F467881

General Info

Members Datasets Scaffolds Average Seq Length
599 261 1198 433

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10070644|Ga0207704_100706442
Length 458
Sequence VSLHPTKTPSAAEVLAASNREIPKSLKTATLALFAIGAAIFLIGLFAAPDRAWRAFHANWLFFAVLSHAGVVFAAVQRVTTARWSRAVIRFMEAYVAFLPVAFVFLLLTLTIGRGHVFWWAHETPPNPEKATYFNPAFITIRDIVVFGLIVWLSTWYIYTSLRLDVGRIPEWGASWAANLRARMRNGFGEERREIHSTHSLQGKLSVLMVALFAIGWSVLSWDLSMGLSAHFQSTLYSWWFFMGGWLCALSLFALLVLAWSRFLNTADGLIQERHFHDIGKLVFAFTAFWGYLTFSQFLVIWYGNMPEETHFFFLRMSQPWVKVTVSVAVLMFVIPFFGLLSKTAKIYTPAMTLLALCSIIGLWLQRYVEIYPSIYATSAGEHAVEAGQTAAAATAHLPFGLYEVGVTLGFLGLWGVSYLAFMNAFPRMRVFMLTSPFRDEVQVPVNPDTMEPLPAHE

Samples

Sample ID Description Type Environment
1 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
247 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
248 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
249 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.34
Rhizosphere 98
Stem 0
Stem Tuber 0
Unclassified 6.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207704_10070644 3300025938 Bacteria 2212
2 JGI25406J46586_10013506 3300003203 Unclassified 3504
3 Ga0065712_10094122 3300005290 Bacteria 2267
4 Ga0065715_10092686 3300005293 Bacteria 4988
5 Ga0065715_10099018 3300005293 Bacteria 3469
6 Ga0070658_10002623 3300005327 Bacteria 14975
7 Ga0070658_10007002 3300005327 Bacteria 9105
8 Ga0070658_10061408 3300005327 Bacteria 3062
9 Ga0070676_10002054 3300005328 Bacteria 10238
10 Ga0070676_10012252 3300005328 Bacteria 4678
11 Ga0070676_10016789 3300005328 Bacteria 4047
12 Ga0070676_10031200 3300005328 Unclassified 3044
13 Ga0070683_100002730 3300005329 Bacteria 14090
14 Ga0070683_100011975 3300005329 Bacteria 7524
15 Ga0070683_100063742 3300005329 Unclassified 3429
16 Ga0070683_100074339 3300005329 Bacteria 3174
17 Ga0070683_100077853 3300005329 Bacteria 3101
18 Ga0070683_100083512 3300005329 Bacteria 2992
19 Ga0070683_100178370 3300005329 Bacteria 2016
20 Ga0070683_100192887 3300005329 Unclassified 1935
21 Ga0070683_100228805 3300005329 Bacteria 1768
22 Ga0070690_100064613 3300005330 Bacteria 2364
23 Ga0070690_100090301 3300005330 Bacteria 2017
24 Ga0070670_100007021 3300005331 Bacteria 9543
25 Ga0070670_100009757 3300005331 Bacteria 8198
26 Ga0070670_100012000 3300005331 Bacteria 7411
27 Ga0068869_100003499 3300005334 Bacteria 9622
28 Ga0068869_100006384 3300005334 Bacteria 7474
29 Ga0070666_10189252 3300005335 Bacteria 1446
30 Ga0070680_100004251 3300005336 Bacteria 10752
31 Ga0070680_100006273 3300005336 Bacteria 9022
32 Ga0070680_100021528 3300005336 Bacteria 5125
33 Ga0070680_100100854 3300005336 Bacteria 2396
34 Ga0070682_100001044 3300005337 Bacteria 16013
35 Ga0070682_100001257 3300005337 Bacteria 14394
36 Ga0070682_100013735 3300005337 Bacteria 4668
37 Ga0068868_100002367 3300005338 Bacteria 13049
38 Ga0068868_100010210 3300005338 Bacteria 6787
39 Ga0068868_100023432 3300005338 Bacteria 4672
40 Ga0070660_100040372 3300005339 Bacteria 3551
41 Ga0070660_100041003 3300005339 Bacteria 3526
42 Ga0070660_100117116 3300005339 Bacteria 2124
43 Ga0070660_100170079 3300005339 Bacteria 1760
44 Ga0070689_100084256 3300005340 Bacteria 2498
45 Ga0070689_100190946 3300005340 Bacteria 1668
46 Ga0070687_100012248 3300005343 Bacteria 3781
47 Ga0070687_100036604 3300005343 Bacteria 2447
48 Ga0070687_100037261 3300005343 Unclassified 2430
49 Ga0070661_100003156 3300005344 Bacteria 11341
50 Ga0070661_100007522 3300005344 Bacteria 7514
51 Ga0070661_100020402 3300005344 Bacteria 4725
52 Ga0070661_100022175 3300005344 Bacteria 4544
53 Ga0070661_100089090 3300005344 Bacteria 2285
54 Ga0070692_10020363 3300005345 Unclassified 3216
55 Ga0070692_10026534 3300005345 Bacteria 2864
56 Ga0070692_10031272 3300005345 Bacteria 2667
57 Ga0070692_10035621 3300005345 Unclassified 2521
58 Ga0070668_100033912 3300005347 Bacteria 3890
59 Ga0070669_100000283 3300005353 Bacteria 40240
60 Ga0070669_100008212 3300005353 Bacteria 7456
61 Ga0070669_100012413 3300005353 Bacteria 6044
62 Ga0070675_100002689 3300005354 Bacteria 13361
63 Ga0070675_100006502 3300005354 Bacteria 8975
64 Ga0070675_100039350 3300005354 Bacteria 3858
65 Ga0070675_100110006 3300005354 Bacteria 2330
66 Ga0070674_100008707 3300005356 Bacteria 6053
67 Ga0070674_100037595 3300005356 Bacteria 3257
68 Ga0070688_100095570 3300005365 Unclassified 1951
69 Ga0070659_100011561 3300005366 Bacteria 6532
70 Ga0070659_100013382 3300005366 Bacteria 6104
71 Ga0070659_100048807 3300005366 Bacteria 3326
72 Ga0070667_100236886 3300005367 Bacteria 1629
