986 Bacteria 1014
248 Ga0207677_10000479 3300026023 Bacteria 26103
249 Ga0207677_10001833 3300026023 Bacteria 11221
250 Ga0207703_10000020 3300026035 Bacteria 251603
251 Ga0207703_10000030 3300026035 Bacteria 199014
252 Ga0207703_10039734 3300026035 Bacteria 3761
253 Ga0207703_10067575 3300026035 Unclassified 2942
254 Ga0207639_10067249 3300026041 Bacteria 2788
255 Ga0207639_10633883 3300026041 Bacteria 988
256 Ga0207639_10987106 3300026041 Bacteria 788
257 Ga0207678_11007096 3300026067 Bacteria 737
258 Ga0207678_11676297 3300026067 Unclassified 559
259 Ga0207708_10189714 3300026075 Bacteria 1635
260 Ga0207708_10933949 3300026075 Bacteria 752
261 Ga0207702_10000419 3300026078 Bacteria 48574
262 Ga0207702_10003965 3300026078 Bacteria 13291
263 Ga0207702_10031122 3300026078 Bacteria 4447
264 Ga0207702_10603808 3300026078 Bacteria 1077
265 Ga0207702_10666544 3300026078 Unclassified 1024
266 Ga0207641_10001796 3300026088 Bacteria 20626
267 Ga0207641_10002314 3300026088 Bacteria 17689
268 Ga0207641_10034705 3300026088 Bacteria 4198
269 Ga0207648_10001072 3300026089 Bacteria 30645
270 Ga0207676_10000042 3300026095 Bacteria 163475
271 Ga0207675_100061701 3300026118 Bacteria 3499
272 Ga0207683_10013197 3300026121 Bacteria 7048
273 Ga0207683_10356576 3300026121 Unclassified 1343
274 Ga0207698_10000015 3300026142 Bacteria 207368
275 Ga0207698_10008081 3300026142 Bacteria 6635
276 Ga0268266_10000029 3300028379 Bacteria 424015
277 Ga0268266_10001186 3300028379 Bacteria 32148
278 Ga0268266_10038746 3300028379 Bacteria 4057
279 Ga0268266_10210857 3300028379 Unclassified 1781
280 Ga0268266_10986753 3300028379 Unclassified 815
281 Ga0268265_10029147 3300028380 Bacteria 3959
282 Ga0268264_10003675 3300028381 Bacteria 13169
283 Ga0268264_10072728 3300028381 Bacteria 2916
284 Ga0268264_10293288 3300028381 Unclassified 1528
285 Ga0268264_12077223 3300028381 Unclassified 577
286 Ga0265337_1000101 3300028556 Bacteria 42173
287 Ga0265326_10000033 3300028558 Bacteria 91972
288 Ga0265319_1000010 3300028563 Bacteria 188773
289 Ga0265334_10098676 3300028573 Unclassified 1059
290 Ga0265323_10263201 3300028653 Bacteria 535
291 Ga0265322_10000005 3300028654 Bacteria 246112
292 Ga0265338_10000051 3300028800 Bacteria 211202
293 Ga0265338_11001490 3300028800 Bacteria 566
294 Ga0265324_10000207 3300029957 Bacteria 44991
295 Ga0265324_10075613 3300029957 Unclassified 1146
296 Ga0265332_10034937 3300031238 Bacteria 2184
297 Ga0265328_10001194 3300031239 Bacteria 12029
298 Ga0265320_10000010 3300031240 Bacteria 250501
299 Ga0265325_10005471 3300031241 Bacteria 7835
300 Ga0265329_10008633 3300031242 Bacteria 3850
301 Ga0265339_10016352 3300031249 Bacteria 4424
302 Ga0265331_10000869 3300031250 Bacteria 24602
303 Ga0265331_10188553 3300031250 Unclassified 930
304 Ga0265327_10000040 3300031251 Bacteria 291052
305 Ga0265316_10068127 3300031344 Bacteria 2751
306 Ga0265314_10000208 3300031711 Bacteria 86855
307 Ga0265342_10378692 3300031712 Unclassified 733
308 Ga0265342_10628040 3300031712 Bacteria 540
309 Ga0307415_100020148 3300032126 Bacteria 4066
310 Ga0373953_0182304 3300035117 Unclassified 906
311 Ga0373954_0157931 3300035118 Unclassified 1109
312 Ga0373956_0327061 3300035119 Bacteria 731
313 Ga0373943_0791806 3300035170 Unclassified 564
314 Ga0373955_0129684 3300035172 Bacteria 1471
315 Ga0316574_0672238 3300035398 Bacteria 636
316 Ga0373935_0848864 3300035692 Unclassified 675
317 Ga0373937_0015203 3300036401 Bacteria 6802
318 Ga0373937_0463516 3300036401 Bacteria 1203
319 Ga0373937_0595463 3300036401 Unclassified 1050
320 Ga0373937_0759043 3300036401 Bacteria 917
321 Ga0373937_1195500 3300036401 Bacteria 709
322 Ga0395898_1290253 3300037466 Unclassified 660
323 Ga0451791_0052506 3300041451 Bacteria 1246
324 Ga0451800_0357192 3300041459 Bacteria 601
325 Ga0451800_0629083 3300041459 Bacteria 568
326 Ga0451804_0369380 3300041463 Unclassified 709
327 Ga0451807_0497514 3300041486 Bacteria 2174
328 Ga0451807_1858638 3300041486 Unclassified 1068
329 Ga0451835_0782939 3300041492 Unclassified 659
330 Ga0451845_0189617 3300041501 Unclassified 730
331 Ga0451849_0745045 3300041505 Unclassified 1048
332 Ga0451849_1502250 3300041505 Bacteria 925
333 Ga0451853_1500978 3300041512 Unclassified 1634
334 Ga0451853_1723538 3300041512 Bacteria 2756
335 Ga0451853_3840077 3300041512 Bacteria 3368
336 Ga0466963_0000012 3300044694 Bacteria 62839
337 Ga0466963_0044188 3300044694 Bacteria 2932
338 Ga0466960_0163099 3300044901 Bacteria 1198
339 Ga0466960_0208636 3300044901 Bacteria 1070
340 Ga0466967_0000012 3300045976 Bacteria 104270
341 Ga0466967_0027403 3300045976 Bacteria 4739
342 Ga0466967_2037144 3300045976 Unclassified 570
343 Ga0495592_0001189 3300046454 Bacteria 18063
344 Ga0495592_0374756 3300046454 Bacteria 907
345 Ga0495592_0696854 3300046454 Unclassified 611
346 Ga0495603_0000861 3300046455 Bacteria 17377
347 Ga0495603_0007243 3300046455 Bacteria 6660
348 Ga0495629_0000421 3300046459 Bacteria 35460
349 Ga0495629_0018857 3300046459 Bacteria 4932
350 Ga0495629_0033550 3300046459 Bacteria 3630
351 Ga0495629_0519749 3300046459 Archaea 801
352 Ga0495638_0034123 3300046460 Bacteria 3250
353 Ga0495641_0000440 3300046461 Bacteria 34775
354 Ga0495641_0065757 3300046461 Bacteria 1632
355 Ga0495641_0207533 3300046461 Unclassified 878
356 Ga0495651_0165995 3300046462 Bacteria 1577
357 Ga0495653_0013286 3300046463 Bacteria 6713
358 Ga0495653_0093416 3300046463 Bacteria 2194
359 Ga0495653_0165543 3300046463 Bacteria 1531
360 Ga0495653_0188759 3300046463 Bacteria 1408
361 Ga0495653_0259344 3300046463 Unclassified 1150
362 Ga0495582_0000002 3300046473 Bacteria 219909
363 Ga0495639_0027611 3300046475 Bacteria 2513
364 Ga0495662_0000130 3300046476 Bacteria 28303
365 Ga0495662_0002551 3300046476 Bacteria 9194
366 Ga0495662_0061446 3300046476 Bacteria 1815
367 Ga0495664_0312191 3300046477 Unclassified 949
368 Ga0495584_0215143 3300046491 Unclassified 977
369 Ga0495594_0000012 3300046499 Bacteria 105133
370 Ga0495606_0000908 3300046507 Bacteria 43982
371 Ga0495608_0000013 3300046511 Bacteria 228481
372 Ga0495608_0000346 3300046511 Bacteria 32424
373 Ga0495608_0010058 3300046511 Bacteria 6599
374 Ga0495608_0052814 3300046511 Bacteria 2690
375 Ga0495618_0000218 3300046514 Bacteria 41741
376 Ga0495620_0000466 3300046515 Bacteria 26454
377 Ga0495628_0001008 3300046516 Bacteria 25683
378 Ga0495628_0014578 3300046516 Bacteria 6582
379 Ga0495628_0051007 3300046516 Bacteria 3272
380 Ga0495628_0126513 3300046516 Bacteria 1958
381 Ga0495628_0137629 3300046516 Bacteria 1865
382 Ga0495628_0233724 3300046516 Bacteria 1377
383 Ga0495628_0264828 3300046516 Unclassified 1280
384 Ga0495630_0001724 3300046517 Bacteria 15254
385 Ga0495630_0003792 3300046517 Bacteria 10541
386 Ga0495630_0028143 3300046517 Bacteria 4176
387 Ga0495630_0172751 3300046517 Bacteria 1647
388 Ga0495630_0360763 3300046517 Bacteria 1112
389 Ga0495631_0104808 3300046518 Bacteria 1217
390 Ga0495637_0062760 3300046520 Bacteria 1520