73 Ga0070709_10007294 3300005434 Bacteria 6058
74 Ga0070714_100005061 3300005435 Bacteria 10030
75 Ga0070714_100015039 3300005435 Bacteria 6221
76 Ga0070714_100025566 3300005435 Bacteria 4873
77 Ga0070714_100027946 3300005435 Bacteria 4674
78 Ga0070713_100000345 3300005436 Bacteria 30173
79 Ga0070713_100183044 3300005436 Unclassified 1884
80 Ga0070710_10107781 3300005437 Unclassified 1669
81 Ga0070700_100004131 3300005441 Bacteria 7569
82 Ga0070700_100071567 3300005441 Bacteria 2214
83 Ga0070708_100000035 3300005445 Bacteria 86305
84 Ga0070708_100000576 3300005445 Bacteria 27492
85 Ga0070708_100036562 3300005445 Bacteria 4283
86 Ga0070678_100018745 3300005456 Bacteria 4493
87 Ga0070662_100005673 3300005457 Bacteria 7990
88 Ga0070681_10002263 3300005458 Bacteria 17579
89 Ga0070681_10006159 3300005458 Bacteria 11653
90 Ga0070681_10009188 3300005458 Bacteria 9716
91 Ga0070681_10014942 3300005458 Bacteria 7720
92 Ga0070681_10072379 3300005458 Bacteria 3410
93 Ga0070681_10090800 3300005458 Bacteria 3004
94 Ga0070681_10134058 3300005458 Bacteria 2408
95 Ga0070681_10152790 3300005458 Bacteria 2234
96 Ga0068867_100021734 3300005459 Bacteria 4580
97 Ga0070685_10037404 3300005466 Bacteria 2749
98 Ga0070685_10057120 3300005466 Bacteria 2271
99 Ga0070706_100073164 3300005467 Bacteria 3172
100 Ga0070706_100105213 3300005467 Bacteria 2625
101 Ga0070707_100020055 3300005468 Bacteria 6304
102 Ga0070698_100013538 3300005471 Bacteria 8635
103 Ga0070698_100092097 3300005471 Bacteria 3012
104 Ga0070698_100118896 3300005471 Bacteria 2604
105 Ga0070699_100018479 3300005518 Bacteria 5987
106 Ga0070699_100027658 3300005518 Bacteria 4891
107 Ga0070679_100000347 3300005530 Bacteria 39328
108 Ga0070679_100000771 3300005530 Bacteria 27790
109 Ga0070679_100005458 3300005530 Bacteria 11785
110 Ga0070679_100007141 3300005530 Bacteria 10426
111 Ga0070679_100022098 3300005530 Bacteria 6215
112 Ga0070679_100050607 3300005530 Bacteria 4138
113 Ga0070684_100003910 3300005535 Bacteria 11286
114 Ga0070684_100010156 3300005535 Bacteria 7445
115 Ga0070684_100010357 3300005535 Bacteria 7382
116 Ga0070684_100024221 3300005535 Bacteria 5089
117 Ga0070684_100057546 3300005535 Bacteria 3395
118 Ga0070684_100065290 3300005535 Bacteria 3194
119 Ga0070684_100153006 3300005535 Bacteria 2090
120 Ga0070684_100206144 3300005535 Bacteria 1792
121 Ga0070697_100032596 3300005536 Bacteria 4193
122 Ga0068853_100082846 3300005539 Bacteria 2810
123 Ga0070672_100003672 3300005543 Bacteria 9971
124 Ga0070672_100075225 3300005543 Bacteria 2696
125 Ga0070672_100197073 3300005543 Bacteria 1683
126 Ga0070686_100006823 3300005544 Bacteria 6356
127 Ga0070695_100030988 3300005545 Bacteria 3332
128 Ga0070696_100000465 3300005546 Bacteria 25402
129 Ga0070696_100019432 3300005546 Bacteria 4600
130 Ga0070693_100008947 3300005547 Bacteria 4967
131 Ga0070693_100036360 3300005547 Bacteria 2737
132 Ga0070665_100066821 3300005548 Bacteria 3607
133 Ga0070665_100106298 3300005548 Bacteria 2809
134 Ga0070704_100066700 3300005549 Bacteria 2596
135 Ga0068855_100007163 3300005563 Bacteria 13532
136 Ga0068855_100036046 3300005563 Bacteria 5889
137 Ga0070664_100000208 3300005564 Bacteria 42028
138 Ga0070664_100002184 3300005564 Bacteria 15713
139 Ga0070664_100006090 3300005564 Bacteria 9753
140 Ga0070664_100038130 3300005564 Bacteria 4044
141 Ga0070664_100044364 3300005564 Bacteria 3754
142 Ga0070664_100118563 3300005564 Bacteria 2315
143 Ga0070664_100135448 3300005564 Bacteria 2166
144 Ga0068857_100002478 3300005577 Bacteria 15092
145 Ga0068857_100018398 3300005577 Bacteria 6131
146 Ga0068857_100019270 3300005577 Bacteria 5991
147 Ga0068857_100039017 3300005577 Bacteria 4205
148 Ga0068857_100125535 3300005577 Bacteria 2312
149 Ga0068856_100006396 3300005614 Bacteria 11556
150 Ga0068856_100058875 3300005614 Bacteria 3794
151 Ga0068856_100283778 3300005614 Bacteria 1673
152 Ga0070702_100092906 3300005615 Bacteria 1833
153 Ga0068852_100021177 3300005616 Bacteria 5183
154 Ga0068852_100045822 3300005616 Bacteria 3722
155 Ga0068852_100048320 3300005616 Bacteria 3635
156 Ga0068859_100045605 3300005617 Bacteria 4404
157 Ga0068859_100055346 3300005617 Bacteria 3992
158 Ga0068859_100107232 3300005617 Bacteria 2853
159 Ga0068864_100022256 3300005618 Bacteria 5313
160 Ga0068864_100053429 3300005618 Bacteria 3485
161 Ga0068866_10089798 3300005718 Bacteria 1671
162 Ga0068861_100002401 3300005719 Bacteria 12204
163 Ga0068861_100008853 3300005719 Bacteria 6938
164 Ga0068870_10010428 3300005840 Bacteria 4271