391 Ga0495644_0001063 3300046523 Bacteria 11437
392 Ga0495652_0000009 3300046529 Bacteria 311000
393 Ga0495652_0040087 3300046529 Bacteria 4048
394 Ga0495652_0551287 3300046529 Unclassified 793
395 Ga0495665_0343336 3300046531 Bacteria 761
396 Ga0495640_0020319 3300046533 Bacteria 4890
397 Ga0495640_0569502 3300046533 Bacteria 686
398 Ga0495586_0000359 3300046535 Bacteria 28382
399 Ga0495586_0229640 3300046535 Bacteria 1056
400 Ga0495587_0011918 3300046536 Bacteria 5495
401 Ga0495587_0042253 3300046536 Bacteria 2719
402 Ga0495587_0115195 3300046536 Bacteria 1542
403 Ga0495621_0025134 3300046539 Bacteria 1998
404 Ga0495645_0027561 3300046543 Bacteria 4128
405 Ga0495645_0054850 3300046543 Bacteria 2894
406 Ga0495622_0000076 3300046557 Bacteria 86777
407 Ga0495633_0305168 3300046558 Unclassified 723
408 Ga0495667_0000019 3300046559 Bacteria 181645
409 Ga0495667_0128417 3300046559 Bacteria 1635
410 Ga0495656_0000151 3300046615 Bacteria 25724
411 Ga0495634_0001012 3300046642 Bacteria 26406
412 Ga0495634_0022565 3300046642 Bacteria 4434
413 Ga0495634_0033575 3300046642 Bacteria 3526
414 Ga0495634_0073488 3300046642 Bacteria 2248
415 Ga0495634_0220485 3300046642 Bacteria 1171
416 Ga0495625_0000395 3300046660 Bacteria 66640
417 Ga0495625_0535240 3300046660 Unclassified 711
418 Ga0495635_0000017 3300046663 Bacteria 195506
419 Ga0495635_0282436 3300046663 Bacteria 1115
420 Ga0495635_0469335 3300046663 Unclassified 831
421 Ga0495588_0000247 3300046674 Bacteria 45295
422 Ga0495657_0000003 3300046675 Bacteria 279680
423 Ga0495657_0055870 3300046675 Bacteria 2633
424 Ga0495657_0064266 3300046675 Bacteria 2418
425 Ga0495657_0223041 3300046675 Bacteria 1142
426 Ga0495599_0031576 3300046678 Bacteria 3324
427 Ga0495599_0249467 3300046678 Unclassified 1081
428 Ga0495599_0670832 3300046678 Bacteria 599
429 Ga0495599_0688971 3300046678 Unclassified 590
430 Ga0495623_0125714 3300046679 Bacteria 1540
431 Ga0495647_0000028 3300046681 Bacteria 56683
432 Ga0495647_0002875 3300046681 Bacteria 5469
433 Ga0495647_0029830 3300046681 Unclassified 2019
434 Ga0495658_0000001 3300046683 Bacteria 385362
435 Ga0495658_0015227 3300046683 Bacteria 3943
436 Ga0495669_0000181 3300046684 Bacteria 39486
437 Ga0495669_0009025 3300046684 Bacteria 4201
438 Ga0495613_0000132 3300046689 Bacteria 74233
439 Ga0495613_0000690 3300046689 Bacteria 26621
440 Ga0495613_0040693 3300046689 Bacteria 3443
441 Ga0495613_0082962 3300046689 Bacteria 2328
442 Ga0495624_0000196 3300046690 Bacteria 46319
443 Ga0495624_0002294 3300046690 Bacteria 14578
444 Ga0495624_0064053 3300046690 Bacteria 2298
445 Ga0495624_0190003 3300046690 Bacteria 1249
446 Ga0495670_0010732 3300046691 Unclassified 4501
447 Ga0495600_0000652 3300046809 Bacteria 18003
448 Ga0495600_0047087 3300046809 Bacteria 2813
449 Ga0495600_0100908 3300046809 Bacteria 1881
450 Ga0495600_0426297 3300046809 Unclassified 823
451 Ga0495581_0045133 3300047315 Bacteria 2548
452 Ga0495604_0000104 3300047317 Bacteria 71390
453 Ga0495604_0000527 3300047317 Bacteria 33774
454 Ga0495674_0000024 3300047319 Bacteria 141746
455 Ga0495674_0319263 3300047319 Bacteria 1266
456 Ga0495672_0101297 3300047320 Bacteria 1561
457 Ga0495676_0006298 3300047321 Bacteria 10919
458 Ga0495676_0031967 3300047321 Bacteria 4446
459 Ga0495676_0138708 3300047321 Bacteria 1745
460 Ga0495680_0001363 3300047322 Bacteria 26520
461 Ga0495680_0007564 3300047322 Bacteria 9935
462 Ga0495680_0011541 3300047322 Bacteria 7816
463 Ga0495680_0193046 3300047322 Unclassified 1464
464 Ga0495680_0254627 3300047322 Bacteria 1243
465 Ga0495680_0470572 3300047322 Bacteria 857
466 Ga0495680_0527743 3300047322 Bacteria 798
467 Ga0495675_0000094 3300047444 Bacteria 63338
468 Ga0495679_012187 3300047446 Bacteria 3282
469 Ga0495679_083779 3300047446 Bacteria 902
470 Ga0495685_074866 3300047447 Bacteria 1131
471 Ga0495684_0604571 3300047471 Bacteria 739
472 Ga0495686_0022374 3300047472 Bacteria 4184
473 Ga0495593_0048881 3300047673 Unclassified 2247
474 Ga0495593_0139664 3300047673 Bacteria 1227
475 Ga0495602_0001025 3300048088 Bacteria 27203
476 Ga0495602_0667342 3300048088 Bacteria 708
477 Ga0495614_0169057 3300048089 Unclassified 980
478 Ga0496100_0000006 3300048903 Bacteria 297429
479 Ga0496100_0000019 3300048903 Bacteria 149995
480 Ga0496100_0956553 3300048903 Bacteria 673
481 Ga0496101_0000005 3300048904 Bacteria 331455
482 Ga0496101_0000009 3300048904 Bacteria 297429
483 Ga0496102_0000438 3300048905 Bacteria 47526
484 Ga0496102_0025372 3300048905 Bacteria 5277
485 Ga0496103_0000001 3300048906 Bacteria 643471
486 Ga0496103_0470968 3300048906 Unclassified 805
487 Ga0496104_0000008 3300048907 Bacteria 516976
488 Ga0496104_0000010 3300048907 Bacteria 475255
489 Ga0496104_0015865 3300048907 Bacteria 6834
490 Ga0496104_0059279 3300048907 Bacteria 3624
491 Ga0496104_0077504 3300048907 Bacteria 3167
492 Ga0496104_0798945 3300048907 Bacteria 850
493 Ga0496105_0000003 3300048908 Bacteria 713251
494 Ga0496105_0000005 3300048908 Bacteria 475797
495 Ga0496105_0000386 3300048908 Bacteria 28919
496 Ga0496105_0153180 3300048908 Bacteria 1894
497 Ga0496106_0000064 3300048909 Bacteria 85019
498 Ga0496106_0000137 3300048909 Bacteria 54395
499 Ga0496106_0000156 3300048909 Bacteria 50301
500 Ga0496107_0000002 3300048910 Bacteria 320871
501 Ga0496107_0000004 3300048910 Bacteria 297680
502 Ga0496107_1312216 3300048910 Unclassified 517
503 Ga0496108_0000004 3300048911 Bacteria 545055
504 Ga0496108_0000349 3300048911 Bacteria 39032
505 Ga0496108_0007713 3300048911 Bacteria 8717
506 Ga0496108_0009268 3300048911 Bacteria 7965
507 Ga0496108_0047519 3300048911 Bacteria 3587
508 Ga0496108_0499702 3300048911 Unclassified 1062
509 Ga0496109_0000011 3300048912 Bacteria 234908
510 Ga0496109_0000031 3300048912 Bacteria 163998
511 Ga0496109_0000307 3300048912 Bacteria 46191
512 Ga0496109_0006693 3300048912 Bacteria 9703
513 Ga0496109_0276207 3300048912 Bacteria 1583
514 Ga0496109_0319107 3300048912 Bacteria 1466
515 Ga0496109_0827302 3300048912 Unclassified 864
516 Ga0496109_2071452 3300048912 Unclassified 501
517 Ga0496110_0000166 3300048913 Bacteria 40195
518 Ga0496110_0028735 3300048913 Bacteria 4779
519 Ga0496110_0035382 3300048913 Bacteria 4332
520 Ga0496110_0105349 3300048913 Bacteria 2530
521 Ga0496111_0000046 3300048914 Bacteria 48246
522 Ga0496111_0457959 3300048914 Unclassified 941
523 Ga0496111_0500529 3300048914 Bacteria 894
524 Ga0496111_0706136 3300048914 Bacteria 733
525 Ga0496112_0000026 3300048915 Bacteria 144758
526 Ga0496112_0025758 3300048915 Bacteria 5649
527 Ga0496112_0147714 3300048915 Bacteria 2319
528 Ga0496112_1414648 3300048915 Unclassified 610
529 Ga0496113_0000017 3300048916 Bacteria 74327
530 Ga0496113_0013671 3300048916 Bacteria 5511
531 Ga0496113_0064188 3300048916 Bacteria 2776
532 Ga0496113_0312440 3300048916 Unclassified 1259
533 Ga0496113_0521745 3300048916 Unclassified 953
534 Ga0496114_0000003 3300048917 Bacteria 630981