165 Ga0068863_100022090 3300005841 Bacteria 6075
166 Ga0068860_100092972 3300005843 Unclassified 2874
167 Ga0068862_100000923 3300005844 Bacteria 28408
168 Ga0068862_100016008 3300005844 Bacteria 6235
169 Ga0068862_100055211 3300005844 Bacteria 3402
170 Ga0068862_100231074 3300005844 Bacteria 1678
171 Ga0081455_10097919 3300005937 Bacteria 2362
172 Ga0081539_10000104 3300005985 Bacteria 197478
173 Ga0070717_10008057 3300006028 Bacteria 7856
174 Ga0070717_10125399 3300006028 Bacteria 2204
175 Ga0070712_100057881 3300006175 Bacteria 2725
176 Ga0075428_100039328 3300006844 Bacteria 5204
177 Ga0075430_100000690 3300006846 Bacteria 25728
178 Ga0075430_100111065 3300006846 Bacteria 2285
179 Ga0075430_100240335 3300006846 Bacteria 1501
180 Ga0075431_100038119 3300006847 Archaea 4949
181 Ga0075433_10012748 3300006852 Bacteria 6806
182 Ga0075433_10158406 3300006852 Bacteria 2015
183 Ga0075434_100037775 3300006871 Bacteria 4780
184 Ga0075434_100052717 3300006871 Bacteria 4042
185 Ga0075429_100226461 3300006880 Bacteria 1637
186 Ga0068865_100026273 3300006881 Bacteria 3837
187 Ga0075436_100185578 3300006914 Bacteria 1471
188 Ga0097620_100045605 3300006931 Bacteria 4404
189 Ga0097620_100055350 3300006931 Bacteria 3992
190 Ga0097620_100107237 3300006931 Bacteria 2853
191 Ga0105240_10050245 3300009093 Bacteria 5258
192 Ga0105240_10069855 3300009093 Bacteria 4346
193 Ga0105240_10251712 3300009093 Bacteria 2043
194 Ga0111539_10014031 3300009094 Bacteria 10013
195 Ga0111539_10064936 3300009094 Bacteria 4316
196 Ga0111539_10243005 3300009094 Bacteria 2096
197 Ga0105245_10018454 3300009098 Bacteria 6100
198 Ga0105245_10138693 3300009098 Bacteria 2288
199 Ga0105245_10160435 3300009098 Unclassified 2133
200 Ga0105245_10346019 3300009098 Bacteria 1471
201 Ga0114129_10068515 3300009147 Bacteria 4947
202 Ga0105243_10177852 3300009148 Bacteria 1848
203 Ga0105241_10008912 3300009174 Bacteria 7377
204 Ga0105242_10015592 3300009176 Bacteria 5905
205 Ga0105242_10056363 3300009176 Bacteria 3215
206 Ga0105242_10145561 3300009176 Unclassified 2061
207 Ga0105248_10027272 3300009177 Bacteria 6356
208 Ga0105248_10055370 3300009177 Bacteria 4448
209 Ga0105248_10100917 3300009177 Bacteria 3252
210 Ga0105248_10304497 3300009177 Unclassified 1795
211 Ga0105237_10006747 3300009545 Bacteria 12676
212 Ga0105238_10029559 3300009551 Bacteria 5582
213 Ga0105238_10032659 3300009551 Bacteria 5297
214 Ga0105238_10046967 3300009551 Bacteria 4354
215 Ga0105249_10000089 3300009553 Bacteria 131175
216 Ga0105249_10000388 3300009553 Bacteria 43495
217 Ga0105249_10092254 3300009553 Bacteria 2835
218 Ga0105249_10253440 3300009553 Unclassified 1746
219 Ga0105246_10007220 3300011119 Bacteria 6807
220 Ga0157373_10021056 3300013100 Bacteria 4734
221 Ga0157373_10043713 3300013100 Unclassified 3200
222 Ga0157373_10097547 3300013100 Bacteria 2069
223 Ga0157371_10004746 3300013102 Bacteria 11726
224 Ga0157371_10012194 3300013102 Bacteria 6580
225 Ga0157371_10022126 3300013102 Bacteria 4663
226 Ga0157370_10011857 3300013104 Bacteria 9092
227 Ga0157370_10032178 3300013104 Bacteria 5123
228 Ga0157370_10051950 3300013104 Bacteria 3914
229 Ga0157370_10065563 3300013104 Bacteria 3436
230 Ga0157370_10081969 3300013104 Archaea 3035
231 Ga0157369_10014431 3300013105 Bacteria 8920
232 Ga0157369_10059764 3300013105 Unclassified 4111
233 Ga0157369_10060012 3300013105 Bacteria 4102
234 Ga0157369_10083547 3300013105 Archaea 3415
235 Ga0157369_10088226 3300013105 Bacteria 3310
236 Ga0157369_10098010 3300013105 Unclassified 3127
237 Ga0157369_10144887 3300013105 Bacteria 2512
238 Ga0157374_10036578 3300013296 Bacteria 4498
239 Ga0157374_10050370 3300013296 Bacteria 3871
240 Ga0157374_10223839 3300013296 Bacteria 1847
241 Ga0157374_10274125 3300013296 Bacteria 1664
242 Ga0157378_10000946 3300013297 Bacteria 26663
243 Ga0157378_10009077 3300013297 Bacteria 8655
244 Ga0163162_10004398 3300013306 Bacteria 13559
245 Ga0157372_10002948 3300013307 Bacteria 18348
246 Ga0157372_10008170 3300013307 Bacteria 11124
247 Ga0157372_10011813 3300013307 Bacteria 9303
248 Ga0157372_10020327 3300013307 Bacteria 7161
249 Ga0157372_10032344 3300013307 Bacteria 5735
250 Ga0157372_10034565 3300013307 Bacteria 5558
251 Ga0157372_10064630 3300013307 Bacteria 4105
252 Ga0157372_10073422 3300013307 Bacteria 3856
253 Ga0157372_10134106 3300013307 Unclassified 2851
254 Ga0157372_10148425 3300013307 Bacteria 2705
255 Ga0157372_10371115 3300013307 Bacteria 1667
256 Ga0157375_10011603 3300013308 Bacteria 7786
257 Ga0157375_10019204 3300013308 Bacteria 6212