535 Ga0496114_0115091 3300048917 Bacteria 2307
536 Ga0496114_0405934 3300048917 Bacteria 1206
537 Ga0496115_0000022 3300048918 Bacteria 164224
538 Ga0496115_0000027 3300048918 Bacteria 145505
539 Ga0496119_0064063 3300048922 Bacteria 2184
540 Ga0496120_0027513 3300048923 Bacteria 3496
541 Ga0496125_0087147 3300048928 Bacteria 2359
542 Ga0501036_0838948 3300049572 Bacteria 756
543 Ga0501038_0893710 3300049574 Bacteria 656
544 Ga0501039_0070081 3300049575 Bacteria 2724
545 Ga0501040_0776095 3300049576 Bacteria 693
546 Ga0501042_0034840 3300049578 Bacteria 3571
547 Ga0501042_0140933 3300049578 Bacteria 1738
548 Ga0501048_0744711 3300049582 Bacteria 704
549 Ga0501068_0247227 3300049584 Bacteria 1136
550 Ga0501071_1039736 3300049587 Unclassified 633
551 Ga0501072_0297739 3300049588 Bacteria 1282
552 Ga0501075_0206157 3300049591 Bacteria 1500
553 Ga0501076_1024948 3300049592 Bacteria 680
554 Ga0501079_0675985 3300049741 Bacteria 813
555 Ga0501079_0929334 3300049741 Bacteria 685
556 Ga0501081_0167588 3300049743 Bacteria 1585
557 Ga0501081_0330962 3300049743 Bacteria 1121
558 Ga0501272_045735 3300049769 Archaea 596
559 nmdc:mga0n895_375319_c1 3300050512 Bacteria 1439
560 nmdc:mga0a205_1461_c1 3300050515 Bacteria 20140
561 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
562 Ga0495601_0000029 3300053077 Bacteria 111437
563 Ga0495601_0000179 3300053077 Bacteria 33502
564 Ga0495601_0006771 3300053077 Bacteria 6714
565 Ga0495601_0041695 3300053077 Bacteria 2878
566 Ga0495601_0042388 3300053077 Bacteria 2856
567 Ga0495601_0227202 3300053077 Bacteria 1219
568 Ga0495601_0516998 3300053077 Bacteria 769
569 Ga0495601_1070113 3300053077 Unclassified 505
570 Ga0495612_0000115 3300053078 Bacteria 33767
571 Ga0495612_0002233 3300053078 Bacteria 7962
572 Ga0495612_0008755 3300053078 Bacteria 4105
573 Ga0495612_0020013 3300053078 Bacteria 2681
574 Ga0495612_0090788 3300053078 Unclassified 1293
575 Ga0495612_0351598 3300053078 Unclassified 665
576 Ga0495612_0404223 3300053078 Bacteria 621
577 Ga0495655_0000010 3300053083 Bacteria 125615
578 Ga0495655_0106099 3300053083 Bacteria 838
579 Ga0495595_0000007 3300053084 Bacteria 228504
580 Ga0495595_0001355 3300053084 Bacteria 9514
581 Ga0495595_0007157 3300053084 Bacteria 4559
582 Ga0495595_0231618 3300053084 Bacteria 923
583 Ga0495595_0585974 3300053084 Bacteria 570
584 Ga0495619_0000001 3300053085 Bacteria 586054
585 Ga0495619_0000233 3300053085 Bacteria 40638
586 Ga0495619_0000413 3300053085 Bacteria 29033
587 Ga0495619_0001241 3300053085 Bacteria 16706
588 Ga0495619_0010884 3300053085 Bacteria 5724
589 Ga0495619_0033178 3300053085 Bacteria 3352
590 Ga0495619_0078447 3300053085 Bacteria 2220
591 Ga0495619_0137018 3300053085 Bacteria 1684
592 Ga0500566_0009429 3300053094 Bacteria 5768
593 Ga0500641_0001760 3300053096 Bacteria 7670
594 Ga0500650_0317058 3300053098 Bacteria 687
595 Ga0500554_022360 3300053102 Bacteria 1766
596 Ga0500614_002080 3300053123 Bacteria 4572
597 Ga0500628_000039 3300053129 Bacteria 49907
598 Ga0501084_0722328 3300054114 Bacteria 840
599 Ga0501082_0579950 3300060353 Archaea 981
600 Ga0501082_1917150 3300060353 Unclassified 517
601 Ga0530510_0083074 3300061734 Bacteria 2333
602 Ga0530510_0476894 3300061734 Bacteria 945

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0215143 Ga0495584_0215143_244_597 113
2 3300006852 Ga0075433_10939506 Ga0075433_109395062 121
3 3300009148 Ga0105243_11699923 Ga0105243_116999231 121
4 3300025927 Ga0207687_11676517 Ga0207687_116765171 121
5 3300050512 nmdc:mga0n895_375319_c1 nmdc:mga0n895_375319_c1_384_752 121
6 3300005331 Ga0070670_100425650 Ga0070670_1004256501 123
7 3300005337 Ga0070682_100000061 Ga0070682_10000006135 123
8 3300005338 Ga0068868_100000104 Ga0068868_10000010437 123
9 3300005341 Ga0070691_10024493 Ga0070691_100244934 123
10 3300005347 Ga0070668_100006928 Ga0070668_1000069282 123
11 3300005353 Ga0070669_100507436 Ga0070669_1005074362 123
12 3300005354 Ga0070675_100000069 Ga0070675_10000006953 123
13 3300005356 Ga0070674_100000019 Ga0070674_10000001982 123
14 3300005364 Ga0070673_100006768 Ga0070673_1000067682 123
15 3300005367 Ga0070667_100002266 Ga0070667_10000226611 123
16 3300005367 Ga0070667_101546503 Ga0070667_1015465031 123
17 3300005406 Ga0070703_10169785 Ga0070703_101697852 123
18 3300005435 Ga0070714_100036362 Ga0070714_1000363623 123
19 3300005438 Ga0070701_10188915 Ga0070701_101889151 123
20 3300005444 Ga0070694_101460428 Ga0070694_1014604281 123
21 3300005455 Ga0070663_100635651 Ga0070663_1006356512 123
22 3300005457 Ga0070662_100000001 Ga0070662_100000001191 123
23 3300005466 Ga0070685_10000032 Ga0070685_1000003232 123
24 3300005539 Ga0068853_100615476 Ga0068853_1006154762 123
25 3300005547 Ga0070693_100000638 Ga0070693_1000006387 123
26 3300005548 Ga0070665_100216008 Ga0070665_1002160083 123
27 3300005563 Ga0068855_102542366 Ga0068855_1025423661 123
28 3300005578 Ga0068854_100000345 Ga0068854_10000034520 123
29 3300005614 Ga0068856_100003669 Ga0068856_10000366912 123
30 3300005614 Ga0068856_100026420 Ga0068856_1000264202 123
31 3300005614 Ga0068856_100193441 Ga0068856_1001934412 123
32 3300005614 Ga0068856_100829457 Ga0068856_1008294572 123
33 3300005615 Ga0070702_101253603 Ga0070702_1012536031 123
34 3300005616 Ga0068852_100000037 Ga0068852_10000003791 123
35 3300005718 Ga0068866_10000005 Ga0068866_10000005111 123
36 3300005834 Ga0068851_10005227 Ga0068851_100052277 123
37 3300005842 Ga0068858_100093347 Ga0068858_1000933472 123
38 3300005843 Ga0068860_100421948 Ga0068860_1004219482 123
39 3300005844 Ga0068862_100020486 Ga0068862_1000204862 123
40 3300005937 Ga0081455_10001231 Ga0081455_100012312 123
41 3300006058 Ga0075432_10332856 Ga0075432_103328561 123
42 3300006163 Ga0070715_10000008 Ga0070715_10000008175 123
43 3300006237 Ga0097621_100804729 Ga0097621_1008047292 123
44 3300006881 Ga0068865_100000081 Ga0068865_10000008121 123
45 3300009098 Ga0105245_10000249 Ga0105245_100002492 123
46 3300009098 Ga0105245_10019398 Ga0105245_100193987 123
47 3300009101 Ga0105247_10345466 Ga0105247_103454661 123
48 3300009174 Ga0105241_10124872 Ga0105241_101248723 123
49 3300009177 Ga0105248_10000017 Ga0105248_10000017217 123
50 3300009551 Ga0105238_10000016 Ga0105238_10000016181 123
51 3300009553 Ga0105249_10005341 Ga0105249_100053418 123
52 3300010375 Ga0105239_10217724 Ga0105239_102177242 123
53 3300010375 Ga0105239_12098155 Ga0105239_120981552 123
54 3300013104 Ga0157370_10228969 Ga0157370_102289693 123
55 3300013105 Ga0157369_10000105 Ga0157369_1000010588 123
56 3300013296 Ga0157374_10085714 Ga0157374_100857141 123
57 3300013296 Ga0157374_10715480 Ga0157374_107154802 123
58 3300013306 Ga0163162_10302474 Ga0163162_103024742 123
59 3300013307 Ga0157372_10000284 Ga0157372_1000028429 123
60 3300014325 Ga0163163_10365762 Ga0163163_103657622 123
61 3300014968 Ga0157379_10024043 Ga0157379_100240436 123
62 3300014968 Ga0157379_10195594 Ga0157379_101955942 123
63 3300017792 Ga0163161_10000240 Ga0163161_1000024051 123
64 3300017792 Ga0163161_10438438 Ga0163161_104384381 123
65 3300025321 Ga0207656_10002224 Ga0207656_100022248 123
66 3300025885 Ga0207653_10042538 Ga0207653_100425382 123
67 3300025899 Ga0207642_10000005 Ga0207642_10000005316 123
68 3300025901 Ga0207688_10415841 Ga0207688_104158412 123
69 3300025905 Ga0207685_10000012 Ga0207685_10000012173 123
70 3300025911 Ga0207654_10117527 Ga0207654_101175272 123
71 3300025923 Ga0207681_11262422 Ga0207681_112624221 123
72 3300025924 Ga0207694_10000012 Ga0207694_10000012241 123
73 3300025925 Ga0207650_10120890 Ga0207650_101208901 123
74 3300025926 Ga0207659_10001302 Ga0207659_1000130211 123
75 3300025927 Ga0207687_10000106 Ga0207687_100001062 123
76 3300025927 Ga0207687_10010977 Ga0207687_100109772 123
77 3300025929 Ga0207664_10676386 Ga0207664_106763861 123
78 3300025933 Ga0207706_10000003 Ga0207706_10000003140 123
79 3300025937 Ga0207669_10000047 Ga0207669_1000004733 123
80 3300025938 Ga0207704_10000018 Ga0207704_1000001865 123
81 3300025938 Ga0207704_10140066 Ga0207704_101400661 123
82 3300025941 Ga0207711_10000011 Ga0207711_10000011264 123
83 3300025960 Ga0207651_10004033 Ga0207651_100040332 123
84 3300025961 Ga0207712_10007217 Ga0207712_100072172 123
85 3300025972 Ga0207668_10080861 Ga0207668_100808612 123
86 3300025981 Ga0207640_10000077 Ga0207640_1000007719 123
87 3300025986 Ga0207658_10002876 Ga0207658_100028762 123
88 3300026023 Ga0207677_10000479 Ga0207677_1000047917 123
89 3300026035 Ga0207703_10067575 Ga0207703_100675752 123
90 3300026041 Ga0207639_10067249 Ga0207639_100672493 123
91 3300026041 Ga0207639_10633883 Ga0207639_106338831 123
92 3300026067 Ga0207678_11007096 Ga0207678_110070961 123
93 3300026078 Ga0207702_10000419 Ga0207702_1000041934 123
94 3300026078 Ga0207702_10003965 Ga0207702_1000396512 123
95 3300026078 Ga0207702_10603808 Ga0207702_106038082 123
96 3300026078 Ga0207702_10666544 Ga0207702_106665442 123
97 3300026142 Ga0207698_10000015 Ga0207698_10000015213 123
98 3300028379 Ga0268266_10210857 Ga0268266_102108572 123
99 3300028380 Ga0268265_10029147 Ga0268265_100291472 123
100 3300028381 Ga0268264_10293288 Ga0268264_102932882 123
101 3300028381 Ga0268264_12077223 Ga0268264_120772231 123
102 3300035398 Ga0316574_0672238 Ga0316574_0672238_57_428 123
103 3300041505 Ga0451849_1502250 Ga0451849_1502250_47_418 123
104 3300045976 Ga0466967_0000012 Ga0466967_0000012_44491_44862 123
105 3300045976 Ga0466967_2037144 Ga0466967_2037144_149_520 123
106 3300046454 Ga0495592_0001189 Ga0495592_0001189_7171_7542 123
107 3300046459 Ga0495629_0000421 Ga0495629_0000421_33373_33744 123
108 3300046460 Ga0495638_0034123 Ga0495638_0034123_2673_3044 123
109 3300046461 Ga0495641_0065757 Ga0495641_0065757_65_436 123
110 3300046462 Ga0495651_0165995 Ga0495651_0165995_564_935 123
111 3300046463 Ga0495653_0013286 Ga0495653_0013286_5494_5865 123
112 3300046463 Ga0495653_0188759 Ga0495653_0188759_1003_1374 123
113 3300046473 Ga0495582_0000002 Ga0495582_0000002_138733_139104 123
114 3300046507 Ga0495606_0000908 Ga0495606_0000908_31959_32330 123
115 3300046511 Ga0495608_0000346 Ga0495608_0000346_7217_7588 123
116 3300046511 Ga0495608_0010058 Ga0495608_0010058_3275_3646 123
117 3300046515 Ga0495620_0000466 Ga0495620_0000466_15733_16104 123
118 3300046516 Ga0495628_0264828 Ga0495628_0264828_53_424 123
119 3300046523 Ga0495644_0001063 Ga0495644_0001063_9456_9827 123
120 3300046533 Ga0495640_0020319 Ga0495640_0020319_922_1293 123
121 3300046642 Ga0495634_0220485 Ga0495634_0220485_462_833 123
122 3300046660 Ga0495625_0535240 Ga0495625_0535240_39_410 123
123 3300046674 Ga0495588_0000247 Ga0495588_0000247_25064_25435 123
124 3300046678 Ga0495599_0249467 Ga0495599_0249467_396_767 123
125 3300046681 Ga0495647_0000028 Ga0495647_0000028_7265_7636 123
126 3300046681 Ga0495647_0002875 Ga0495647_0002875_4561_4932 123
127 3300046683 Ga0495658_0000001 Ga0495658_0000001_253164_253535 123
128 3300046683 Ga0495658_0015227 Ga0495658_0015227_3493_3864 123
129 3300046689 Ga0495613_0000132 Ga0495613_0000132_34749_35120 123
130 3300046689 Ga0495613_0000690 Ga0495613_0000690_18913_19284 123
131 3300046690 Ga0495624_0000196 Ga0495624_0000196_24844_25215 123
132 3300046809 Ga0495600_0000652 Ga0495600_0000652_627_998 123
133 3300047321 Ga0495676_0006298 Ga0495676_0006298_3421_3792 123
134 3300047321 Ga0495676_0138708 Ga0495676_0138708_343_714 123
135 3300047471 Ga0495684_0604571 Ga0495684_0604571_211_582 123
136 3300047673 Ga0495593_0139664 Ga0495593_0139664_280_651 123
137 3300048088 Ga0495602_0667342 Ga0495602_0667342_302_673 123
138 3300048089 Ga0495614_0169057 Ga0495614_0169057_307_678 123
139 3300048903 Ga0496100_0956553 Ga0496100_0956553_265_636 123
140 3300048911 Ga0496108_0000349 Ga0496108_0000349_10665_11036 123
141 3300048911 Ga0496108_0007713 Ga0496108_0007713_524_895 123
142 3300048912 Ga0496109_0000307 Ga0496109_0000307_10656_11027 123
143 3300048912 Ga0496109_2071452 Ga0496109_2071452_98_469 123
144 3300048913 Ga0496110_0000166 Ga0496110_0000166_5383_5754 123
145 3300048914 Ga0496111_0000046 Ga0496111_0000046_46199_46570 123
146 3300048915 Ga0496112_0025758 Ga0496112_0025758_2506_2877 123
147 3300048916 Ga0496113_0000017 Ga0496113_0000017_10361_10732 123
148 3300048916 Ga0496113_0064188 Ga0496113_0064188_32_403 123
149 3300049578 Ga0501042_0140933 Ga0501042_0140933_230_601 123
150 3300053077 Ga0495601_1070113 Ga0495601_1070113_58_429 123
151 3300053078 Ga0495612_0404223 Ga0495612_0404223_236_607 123
152 3300053084 Ga0495595_0585974 Ga0495595_0585974_79_450 123
153 3300053085 Ga0495619_0010884 Ga0495619_0010884_502_873 123
154 3300053098 Ga0500650_0317058 Ga0500650_0317058_58_429 123
155 3300001977 JGI24746J21847_1000566 JGI24746J21847_10005662 124
156 3300001979 JGI24740J21852_10002767 JGI24740J21852_100027673 124
157 3300001991 JGI24743J22301_10134867 JGI24743J22301_101348671 124
158 3300002074 JGI24748J21848_1000241 JGI24748J21848_10002412 124
159 3300002239 JGI24034J26672_10000120 JGI24034J26672_100001205 124
160 3300002244 JGI24742J22300_10010826 JGI24742J22300_100108261 124
161 3300005329 Ga0070683_100007274 Ga0070683_1000072747 124
162 3300005329 Ga0070683_100010609 Ga0070683_1000106092 124
163 3300005329 Ga0070683_100015665 Ga0070683_1000156652 124
164 3300005329 Ga0070683_100112957 Ga0070683_1001129573 124
165 3300005329 Ga0070683_100126241 Ga0070683_1001262414 124
166 3300005329 Ga0070683_100134601 Ga0070683_1001346013 124
167 3300005333 Ga0070677_10000085 Ga0070677_1000008522 124
168 3300005336 Ga0070680_100215276 Ga0070680_1002152762 124
169 3300005337 Ga0070682_100000009 Ga0070682_10000000948 124
170 3300005337 Ga0070682_100435064 Ga0070682_1004350642 124
171 3300005338 Ga0068868_100000220 Ga0068868_10000022010 124
172 3300005340 Ga0070689_100071524 Ga0070689_1000715242 124
173 3300005340 Ga0070689_100105239 Ga0070689_1001052392 124
174 3300005341 Ga0070691_10000275 Ga0070691_100002752 124
175 3300005341 Ga0070691_10001199 Ga0070691_100011999 124
176 3300005347 Ga0070668_100351240 Ga0070668_1003512402 124