258 Ga0157375_10041810 3300013308 Bacteria 4430
259 Ga0163163_10109482 3300014325 Bacteria 2790
260 Ga0163163_10133694 3300014325 Bacteria 2521
261 Ga0157377_10003768 3300014745 Bacteria 6879
262 Ga0157379_10007575 3300014968 Bacteria 9400
263 Ga0157376_10113835 3300014969 Bacteria 2386
264 Ga0182007_10016942 3300015262 Bacteria 2676
265 Ga0163161_10028901 3300017792 Bacteria 3939
266 Ga0163161_10066881 3300017792 Bacteria 2625
267 Ga0213876_10045089 3300021384 Bacteria 2332
268 Ga0207697_10002826 3300025315 Bacteria 8836
269 Ga0207688_10087593 3300025901 Bacteria 1785
270 Ga0207699_10008984 3300025906 Bacteria 4954
271 Ga0207645_10000514 3300025907 Bacteria 32127
272 Ga0207645_10008764 3300025907 Bacteria 7035
273 Ga0207705_10005035 3300025909 Bacteria 9912
274 Ga0207705_10013335 3300025909 Bacteria 5928
275 Ga0207705_10020104 3300025909 Bacteria 4775
276 Ga0207705_10020618 3300025909 Bacteria 4706
277 Ga0207654_10004050 3300025911 Bacteria 7378
278 Ga0207654_10122428 3300025911 Bacteria 1635
279 Ga0207707_10000715 3300025912 Bacteria 32899
280 Ga0207707_10001760 3300025912 Bacteria 19882
281 Ga0207707_10002985 3300025912 Bacteria 15047
282 Ga0207707_10009643 3300025912 Bacteria 8376
283 Ga0207707_10058925 3300025912 Bacteria 3341
284 Ga0207695_10002033 3300025913 Bacteria 31037
285 Ga0207695_10011060 3300025913 Bacteria 10965
286 Ga0207671_10024646 3300025914 Bacteria 4520
287 Ga0207693_10029101 3300025915 Bacteria 4366
288 Ga0207660_10004526 3300025917 Bacteria 9062
289 Ga0207660_10008349 3300025917 Bacteria 6697
290 Ga0207660_10017634 3300025917 Bacteria 4747
291 Ga0207660_10127358 3300025917 Archaea 1935
292 Ga0207662_10010331 3300025918 Bacteria 5154
293 Ga0207657_10006938 3300025919 Bacteria 11672
294 Ga0207657_10019716 3300025919 Bacteria 6395
295 Ga0207657_10028318 3300025919 Bacteria 5113
296 Ga0207657_10033991 3300025919 Bacteria 4591
297 Ga0207657_10053199 3300025919 Bacteria 3508
298 Ga0207657_10088467 3300025919 Bacteria 2589
299 Ga0207657_10123548 3300025919 Bacteria 2128
300 Ga0207657_10146269 3300025919 Bacteria 1927
301 Ga0207649_10005091 3300025920 Bacteria 7104
302 Ga0207649_10043212 3300025920 Bacteria 2754
303 Ga0207652_10001243 3300025921 Bacteria 22729
304 Ga0207652_10002191 3300025921 Bacteria 16688
305 Ga0207652_10014968 3300025921 Bacteria 6292
306 Ga0207652_10020279 3300025921 Bacteria 5472
307 Ga0207652_10020382 3300025921 Bacteria 5459
308 Ga0207652_10028589 3300025921 Bacteria 4653
309 Ga0207652_10062994 3300025921 Bacteria 3206
310 Ga0207652_10063940 3300025921 Bacteria 3183
311 Ga0207652_10134885 3300025921 Bacteria 2204
312 Ga0207646_10001901 3300025922 Bacteria 25140
313 Ga0207646_10019393 3300025922 Bacteria 6323
314 Ga0207681_10006506 3300025923 Bacteria 7172
315 Ga0207681_10008060 3300025923 Bacteria 6445
316 Ga0207681_10049775 3300025923 Bacteria 2834
317 Ga0207681_10096058 3300025923 Bacteria 2127
318 Ga0207694_10022165 3300025924 Bacteria 4816
319 Ga0207650_10026741 3300025925 Bacteria 4120
320 Ga0207659_10017606 3300025926 Bacteria 4669
321 Ga0207659_10216316 3300025926 Bacteria 1538
322 Ga0207687_10085489 3300025927 Bacteria 2288
323 Ga0207700_10000859 3300025928 Bacteria 17463
324 Ga0207700_10007066 3300025928 Bacteria 6831
325 Ga0207700_10158405 3300025928 Unclassified 1878
326 Ga0207664_10030299 3300025929 Bacteria 4131
327 Ga0207664_10203129 3300025929 Bacteria 1712
328 Ga0207644_10204954 3300025931 Bacteria 1557
329 Ga0207690_10052742 3300025932 Unclassified 2725
330 Ga0207706_10000703 3300025933 Bacteria 34938
331 Ga0207706_10001022 3300025933 Bacteria 28515
332 Ga0207706_10105475 3300025933 Bacteria 2480
333 Ga0207686_10008025 3300025934 Bacteria 5695
334 Ga0207686_10074905 3300025934 Bacteria 2189
335 Ga0207669_10159367 3300025937 Bacteria 1592
336 Ga0207691_10001158 3300025940 Bacteria 26181
337 Ga0207691_10010639 3300025940 Bacteria 8828
338 Ga0207691_10190502 3300025940 Unclassified 1789
339 Ga0207691_10197232 3300025940 Bacteria 1753
340 Ga0207711_10037618 3300025941 Bacteria 4112
341 Ga0207711_10109385 3300025941 Bacteria 2456
342 Ga0207711_10203360 3300025941 Bacteria 1808
343 Ga0207689_10020326 3300025942 Bacteria 5590
344 Ga0207689_10057553 3300025942 Bacteria 3198
345 Ga0207661_10000603 3300025944 Bacteria 22981
346 Ga0207661_10008752 3300025944 Bacteria 7241
347 Ga0207661_10039659 3300025944 Bacteria 3698
348 Ga0207661_10045187 3300025944 Bacteria 3485
349 Ga0207661_10052422 3300025944 Bacteria 3259
350 Ga0207661_10057031 3300025944 Bacteria 3139