177 3300005355 Ga0070671_100237787 Ga0070671_1002377872 124
178 3300005356 Ga0070674_100000030 Ga0070674_10000003041 124
179 3300005365 Ga0070688_100000053 Ga0070688_10000005335 124
180 3300005365 Ga0070688_100122084 Ga0070688_1001220842 124
181 3300005365 Ga0070688_100908241 Ga0070688_1009082412 124
182 3300005366 Ga0070659_100015340 Ga0070659_1000153406 124
183 3300005366 Ga0070659_100155757 Ga0070659_1001557572 124
184 3300005366 Ga0070659_101140284 Ga0070659_1011402841 124
185 3300005435 Ga0070714_100037035 Ga0070714_1000370352 124
186 3300005436 Ga0070713_100000023 Ga0070713_10000002370 124
187 3300005437 Ga0070710_10409277 Ga0070710_104092772 124
188 3300005438 Ga0070701_10719961 Ga0070701_107199612 124
189 3300005439 Ga0070711_100004129 Ga0070711_1000041295 124
190 3300005439 Ga0070711_100628171 Ga0070711_1006281711 124
191 3300005441 Ga0070700_100167973 Ga0070700_1001679732 124
192 3300005455 Ga0070663_100626614 Ga0070663_1006266142 124
193 3300005458 Ga0070681_10042499 Ga0070681_100424992 124
194 3300005466 Ga0070685_10000086 Ga0070685_1000008625 124
195 3300005466 Ga0070685_10132387 Ga0070685_101323872 124
196 3300005466 Ga0070685_10407577 Ga0070685_104075772 124
197 3300005530 Ga0070679_100000258 Ga0070679_10000025824 124
198 3300005535 Ga0070684_100008110 Ga0070684_1000081104 124
199 3300005535 Ga0070684_100044980 Ga0070684_1000449802 124
200 3300005535 Ga0070684_100080941 Ga0070684_1000809412 124
201 3300005535 Ga0070684_101549075 Ga0070684_1015490751 124
202 3300005539 Ga0068853_100021670 Ga0068853_1000216702 124
203 3300005543 Ga0070672_100000005 Ga0070672_10000000540 124
204 3300005544 Ga0070686_101896915 Ga0070686_1018969151 124
205 3300005545 Ga0070695_101231057 Ga0070695_1012310571 124
206 3300005548 Ga0070665_100000022 Ga0070665_100000022134 124
207 3300005548 Ga0070665_100017640 Ga0070665_1000176408 124
208 3300005548 Ga0070665_100094251 Ga0070665_1000942514 124
209 3300005549 Ga0070704_100331076 Ga0070704_1003310762 124
210 3300005564 Ga0070664_100014728 Ga0070664_1000147282 124
211 3300005564 Ga0070664_100835820 Ga0070664_1008358202 124
212 3300005578 Ga0068854_100029725 Ga0068854_1000297252 124
213 3300005614 Ga0068856_100195633 Ga0068856_1001956332 124
214 3300005614 Ga0068856_101994131 Ga0068856_1019941311 124
215 3300005615 Ga0070702_100198963 Ga0070702_1001989632 124
216 3300005615 Ga0070702_101005917 Ga0070702_1010059172 124
217 3300005616 Ga0068852_100008636 Ga0068852_1000086362 124
218 3300005618 Ga0068864_100000043 Ga0068864_10000004368 124
219 3300005718 Ga0068866_10000382 Ga0068866_1000038220 124
220 3300005718 Ga0068866_10521183 Ga0068866_105211832 124
221 3300005718 Ga0068866_10534891 Ga0068866_105348912 124
222 3300005834 Ga0068851_10020425 Ga0068851_100204252 124
223 3300005840 Ga0068870_10397359 Ga0068870_103973592 124
224 3300005841 Ga0068863_100000229 Ga0068863_1000002292 124
225 3300005841 Ga0068863_100002888 Ga0068863_1000028882 124
226 3300005841 Ga0068863_100268768 Ga0068863_1002687683 124
227 3300005842 Ga0068858_100000017 Ga0068858_100000017131 124
228 3300005842 Ga0068858_100000140 Ga0068858_1000001402 124
229 3300005842 Ga0068858_100045457 Ga0068858_1000454572 124
230 3300005843 Ga0068860_100001002 Ga0068860_1000010029 124
231 3300005843 Ga0068860_100154024 Ga0068860_1001540241 124
232 3300005937 Ga0081455_10374976 Ga0081455_103749762 124
233 3300005983 Ga0081540_1000046 Ga0081540_100004633 124
234 3300005983 Ga0081540_1216159 Ga0081540_12161591 124
235 3300005985 Ga0081539_10001074 Ga0081539_1000107424 124
236 3300006237 Ga0097621_100958826 Ga0097621_1009588262 124
237 3300006358 Ga0068871_100085751 Ga0068871_1000857515 124
238 3300006852 Ga0075433_10007173 Ga0075433_100071737 124
239 3300009098 Ga0105245_10000330 Ga0105245_100003302 124
240 3300009098 Ga0105245_10019372 Ga0105245_100193726 124
241 3300009098 Ga0105245_11347658 Ga0105245_113476582 124
242 3300009101 Ga0105247_10002606 Ga0105247_1000260611 124
243 3300009101 Ga0105247_10828813 Ga0105247_108288131 124
244 3300009148 Ga0105243_10006390 Ga0105243_100063903 124
245 3300009174 Ga0105241_10216916 Ga0105241_102169163 124
246 3300009176 Ga0105242_10000052 Ga0105242_100000527 124
247 3300009176 Ga0105242_10035964 Ga0105242_100359644 124
248 3300009176 Ga0105242_10049788 Ga0105242_100497882 124
249 3300009176 Ga0105242_10249527 Ga0105242_102495272 124
250 3300009553 Ga0105249_10000054 Ga0105249_100000542 124
251 3300010375 Ga0105239_10332280 Ga0105239_103322802 124
252 3300011119 Ga0105246_10269439 Ga0105246_102694392 124
253 3300011119 Ga0105246_10475227 Ga0105246_104752272 124
254 3300013104 Ga0157370_10046483 Ga0157370_100464832 124
255 3300013296 Ga0157374_10000242 Ga0157374_1000024252 124
256 3300013297 Ga0157378_10046947 Ga0157378_100469472 124
257 3300013297 Ga0157378_10052908 Ga0157378_100529085 124
258 3300013297 Ga0157378_10064214 Ga0157378_100642142 124
259 3300013308 Ga0157375_10000620 Ga0157375_100006202 124
260 3300013308 Ga0157375_12661401 Ga0157375_126614011 124
261 3300014325 Ga0163163_10059017 Ga0163163_100590173 124
262 3300014326 Ga0157380_10000178 Ga0157380_1000017836 124
263 3300014326 Ga0157380_10000838 Ga0157380_1000083819 124
264 3300014326 Ga0157380_10102618 Ga0157380_101026182 124
265 3300014326 Ga0157380_10959792 Ga0157380_109597922 124
266 3300014745 Ga0157377_10610981 Ga0157377_106109811 124
267 3300014745 Ga0157377_10632059 Ga0157377_106320591 124
268 3300014968 Ga0157379_10039602 Ga0157379_100396022 124
269 3300014969 Ga0157376_10111428 Ga0157376_101114283 124
270 3300014969 Ga0157376_11151965 Ga0157376_111519652 124
271 3300017792 Ga0163161_10243456 Ga0163161_102434562 124
272 3300020070 Ga0206356_10206281 Ga0206356_102062813 124
273 3300025321 Ga0207656_10008896 Ga0207656_100088962 124
274 3300025893 Ga0207682_10000060 Ga0207682_1000006037 124
275 3300025898 Ga0207692_10563027 Ga0207692_105630272 124
276 3300025899 Ga0207642_10000500 Ga0207642_100005002 124
277 3300025899 Ga0207642_10510342 Ga0207642_105103422 124
278 3300025900 Ga0207710_10000096 Ga0207710_1000009671 124
279 3300025900 Ga0207710_10402869 Ga0207710_104028691 124
280 3300025911 Ga0207654_10165808 Ga0207654_101658083 124
281 3300025912 Ga0207707_10022249 Ga0207707_100222493 124
282 3300025915 Ga0207693_10358157 Ga0207693_103581572 124
283 3300025916 Ga0207663_10002802 Ga0207663_100028022 124
284 3300025916 Ga0207663_10030099 Ga0207663_100300994 124
285 3300025917 Ga0207660_10214982 Ga0207660_102149822 124
286 3300025920 Ga0207649_10000015 Ga0207649_10000015183 124
287 3300025921 Ga0207652_10000196 Ga0207652_1000019622 124
288 3300025927 Ga0207687_10000094 Ga0207687_1000009459 124
289 3300025927 Ga0207687_10011714 Ga0207687_100117142 124
290 3300025927 Ga0207687_10885573 Ga0207687_108855732 124
291 3300025928 Ga0207700_10000003 Ga0207700_1000000370 124
292 3300025929 Ga0207664_10030260 Ga0207664_100302605 124
293 3300025931 Ga0207644_10287996 Ga0207644_102879962 124
294 3300025932 Ga0207690_10010639 Ga0207690_100106391 124
295 3300025932 Ga0207690_10104900 Ga0207690_101049003 124
296 3300025934 Ga0207686_10000035 Ga0207686_10000035123 124
297 3300025934 Ga0207686_10003508 Ga0207686_100035087 124
298 3300025934 Ga0207686_10285331 Ga0207686_102853312 124
299 3300025934 Ga0207686_10549287 Ga0207686_105492872 124
300 3300025935 Ga0207709_10019786 Ga0207709_100197862 124
301 3300025936 Ga0207670_10023085 Ga0207670_100230852 124
302 3300025936 Ga0207670_10088689 Ga0207670_100886893 124
303 3300025937 Ga0207669_10000029 Ga0207669_100000297 124
304 3300025940 Ga0207691_10000028 Ga0207691_1000002890 124
305 3300025944 Ga0207661_10005996 Ga0207661_100059967 124
306 3300025944 Ga0207661_10013598 Ga0207661_100135982 124
307 3300025944 Ga0207661_10099391 Ga0207661_100993911 124
308 3300025944 Ga0207661_10101096 Ga0207661_101010963 124
309 3300025944 Ga0207661_10177052 Ga0207661_101770522 124
310 3300025945 Ga0207679_10013592 Ga0207679_100135924 124
311 3300025945 Ga0207679_10700427 Ga0207679_107004272 124
312 3300025949 Ga0207667_10771052 Ga0207667_107710522 124
313 3300025961 Ga0207712_10000032 Ga0207712_10000032162 124
314 3300025972 Ga0207668_10666277 Ga0207668_106662771 124
315 3300025981 Ga0207640_10010886 Ga0207640_100108867 124
316 3300025986 Ga0207658_10570280 Ga0207658_105702802 124
317 3300026023 Ga0207677_10001833 Ga0207677_100018332 124
318 3300026035 Ga0207703_10000020 Ga0207703_10000020187 124
319 3300026035 Ga0207703_10000030 Ga0207703_10000030129 124
320 3300026035 Ga0207703_10039734 Ga0207703_100397342 124
321 3300026041 Ga0207639_10987106 Ga0207639_109871062 124
322 3300026067 Ga0207678_11676297 Ga0207678_116762972 124
323 3300026075 Ga0207708_10189714 Ga0207708_101897142 124
324 3300026075 Ga0207708_10933949 Ga0207708_109339492 124
325 3300026078 Ga0207702_10031122 Ga0207702_100311222 124
326 3300026088 Ga0207641_10001796 Ga0207641_1000179619 124
327 3300026088 Ga0207641_10002314 Ga0207641_100023147 124
328 3300026088 Ga0207641_10034705 Ga0207641_100347055 124
329 3300026089 Ga0207648_10001072 Ga0207648_1000107212 124
330 3300026095 Ga0207676_10000042 Ga0207676_1000004299 124
331 3300026118 Ga0207675_100061701 Ga0207675_1000617012 124
332 3300026121 Ga0207683_10013197 Ga0207683_100131973 124
333 3300026121 Ga0207683_10356576 Ga0207683_103565761 124
334 3300026142 Ga0207698_10008081 Ga0207698_100080812 124
335 3300028379 Ga0268266_10000029 Ga0268266_10000029317 124
336 3300028379 Ga0268266_10001186 Ga0268266_100011868 124
337 3300028379 Ga0268266_10038746 Ga0268266_100387462 124
338 3300028379 Ga0268266_10986753 Ga0268266_109867531 124
339 3300028381 Ga0268264_10003675 Ga0268264_100036758 124
340 3300028381 Ga0268264_10072728 Ga0268264_100727284 124
341 3300028556 Ga0265337_1000101 Ga0265337_100010117 124
342 3300028558 Ga0265326_10000033 Ga0265326_1000003390 124
343 3300028563 Ga0265319_1000010 Ga0265319_1000010164 124
344 3300028573 Ga0265334_10098676 Ga0265334_100986762 124
345 3300028653 Ga0265323_10263201 Ga0265323_102632011 124
346 3300028654 Ga0265322_10000005 Ga0265322_1000000544 124
347 3300028800 Ga0265338_10000051 Ga0265338_1000005157 124
348 3300028800 Ga0265338_11001490 Ga0265338_110014901 124
349 3300029957 Ga0265324_10000207 Ga0265324_1000020728 124
350 3300029957 Ga0265324_10075613 Ga0265324_100756132 124
351 3300031238 Ga0265332_10034937 Ga0265332_100349372 124
352 3300031239 Ga0265328_10001194 Ga0265328_1000119412 124
353 3300031240 Ga0265320_10000010 Ga0265320_1000001090 124
354 3300031241 Ga0265325_10005471 Ga0265325_100054715 124
355 3300031242 Ga0265329_10008633 Ga0265329_100086332 124
356 3300031249 Ga0265339_10016352 Ga0265339_100163527 124
357 3300031250 Ga0265331_10000869 Ga0265331_1000086923 124
358 3300031250 Ga0265331_10188553 Ga0265331_101885532 124
359 3300031251 Ga0265327_10000040 Ga0265327_10000040217 124
360 3300031344 Ga0265316_10068127 Ga0265316_100681274 124
361 3300031711 Ga0265314_10000208 Ga0265314_1000020824 124
362 3300031712 Ga0265342_10378692 Ga0265342_103786922 124
363 3300031712 Ga0265342_10628040 Ga0265342_106280402 124
364 3300032126 Ga0307415_100020148 Ga0307415_1000201482 124
365 3300035117 Ga0373953_0182304 Ga0373953_0182304_466_840 124
366 3300035118 Ga0373954_0157931 Ga0373954_0157931_631_1005 124
367 3300035119 Ga0373956_0327061 Ga0373956_0327061_129_518 124
368 3300035170 Ga0373943_0791806 Ga0373943_0791806_37_426 124
369 3300035172 Ga0373955_0129684 Ga0373955_0129684_912_1286 124
370 3300035692 Ga0373935_0848864 Ga0373935_0848864_112_486 124
371 3300036401 Ga0373937_0015203 Ga0373937_0015203_6247_6621 124
372 3300036401 Ga0373937_0463516 Ga0373937_0463516_699_1073 124
373 3300036401 Ga0373937_0595463 Ga0373937_0595463_661_1035 124
374 3300036401 Ga0373937_0759043 Ga0373937_0759043_107_487 124
375 3300036401 Ga0373937_1195500 Ga0373937_1195500_114_488 124
376 3300037466 Ga0395898_1290253 Ga0395898_1290253_82_507 124
377 3300041451 Ga0451791_0052506 Ga0451791_0052506_728_1102 124
378 3300041459 Ga0451800_0357192 Ga0451800_0357192_117_491 124
379 3300041459 Ga0451800_0629083 Ga0451800_0629083_51_425 124
380 3300041463 Ga0451804_0369380 Ga0451804_0369380_163_537 124
381 3300041486 Ga0451807_0497514 Ga0451807_0497514_1193_1567 124
382 3300041486 Ga0451807_1858638 Ga0451807_1858638_428_802 124
383 3300041492 Ga0451835_0782939 Ga0451835_0782939_171_545 124
384 3300041501 Ga0451845_0189617 Ga0451845_0189617_21_395 124
385 3300041505 Ga0451849_0745045 Ga0451849_0745045_207_581 124
386 3300041512 Ga0451853_1500978 Ga0451853_1500978_905_1279 124
387 3300041512 Ga0451853_1723538 Ga0451853_1723538_2275_2649 124
388 3300041512 Ga0451853_3840077 Ga0451853_3840077_755_1129 124
389 3300044694 Ga0466963_0000012 Ga0466963_0000012_9251_9625 124
390 3300044694 Ga0466963_0044188 Ga0466963_0044188_904_1278 124
391 3300044901 Ga0466960_0163099 Ga0466960_0163099_579_953 124
392 3300044901 Ga0466960_0208636 Ga0466960_0208636_664_1038 124
393 3300045976 Ga0466967_0027403 Ga0466967_0027403_3113_3487 124
394 3300046454 Ga0495592_0374756 Ga0495592_0374756_395_769 124
395 3300046454 Ga0495592_0696854 Ga0495592_0696854_24_398 124
396 3300046455 Ga0495603_0000861 Ga0495603_0000861_9512_9886 124
397 3300046455 Ga0495603_0007243 Ga0495603_0007243_5370_5744 124
398 3300046459 Ga0495629_0018857 Ga0495629_0018857_1628_2002 124
399 3300046459 Ga0495629_0033550 Ga0495629_0033550_2355_2744 124
400 3300046459 Ga0495629_0519749 Ga0495629_0519749_107_481 124
401 3300046461 Ga0495641_0000440 Ga0495641_0000440_530_904 124
402 3300046461 Ga0495641_0207533 Ga0495641_0207533_107_481 124
403 3300046463 Ga0495653_0093416 Ga0495653_0093416_1474_1848 124
404 3300046463 Ga0495653_0165543 Ga0495653_0165543_33_407 124
405 3300046463 Ga0495653_0259344 Ga0495653_0259344_656_1030 124
406 3300046475 Ga0495639_0027611 Ga0495639_0027611_1779_2153 124
407 3300046476 Ga0495662_0000130 Ga0495662_0000130_7199_7573 124
408 3300046476 Ga0495662_0002551 Ga0495662_0002551_4790_5164 124