351 Ga0207661_10064684 3300025944 Bacteria 2966
352 Ga0207661_10081141 3300025944 Bacteria 2678
353 Ga0207661_10086630 3300025944 Bacteria 2600
354 Ga0207661_10215466 3300025944 Bacteria 1694
355 Ga0207679_10001315 3300025945 Bacteria 15696
356 Ga0207679_10005237 3300025945 Bacteria 8131
357 Ga0207679_10048639 3300025945 Bacteria 3088
358 Ga0207679_10193224 3300025945 Bacteria 1694
359 Ga0207667_10002969 3300025949 Bacteria 21071
360 Ga0207667_10082504 3300025949 Bacteria 3330
361 Ga0207712_10000181 3300025961 Bacteria 65253
362 Ga0207712_10002179 3300025961 Bacteria 12799
363 Ga0207712_10080479 3300025961 Bacteria 2370
364 Ga0207640_10026426 3300025981 Bacteria 3524
365 Ga0207640_10107624 3300025981 Archaea 1969
366 Ga0207658_10082353 3300025986 Bacteria 2471
367 Ga0207658_10124507 3300025986 Bacteria 2061
368 Ga0207658_10193262 3300025986 Unclassified 1694
369 Ga0207677_10022072 3300026023 Bacteria 3904
370 Ga0207703_10129078 3300026035 Bacteria 2181
371 Ga0207639_10073896 3300026041 Bacteria 2675
372 Ga0207678_10016684 3300026067 Bacteria 6450
373 Ga0207708_10004310 3300026075 Bacteria 10473
374 Ga0207708_10044402 3300026075 Bacteria 3387
375 Ga0207708_10069418 3300026075 Bacteria 2698
376 Ga0207702_10065101 3300026078 Bacteria 3121
377 Ga0207702_10158489 3300026078 Bacteria 2065
378 Ga0207641_10016919 3300026088 Bacteria 5970
379 Ga0207648_10013009 3300026089 Bacteria 7763
380 Ga0207648_10051913 3300026089 Bacteria 3584
381 Ga0207648_10080445 3300026089 Bacteria 2842
382 Ga0207676_10004147 3300026095 Bacteria 10234
383 Ga0207676_10119591 3300026095 Bacteria 2219
384 Ga0207674_10003042 3300026116 Bacteria 20752
385 Ga0207674_10003495 3300026116 Bacteria 19185
386 Ga0207674_10009538 3300026116 Bacteria 11076
387 Ga0207674_10018239 3300026116 Bacteria 7634
388 Ga0207675_100000756 3300026118 Bacteria 32138
389 Ga0207675_100015110 3300026118 Bacteria 7201
390 Ga0207683_10130954 3300026121 Bacteria 2256
391 Ga0207698_10018953 3300026142 Bacteria 4699
392 Ga0207698_10080189 3300026142 Bacteria 2628
393 Ga0209995_1005547 3300027471 Unclassified 2026
394 Ga0209999_1001477 3300027543 Bacteria 4029
395 Ga0209998_10001363 3300027717 Bacteria 5937
396 Ga0207428_10071408 3300027907 Bacteria 2726
397 Ga0268265_10002895 3300028380 Bacteria 12607
398 Ga0268265_10055199 3300028380 Bacteria 3017
399 Ga0268264_10111041 3300028381 Bacteria 2401
400 Ga0307408_100012196 3300031548 Bacteria 5688
401 Ga0307408_100023411 3300031548 Bacteria 4207
402 Ga0307408_100034540 3300031548 Bacteria 3542
403 Ga0307408_100097796 3300031548 Bacteria 2230
404 Ga0307405_10000785 3300031731 Bacteria 12431
405 Ga0307405_10001827 3300031731 Bacteria 9126
406 Ga0307405_10010986 3300031731 Bacteria 4721
407 Ga0307405_10021881 3300031731 Bacteria 3603
408 Ga0307413_10005483 3300031824 Bacteria 5670
409 Ga0307413_10008117 3300031824 Bacteria 4932
410 Ga0307413_10080336 3300031824 Unclassified 2088
411 Ga0307410_10000469 3300031852 Bacteria 16344
412 Ga0307410_10004748 3300031852 Bacteria 7083
413 Ga0307410_10051044 3300031852 Unclassified 2785
414 Ga0307410_10085357 3300031852 Bacteria 2227
415 Ga0307406_10002964 3300031901 Bacteria 9253
416 Ga0307406_10019409 3300031901 Unclassified 3989
417 Ga0307406_10044122 3300031901 Bacteria 2793
418 Ga0307406_10069418 3300031901 Bacteria 2304
419 Ga0307406_10070663 3300031901 Unclassified 2286
420 Ga0307407_10000792 3300031903 Bacteria 10458
421 Ga0307407_10007733 3300031903 Bacteria 4886
422 Ga0307407_10010825 3300031903 Bacteria 4316
423 Ga0307407_10020967 3300031903 Bacteria 3359
424 Ga0307412_10000533 3300031911 Bacteria 22669
425 Ga0307412_10003018 3300031911 Bacteria 9320
426 Ga0307412_10037866 3300031911 Bacteria 3101
427 Ga0307409_100000335 3300031995 Bacteria 19414
428 Ga0307409_100065565 3300031995 Bacteria 2858
429 Ga0307409_100133866 3300031995 Bacteria 2123
430 Ga0307416_100000531 3300032002 Bacteria 19505
431 Ga0307416_100001817 3300032002 Bacteria 11859
432 Ga0307416_100005783 3300032002 Bacteria 7661
433 Ga0307416_100386712 3300032002 Bacteria 1431
434 Ga0307414_10002604 3300032004 Bacteria 9493
435 Ga0307411_10002274 3300032005 Bacteria 8405
436 Ga0307411_10003255 3300032005 Bacteria 7490
437 Ga0307411_10022063 3300032005 Bacteria 3741
438 Ga0307415_100001400 3300032126 Bacteria 11516
439 Ga0307415_100004652 3300032126 Bacteria 7172
440 Ga0307415_100005906 3300032126 Bacteria 6550
441 Ga0373923_0011983 3300035111 Bacteria 3194
442 Ga0373945_0008584 3300035116 Bacteria 3331
443 Ga0373956_0001435 3300035119 Bacteria 9854