409 3300046476 Ga0495662_0061446 Ga0495662_0061446_1170_1544 124
410 3300046477 Ga0495664_0312191 Ga0495664_0312191_145_519 124
411 3300046499 Ga0495594_0000012 Ga0495594_0000012_9800_10174 124
412 3300046511 Ga0495608_0000013 Ga0495608_0000013_214189_214563 124
413 3300046511 Ga0495608_0052814 Ga0495608_0052814_1672_2046 124
414 3300046514 Ga0495618_0000218 Ga0495618_0000218_16153_16527 124
415 3300046516 Ga0495628_0001008 Ga0495628_0001008_3372_3746 124
416 3300046516 Ga0495628_0014578 Ga0495628_0014578_2382_2756 124
417 3300046516 Ga0495628_0051007 Ga0495628_0051007_2558_2932 124
418 3300046516 Ga0495628_0126513 Ga0495628_0126513_1160_1552 124
419 3300046516 Ga0495628_0137629 Ga0495628_0137629_734_1108 124
420 3300046516 Ga0495628_0233724 Ga0495628_0233724_38_427 124
421 3300046517 Ga0495630_0001724 Ga0495630_0001724_7562_7936 124
422 3300046517 Ga0495630_0003792 Ga0495630_0003792_9422_9811 124
423 3300046517 Ga0495630_0028143 Ga0495630_0028143_515_889 124
424 3300046517 Ga0495630_0172751 Ga0495630_0172751_1175_1549 124
425 3300046517 Ga0495630_0360763 Ga0495630_0360763_564_938 124
426 3300046518 Ga0495631_0104808 Ga0495631_0104808_462_836 124
427 3300046520 Ga0495637_0062760 Ga0495637_0062760_44_418 124
428 3300046529 Ga0495652_0000009 Ga0495652_0000009_5058_5432 124
429 3300046529 Ga0495652_0040087 Ga0495652_0040087_3504_3878 124
430 3300046529 Ga0495652_0551287 Ga0495652_0551287_168_557 124
431 3300046531 Ga0495665_0343336 Ga0495665_0343336_14_424 124
432 3300046533 Ga0495640_0569502 Ga0495640_0569502_213_587 124
433 3300046535 Ga0495586_0000359 Ga0495586_0000359_991_1365 124
434 3300046535 Ga0495586_0229640 Ga0495586_0229640_263_652 124
435 3300046536 Ga0495587_0011918 Ga0495587_0011918_3284_3658 124
436 3300046536 Ga0495587_0042253 Ga0495587_0042253_627_1001 124
437 3300046536 Ga0495587_0115195 Ga0495587_0115195_735_1109 124
438 3300046539 Ga0495621_0025134 Ga0495621_0025134_1503_1877 124
439 3300046543 Ga0495645_0027561 Ga0495645_0027561_207_581 124
440 3300046543 Ga0495645_0054850 Ga0495645_0054850_28_408 124
441 3300046557 Ga0495622_0000076 Ga0495622_0000076_43048_43422 124
442 3300046558 Ga0495633_0305168 Ga0495633_0305168_267_641 124
443 3300046559 Ga0495667_0000019 Ga0495667_0000019_148788_149162 124
444 3300046559 Ga0495667_0128417 Ga0495667_0128417_220_594 124
445 3300046615 Ga0495656_0000151 Ga0495656_0000151_18412_18786 124
446 3300046642 Ga0495634_0001012 Ga0495634_0001012_21809_22183 124
447 3300046642 Ga0495634_0022565 Ga0495634_0022565_3453_3827 124
448 3300046642 Ga0495634_0033575 Ga0495634_0033575_1288_1677 124
449 3300046642 Ga0495634_0073488 Ga0495634_0073488_1789_2163 124
450 3300046660 Ga0495625_0000395 Ga0495625_0000395_26615_26989 124
451 3300046663 Ga0495635_0000017 Ga0495635_0000017_144530_144910 124
452 3300046663 Ga0495635_0282436 Ga0495635_0282436_358_732 124
453 3300046663 Ga0495635_0469335 Ga0495635_0469335_240_614 124
454 3300046675 Ga0495657_0000003 Ga0495657_0000003_265388_265762 124
455 3300046675 Ga0495657_0055870 Ga0495657_0055870_188_562 124
456 3300046675 Ga0495657_0064266 Ga0495657_0064266_53_442 124
457 3300046675 Ga0495657_0223041 Ga0495657_0223041_521_895 124
458 3300046678 Ga0495599_0031576 Ga0495599_0031576_848_1222 124
459 3300046678 Ga0495599_0670832 Ga0495599_0670832_114_488 124
460 3300046678 Ga0495599_0688971 Ga0495599_0688971_187_561 124
461 3300046679 Ga0495623_0125714 Ga0495623_0125714_208_582 124
462 3300046681 Ga0495647_0029830 Ga0495647_0029830_204_578 124
463 3300046684 Ga0495669_0000181 Ga0495669_0000181_33568_33942 124
464 3300046684 Ga0495669_0009025 Ga0495669_0009025_3079_3453 124
465 3300046689 Ga0495613_0040693 Ga0495613_0040693_2658_3032 124
466 3300046689 Ga0495613_0082962 Ga0495613_0082962_958_1347 124
467 3300046690 Ga0495624_0002294 Ga0495624_0002294_4943_5317 124
468 3300046690 Ga0495624_0064053 Ga0495624_0064053_1756_2145 124
469 3300046690 Ga0495624_0190003 Ga0495624_0190003_168_542 124
470 3300046691 Ga0495670_0010732 Ga0495670_0010732_3783_4157 124
471 3300046809 Ga0495600_0047087 Ga0495600_0047087_2151_2525 124
472 3300046809 Ga0495600_0100908 Ga0495600_0100908_542_916 124
473 3300046809 Ga0495600_0426297 Ga0495600_0426297_134_508 124
474 3300047315 Ga0495581_0045133 Ga0495581_0045133_410_784 124
475 3300047317 Ga0495604_0000104 Ga0495604_0000104_38579_38953 124
476 3300047317 Ga0495604_0000527 Ga0495604_0000527_31107_31481 124
477 3300047319 Ga0495674_0000024 Ga0495674_0000024_21811_22185 124
478 3300047319 Ga0495674_0319263 Ga0495674_0319263_186_575 124
479 3300047320 Ga0495672_0101297 Ga0495672_0101297_904_1278 124
480 3300047321 Ga0495676_0031967 Ga0495676_0031967_969_1343 124
481 3300047322 Ga0495680_0001363 Ga0495680_0001363_16782_17156 124
482 3300047322 Ga0495680_0007564 Ga0495680_0007564_7126_7500 124
483 3300047322 Ga0495680_0011541 Ga0495680_0011541_4905_5291 124
484 3300047322 Ga0495680_0193046 Ga0495680_0193046_131_520 124
485 3300047322 Ga0495680_0254627 Ga0495680_0254627_523_897 124
486 3300047322 Ga0495680_0470572 Ga0495680_0470572_343_717 124
487 3300047322 Ga0495680_0527743 Ga0495680_0527743_346_720 124
488 3300047444 Ga0495675_0000094 Ga0495675_0000094_13919_14293 124
489 3300047446 Ga0495679_012187 Ga0495679_012187_2237_2611 124
490 3300047446 Ga0495679_083779 Ga0495679_083779_122_532 124
491 3300047447 Ga0495685_074866 Ga0495685_074866_633_1019 124
492 3300047472 Ga0495686_0022374 Ga0495686_0022374_1059_1433 124
493 3300047673 Ga0495593_0048881 Ga0495593_0048881_1122_1496 124
494 3300048088 Ga0495602_0001025 Ga0495602_0001025_26264_26671 124
495 3300048903 Ga0496100_0000006 Ga0496100_0000006_72917_73291 124
496 3300048903 Ga0496100_0000019 Ga0496100_0000019_30223_30597 124
497 3300048904 Ga0496101_0000005 Ga0496101_0000005_30223_30597 124
498 3300048904 Ga0496101_0000009 Ga0496101_0000009_72917_73291 124
499 3300048905 Ga0496102_0000438 Ga0496102_0000438_42269_42643 124
500 3300048905 Ga0496102_0025372 Ga0496102_0025372_3162_3536 124
501 3300048906 Ga0496103_0000001 Ga0496103_0000001_638186_638560 124
502 3300048906 Ga0496103_0470968 Ga0496103_0470968_156_530 124
503 3300048907 Ga0496104_0000008 Ga0496104_0000008_259841_260221 124
504 3300048907 Ga0496104_0000010 Ga0496104_0000010_405932_406306 124
505 3300048907 Ga0496104_0015865 Ga0496104_0015865_2018_2392 124
506 3300048907 Ga0496104_0059279 Ga0496104_0059279_1569_1943 124
507 3300048907 Ga0496104_0077504 Ga0496104_0077504_130_504 124
508 3300048907 Ga0496104_0798945 Ga0496104_0798945_283_657 124
509 3300048908 Ga0496105_0000003 Ga0496105_0000003_259841_260221 124
510 3300048908 Ga0496105_0000005 Ga0496105_0000005_405932_406306 124
511 3300048908 Ga0496105_0000386 Ga0496105_0000386_22504_22878 124
512 3300048908 Ga0496105_0153180 Ga0496105_0153180_1242_1616 124
513 3300048909 Ga0496106_0000064 Ga0496106_0000064_53815_54189 124
514 3300048909 Ga0496106_0000137 Ga0496106_0000137_29381_29755 124
515 3300048909 Ga0496106_0000156 Ga0496106_0000156_30514_30888 124