444 Ga0373943_0028312 3300035170 Bacteria 2639
445 Ga0373943_0135298 3300035170 Bacteria 1323
446 Ga0373955_0004861 3300035172 Bacteria 5990
447 Ga0373931_0003607 3300035691 Bacteria 6990
448 Ga0373935_0002991 3300035692 Bacteria 9748
449 Ga0373935_0131524 3300035692 Bacteria 1682
450 Ga0373935_0145266 3300035692 Bacteria 1605
451 Ga0373927_0031004 3300035695 Bacteria 3487
452 Ga0373927_0078094 3300035695 Bacteria 2144
453 Ga0373933_0001448 3300035724 Bacteria 13881
454 Ga0373947_0000019 3300035725 Bacteria 101479
455 Ga0373947_0114508 3300035725 Bacteria 1708
456 Ga0373937_0001300 3300036401 Bacteria 20910
457 Ga0373937_0007555 3300036401 Bacteria 9416
458 Ga0373937_0041272 3300036401 Bacteria 4208
459 Ga0373937_0142477 3300036401 Unclassified 2243
460 Ga0373925_0002119 3300037068 Bacteria 16256
461 Ga0395905_0218977 3300037471 Unclassified 1782
462 Ga0436365_1096521 3300039437 Bacteria 2974
463 Ga0436365_1682455 3300039437 Bacteria 3433
464 Ga0436365_1854571 3300039437 Bacteria 1656
465 Ga0466966_0012121 3300044684 Bacteria 5711
466 Ga0466966_0102375 3300044684 Bacteria 1770
467 Ga0451576_0038762 3300045051 Bacteria 5044
468 Ga0451576_0175552 3300045051 Bacteria 2237
469 Ga0466958_0112013 3300045836 Bacteria 1704
470 Ga0495592_0001174 3300046454 Bacteria 18163
471 Ga0495603_0001274 3300046455 Bacteria 14670
472 Ga0495629_0011508 3300046459 Bacteria 6427
473 Ga0495629_0122229 3300046459 Unclassified 1814
474 Ga0495651_0003439 3300046462 Bacteria 12142
475 Ga0495651_0007089 3300046462 Bacteria 8569
476 Ga0495653_0001331 3300046463 Bacteria 19185
477 Ga0495653_0042936 3300046463 Bacteria 3518
478 Ga0495653_0088755 3300046463 Unclassified 2267
479 Ga0495580_0001888 3300046472 Bacteria 18444
480 Ga0495580_0013857 3300046472 Bacteria 6140
481 Ga0495582_0000045 3300046473 Bacteria 62705
482 Ga0495639_0000361 3300046475 Bacteria 21930
483 Ga0495639_0017746 3300046475 Bacteria 3092
484 Ga0495662_0011241 3300046476 Bacteria 4376
485 Ga0495662_0114095 3300046476 Bacteria 1325
486 Ga0495664_0012881 3300046477 Bacteria 4739
487 Ga0495594_0002844 3300046499 Bacteria 9000
488 Ga0495594_0064269 3300046499 Bacteria 2034
489 Ga0495594_0129783 3300046499 Bacteria 1427
490 Ga0495608_0016580 3300046511 Bacteria 5099
491 Ga0495608_0020035 3300046511 Bacteria 4598
492 Ga0495608_0090257 3300046511 Bacteria 1982
493 Ga0495618_0030409 3300046514 Unclassified 3373
494 Ga0495618_0060106 3300046514 Bacteria 2409
495 Ga0495628_0004941 3300046516 Bacteria 11726
496 Ga0495628_0023645 3300046516 Bacteria 5042
497 Ga0495630_0001419 3300046517 Bacteria 16578
498 Ga0495630_0009104 3300046517 Bacteria 7137
499 Ga0495630_0097181 3300046517 Bacteria 2227
500 Ga0495630_0151204 3300046517 Bacteria 1766
501 Ga0495652_0006694 3300046529 Bacteria 10696
502 Ga0495652_0007869 3300046529 Bacteria 9785
503 Ga0495652_0073233 3300046529 Bacteria 2853
504 Ga0495665_0000014 3300046531 Bacteria 67903
505 Ga0495665_0006158 3300046531 Bacteria 6480
506 Ga0495586_0007720 3300046535 Bacteria 5735
507 Ga0495587_0000693 3300046536 Bacteria 22582
508 Ga0495587_0010815 3300046536 Bacteria 5794
509 Ga0495587_0024676 3300046536 Bacteria 3682
510 Ga0495645_0000475 3300046543 Bacteria 27786
511 Ga0495645_0022805 3300046543 Bacteria 4530
512 Ga0495645_0041331 3300046543 Bacteria 3362
513 Ga0495667_0001537 3300046559 Bacteria 15269
514 Ga0495667_0003741 3300046559 Bacteria 10234
515 Ga0495667_0032853 3300046559 Bacteria 3474
516 Ga0495667_0042010 3300046559 Bacteria 3031
517 Ga0495667_0064204 3300046559 Bacteria 2402
518 Ga0495634_0072729 3300046642 Unclassified 2261
519 Ga0495634_0094953 3300046642 Bacteria 1932
520 Ga0495635_0000743 3300046663 Bacteria 21087
521 Ga0495635_0036666 3300046663 Bacteria 3398
522 Ga0495635_0115171 3300046663 Bacteria 1835
523 Ga0495588_0000549 3300046674 Bacteria 18036
524 Ga0495588_0055161 3300046674 Bacteria 2051
525 Ga0495657_0000681 3300046675 Bacteria 30480
526 Ga0495599_0000654 3300046678 Bacteria 19584
527 Ga0495599_0010737 3300046678 Bacteria 5609
528 Ga0495599_0022620 3300046678 Bacteria 3925
529 Ga0495623_0000637 3300046679 Bacteria 23259
530 Ga0495623_0045872 3300046679 Unclassified 2775
531 Ga0495623_0080862 3300046679 Bacteria 2011
532 Ga0495646_0003218 3300046680 Bacteria 10152
533 Ga0495646_0030061 3300046680 Bacteria 3394
534 Ga0495646_0042327 3300046680 Bacteria 2795
535 Ga0495658_0000476 3300046683 Bacteria 22202
536 Ga0495658_0110559 3300046683 Bacteria 1652
537 Ga0495669_0047070 3300046684 Bacteria 1926
538 Ga0495613_0008517 3300046689 Bacteria 7612
539 Ga0495613_0133343 3300046689 Bacteria 1778
540 Ga0495600_0000519 3300046809 Bacteria 19960
541 Ga0495600_0051570 3300046809 Unclassified 2685
542 Ga0495604_0000429 3300047317 Bacteria 37816
543 Ga0495604_0044212 3300047317 Bacteria 3482
544 Ga0495674_0043010 3300047319 Bacteria 4024
545 Ga0495674_0064105 3300047319 Bacteria 3195
546 Ga0495674_0106761 3300047319 Bacteria 2377
547 Ga0495674_0110344 3300047319 Bacteria 2333
548 Ga0495674_0225134 3300047319 Bacteria 1549
549 Ga0495672_0028478 3300047320 Bacteria 3533
550 Ga0495680_0002640 3300047322 Bacteria 18184
551 Ga0495680_0007047 3300047322 Bacteria 10361
552 Ga0495680_0026260 3300047322 Bacteria 4804
553 Ga0495675_0000489 3300047444 Bacteria 25708
554 Ga0495684_0000115 3300047471 Bacteria 58017
555 Ga0495684_0008175 3300047471 Bacteria 8095
556 Ga0495684_0017008 3300047471 Bacteria 5603
557 Ga0495684_0083025 3300047471 Bacteria 2430
558 Ga0495684_0143221 3300047471 Unclassified 1791
559 Ga0495593_0000460 3300047673 Bacteria 22852
560 Ga0495593_0053617 3300047673 Bacteria 2128
561 Ga0495602_0060627 3300048088 Bacteria 3295
562 Ga0495614_0000512 3300048089 Bacteria 15906
563 Ga0496101_0030530 3300048904 Bacteria 3780
564 Ga0496104_0247560 3300048907 Bacteria 1695
565 Ga0496105_0127209 3300048908 Bacteria 2101
566 Ga0496108_0161675 3300048911 Bacteria 1936
567 Ga0496112_0009041 3300048915 Bacteria 8947
568 Ga0496112_0091307 3300048915 Bacteria 3014
569 Ga0496112_0241415 3300048915 Bacteria 1759
570 Ga0496115_0028768 3300048918 Bacteria 4358
571 Ga0501033_0064382 3300049570 Bacteria 2698
572 Ga0501037_0036598 3300049573 Bacteria 3617
573 Ga0501047_0091003 3300049581 Bacteria 2928
574 Ga0501047_0182238 3300049581 Bacteria 1966
575 Ga0501075_0103912 3300049591 Bacteria 2159
576 Ga0501233_021716 3300049668 Bacteria 1380
577 Ga0501235_000402 3300049669 Bacteria 8336
578 Ga0501250_003120 3300049680 Bacteria 1559
579 Ga0501221_001170 3300049704 Bacteria 4340
580 Ga0501234_001216 3300049707 Bacteria 4062
581 Ga0501263_006953 3300049760 Bacteria 1320
582 Ga0501044_0005534 3300049823 Bacteria 14018
583 Ga0501204_002076 3300049850 Bacteria 2018
584 nmdc:mga05p37_13410_c1 3300050507 Bacteria 9821
585 nmdc:mga05p37_36882_c1 3300050507 Bacteria 5996
586 nmdc:mga0qj67_453_c1 3300050509 Bacteria 28026
587 nmdc:mga08y16_10261_c1 3300050511 Bacteria 9832
588 nmdc:mga08y16_59585_c1 3300050511 Bacteria 3987
589 nmdc:mga0n895_104198_c1 3300050512 Bacteria 2849
590 nmdc:mga0n895_205848_c1 3300050512 Unclassified 1998
591 nmdc:mga0n895_209299_c1 3300050512 Bacteria 1981
592 nmdc:mga0n895_31965_c1 3300050512 Bacteria 5046
593 nmdc:mga08x19_24568_c1 3300050514 Bacteria 3747
594 nmdc:mga0a205_15562_c1 3300050515 Bacteria 5911
595 nmdc:mga0a205_7713_c1 3300050515 Bacteria 9765
596 Ga0495601_0082671 3300053077 Bacteria 2062
597 Ga0495612_0008479 3300053078 Bacteria 4168
598 Ga0495595_0010956 3300053084 Bacteria 3783
599 Ga0495619_0063324 3300053085 Bacteria 2463
600 Ga0207704_10070644
601 JGI25406J46586_10013506
602 Ga0065712_10094122
603 Ga0065715_10092686
604 Ga0065715_10099018
605 Ga0070658_10002623
606 Ga0070658_10007002
607 Ga0070658_10061408
608 Ga0070676_10002054
609 Ga0070676_10012252
610 Ga0070676_10016789
611 Ga0070676_10031200
612 Ga0070683_100002730
613 Ga0070683_100011975
614 Ga0070683_100063742
615 Ga0070683_100074339
616 Ga0070683_100077853
617 Ga0070683_100083512
618 Ga0070683_100178370
619 Ga0070683_100192887
620 Ga0070683_100228805
621 Ga0070690_100064613
622 Ga0070690_100090301
623 Ga0070670_100007021
624 Ga0070670_100009757
625 Ga0070670_100012000
626 Ga0068869_100003499
627 Ga0068869_100006384
628 Ga0070666_10189252
629 Ga0070680_100004251
630 Ga0070680_100006273
631 Ga0070680_100021528
632 Ga0070680_100100854
633 Ga0070682_100001044
634 Ga0070682_100001257
635 Ga0070682_100013735
636 Ga0068868_100002367
637 Ga0068868_100010210
638 Ga0068868_100023432
639 Ga0070660_100040372
640 Ga0070660_100041003
641 Ga0070660_100117116
642 Ga0070660_100170079
643 Ga0070689_100084256
644 Ga0070689_100190946
645 Ga0070687_100012248
646 Ga0070687_100036604
647 Ga0070687_100037261
648 Ga0070661_100003156
649 Ga0070661_100007522
650 Ga0070661_100020402
651 Ga0070661_100022175
652 Ga0070661_100089090
653 Ga0070692_10020363
654 Ga0070692_10026534
655 Ga0070692_10031272
656 Ga0070692_10035621
657 Ga0070668_100033912
658 Ga0070669_100000283
659 Ga0070669_100008212
660 Ga0070669_100012413
661 Ga0070675_100002689
662 Ga0070675_100006502
663 Ga0070675_100039350
664 Ga0070675_100110006