516 3300048910 Ga0496107_0000002 Ga0496107_0000002_289842_290216 124
517 3300048910 Ga0496107_0000004 Ga0496107_0000004_30440_30814 124
518 3300048910 Ga0496107_1312216 Ga0496107_1312216_54_428 124
519 3300048911 Ga0496108_0000004 Ga0496108_0000004_312032_312406 124
520 3300048911 Ga0496108_0009268 Ga0496108_0009268_2066_2440 124
521 3300048911 Ga0496108_0047519 Ga0496108_0047519_2736_3110 124
522 3300048911 Ga0496108_0499702 Ga0496108_0499702_155_529 124
523 3300048912 Ga0496109_0000011 Ga0496109_0000011_83295_83669 124
524 3300048912 Ga0496109_0000031 Ga0496109_0000031_158245_158619 124
525 3300048912 Ga0496109_0006693 Ga0496109_0006693_2061_2435 124
526 3300048912 Ga0496109_0276207 Ga0496109_0276207_429_803 124
527 3300048912 Ga0496109_0319107 Ga0496109_0319107_178_552 124
528 3300048912 Ga0496109_0827302 Ga0496109_0827302_84_458 124
529 3300048913 Ga0496110_0028735 Ga0496110_0028735_2899_3273 124
530 3300048913 Ga0496110_0035382 Ga0496110_0035382_2199_2573 124
531 3300048913 Ga0496110_0105349 Ga0496110_0105349_1645_2019 124
532 3300048914 Ga0496111_0457959 Ga0496111_0457959_395_769 124
533 3300048914 Ga0496111_0500529 Ga0496111_0500529_461_835 124
534 3300048914 Ga0496111_0706136 Ga0496111_0706136_226_600 124
535 3300048915 Ga0496112_0000026 Ga0496112_0000026_143189_143563 124
536 3300048915 Ga0496112_0147714 Ga0496112_0147714_606_980 124
537 3300048915 Ga0496112_1414648 Ga0496112_1414648_116_490 124
538 3300048916 Ga0496113_0013671 Ga0496113_0013671_1271_1645 124
539 3300048916 Ga0496113_0312440 Ga0496113_0312440_470_844 124
540 3300048916 Ga0496113_0521745 Ga0496113_0521745_341_715 124
541 3300048917 Ga0496114_0000003 Ga0496114_0000003_386329_386733 124
542 3300048917 Ga0496114_0115091 Ga0496114_0115091_1554_1928 124
543 3300048917 Ga0496114_0405934 Ga0496114_0405934_256_630 124
544 3300048918 Ga0496115_0000022 Ga0496115_0000022_83539_83913 124
545 3300048918 Ga0496115_0000027 Ga0496115_0000027_112616_113020 124
546 3300048922 Ga0496119_0064063 Ga0496119_0064063_649_1023 124
547 3300048923 Ga0496120_0027513 Ga0496120_0027513_1670_2044 124
548 3300048928 Ga0496125_0087147 Ga0496125_0087147_692_1066 124
549 3300049572 Ga0501036_0838948 Ga0501036_0838948_209_583 124
550 3300049574 Ga0501038_0893710 Ga0501038_0893710_162_536 124
551 3300049575 Ga0501039_0070081 Ga0501039_0070081_586_960 124
552 3300049576 Ga0501040_0776095 Ga0501040_0776095_193_567 124
553 3300049578 Ga0501042_0034840 Ga0501042_0034840_3072_3491 124
554 3300049582 Ga0501048_0744711 Ga0501048_0744711_83_457 124
555 3300049584 Ga0501068_0247227 Ga0501068_0247227_662_1036 124
556 3300049587 Ga0501071_1039736 Ga0501071_1039736_37_423 124
557 3300049588 Ga0501072_0297739 Ga0501072_0297739_883_1257 124
558 3300049591 Ga0501075_0206157 Ga0501075_0206157_1064_1438 124
559 3300049592 Ga0501076_1024948 Ga0501076_1024948_127_501 124
560 3300049741 Ga0501079_0675985 Ga0501079_0675985_147_521 124
561 3300049741 Ga0501079_0929334 Ga0501079_0929334_95_469 124
562 3300049743 Ga0501081_0167588 Ga0501081_0167588_413_787 124
563 3300049743 Ga0501081_0330962 Ga0501081_0330962_541_915 124
564 3300049769 Ga0501272_045735 Ga0501272_045735_42_416 124
565 3300050515 nmdc:mga0a205_1461_c1 nmdc:mga0a205_1461_c1_11037_11411 124
566 3300050515 nmdc:mga0a205_4_c1 nmdc:mga0a205_4_c1_38829_39239 124
567 3300053077 Ga0495601_0000029 Ga0495601_0000029_15367_15741 124
568 3300053077 Ga0495601_0000179 Ga0495601_0000179_32384_32758 124
569 3300053077 Ga0495601_0006771 Ga0495601_0006771_4222_4611 124
570 3300053077 Ga0495601_0041695 Ga0495601_0041695_576_950 124
571 3300053077 Ga0495601_0042388 Ga0495601_0042388_2188_2562 124
572 3300053077 Ga0495601_0227202 Ga0495601_0227202_394_768 124
573 3300053077 Ga0495601_0516998 Ga0495601_0516998_122_496 124
574 3300053078 Ga0495612_0000115 Ga0495612_0000115_4754_5128 124
575 3300053078 Ga0495612_0002233 Ga0495612_0002233_2153_2545 124
576 3300053078 Ga0495612_0008755 Ga0495612_0008755_2445_2819 124
577 3300053078 Ga0495612_0020013 Ga0495612_0020013_1361_1735 124
578 3300053078 Ga0495612_0090788 Ga0495612_0090788_482_856 124
579 3300053078 Ga0495612_0351598 Ga0495612_0351598_18_392 124
580 3300053083 Ga0495655_0000010 Ga0495655_0000010_26919_27293 124
581 3300053083 Ga0495655_0106099 Ga0495655_0106099_436_810 124
582 3300053084 Ga0495595_0000007 Ga0495595_0000007_214212_214586 124
583 3300053084 Ga0495595_0001355 Ga0495595_0001355_7327_7701 124
584 3300053084 Ga0495595_0007157 Ga0495595_0007157_322_729 124
585 3300053084 Ga0495595_0231618 Ga0495595_0231618_292_666 124
586 3300053085 Ga0495619_0000001 Ga0495619_0000001_302096_302470 124
587 3300053085 Ga0495619_0000233 Ga0495619_0000233_16549_16950 124
588 3300053085 Ga0495619_0000413 Ga0495619_0000413_24432_24821 124
589 3300053085 Ga0495619_0001241 Ga0495619_0001241_2414_2788 124
590 3300053085 Ga0495619_0033178 Ga0495619_0033178_1722_2111 124
591 3300053085 Ga0495619_0078447 Ga0495619_0078447_949_1323 124
592 3300053085 Ga0495619_0137018 Ga0495619_0137018_902_1276 124
593 3300053094 Ga0500566_0009429 Ga0500566_0009429_2744_3118 124
594 3300053096 Ga0500641_0001760 Ga0500641_0001760_3898_4272 124
595 3300053102 Ga0500554_022360 Ga0500554_022360_1238_1711 124
596 3300053123 Ga0500614_002080 Ga0500614_002080_3697_4071 124
597 3300053129 Ga0500628_000039 Ga0500628_000039_17562_17936 124
598 3300054114 Ga0501084_0722328 Ga0501084_0722328_288_662 124
599 3300060353 Ga0501082_0579950 Ga0501082_0579950_588_962 124
600 3300060353 Ga0501082_1917150 Ga0501082_1917150_71_460 124
601 3300061734 Ga0530510_0083074 Ga0530510_0083074_1678_2052 124
602 3300061734 Ga0530510_0476894 Ga0530510_0476894_398_787 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

39

110

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8987 33 112
8awp-assembly1.cif.gz_A crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) 0.8925 6 111
8awp-assembly1.cif.gz_B crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) 0.8853 6 110
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8819 6 116
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8801 11 112
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9048 33 112 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8922 18 112 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8874 21 112 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.885 32 112 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8742 18 112 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1M3BCV7-F1-model_v4 Cupin type-2 domain-containing protein 0.9698 16 124
AF-A0A1M3BCV7-F1-model_v4 Cupin type-2 domain-containing protein 0.9612 16 124
AF-I4EK96-F1-model_v4 Cupin 2 conserved barrel domain protein 0.9571 36 111
AF-A0A538K3L0-F1-model_v4 Cupin domain-containing protein 0.943 24 124
AF-A0A2V6W9G6-F1-model_v4 Cupin type-2 domain-containing protein 0.9373 33 115

Feature Viewer

pLDDT pTM Quality
92.71 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map