665 Ga0070674_100008707
666 Ga0070674_100037595
667 Ga0070688_100095570
668 Ga0070659_100011561
669 Ga0070659_100013382
670 Ga0070659_100048807
671 Ga0070667_100236886
672 Ga0070709_10007294
673 Ga0070714_100005061
674 Ga0070714_100015039
675 Ga0070714_100025566
676 Ga0070714_100027946
677 Ga0070713_100000345
678 Ga0070713_100183044
679 Ga0070710_10107781
680 Ga0070700_100004131
681 Ga0070700_100071567
682 Ga0070708_100000035
683 Ga0070708_100000576
684 Ga0070708_100036562
685 Ga0070678_100018745
686 Ga0070662_100005673
687 Ga0070681_10002263
688 Ga0070681_10006159
689 Ga0070681_10009188
690 Ga0070681_10014942
691 Ga0070681_10072379
692 Ga0070681_10090800
693 Ga0070681_10134058
694 Ga0070681_10152790
695 Ga0068867_100021734
696 Ga0070685_10037404
697 Ga0070685_10057120
698 Ga0070706_100073164
699 Ga0070706_100105213
700 Ga0070707_100020055
701 Ga0070698_100013538
702 Ga0070698_100092097
703 Ga0070698_100118896
704 Ga0070699_100018479
705 Ga0070699_100027658
706 Ga0070679_100000347
707 Ga0070679_100000771
708 Ga0070679_100005458
709 Ga0070679_100007141
710 Ga0070679_100022098
711 Ga0070679_100050607
712 Ga0070684_100003910
713 Ga0070684_100010156
714 Ga0070684_100010357
715 Ga0070684_100024221
716 Ga0070684_100057546
717 Ga0070684_100065290
718 Ga0070684_100153006
719 Ga0070684_100206144
720 Ga0070697_100032596
721 Ga0068853_100082846
722 Ga0070672_100003672
723 Ga0070672_100075225
724 Ga0070672_100197073
725 Ga0070686_100006823
726 Ga0070695_100030988
727 Ga0070696_100000465
728 Ga0070696_100019432
729 Ga0070693_100008947
730 Ga0070693_100036360
731 Ga0070665_100066821
732 Ga0070665_100106298
733 Ga0070704_100066700
734 Ga0068855_100007163
735 Ga0068855_100036046
736 Ga0070664_100000208
737 Ga0070664_100002184
738 Ga0070664_100006090
739 Ga0070664_100038130
740 Ga0070664_100044364
741 Ga0070664_100118563
742 Ga0070664_100135448
743 Ga0068857_100002478
744 Ga0068857_100018398
745 Ga0068857_100019270
746 Ga0068857_100039017
747 Ga0068857_100125535
748 Ga0068856_100006396
749 Ga0068856_100058875
750 Ga0068856_100283778
751 Ga0070702_100092906
752 Ga0068852_100021177
753 Ga0068852_100045822
754 Ga0068852_100048320
755 Ga0068859_100045605
756 Ga0068859_100055346
757 Ga0068859_100107232
758 Ga0068864_100022256
759 Ga0068864_100053429
760 Ga0068866_10089798
761 Ga0068861_100002401
762 Ga0068861_100008853
763 Ga0068870_10010428
764 Ga0068863_100022090
765 Ga0068860_100092972
766 Ga0068862_100000923
767 Ga0068862_100016008
768 Ga0068862_100055211
769 Ga0068862_100231074
770 Ga0081455_10097919
771 Ga0081539_10000104
772 Ga0070717_10008057
773 Ga0070717_10125399
774 Ga0070712_100057881
775 Ga0075428_100039328
776 Ga0075430_100000690
777 Ga0075430_100111065
778 Ga0075430_100240335
779 Ga0075431_100038119
780 Ga0075433_10012748
781 Ga0075433_10158406
782 Ga0075434_100037775
783 Ga0075434_100052717
784 Ga0075429_100226461
785 Ga0068865_100026273
786 Ga0075436_100185578
787 Ga0097620_100045605
788 Ga0097620_100055350
789 Ga0097620_100107237
790 Ga0105240_10050245
791 Ga0105240_10069855
792 Ga0105240_10251712
793 Ga0111539_10014031
794 Ga0111539_10064936
795 Ga0111539_10243005
796 Ga0105245_10018454
797 Ga0105245_10138693
798 Ga0105245_10160435
799 Ga0105245_10346019
800 Ga0114129_10068515
801 Ga0105243_10177852
802 Ga0105241_10008912
803 Ga0105242_10015592
804 Ga0105242_10056363
805 Ga0105242_10145561
806 Ga0105248_10027272
807 Ga0105248_10055370
808 Ga0105248_10100917
809 Ga0105248_10304497
810 Ga0105237_10006747
811 Ga0105238_10029559
812 Ga0105238_10032659
813 Ga0105238_10046967
814 Ga0105249_10000089
815 Ga0105249_10000388
816 Ga0105249_10092254
817 Ga0105249_10253440
818 Ga0105246_10007220
819 Ga0157373_10021056
820 Ga0157373_10043713
821 Ga0157373_10097547
822 Ga0157371_10004746
823 Ga0157371_10012194
824 Ga0157371_10022126
825 Ga0157370_10011857
826 Ga0157370_10032178
827 Ga0157370_10051950
828 Ga0157370_10065563
829 Ga0157370_10081969
830 Ga0157369_10014431
831 Ga0157369_10059764
832 Ga0157369_10060012
833 Ga0157369_10083547
834 Ga0157369_10088226
835 Ga0157369_10098010
836 Ga0157369_10144887
837 Ga0157374_10036578
838 Ga0157374_10050370
839 Ga0157374_10223839
840 Ga0157374_10274125
841 Ga0157378_10000946
842 Ga0157378_10009077
843 Ga0163162_10004398
844 Ga0157372_10002948
845 Ga0157372_10008170
846 Ga0157372_10011813
847 Ga0157372_10020327
848 Ga0157372_10032344
849 Ga0157372_10034565
850 Ga0157372_10064630
851 Ga0157372_10073422
852 Ga0157372_10134106
853 Ga0157372_10148425
854 Ga0157372_10371115
855 Ga0157375_10011603
856 Ga0157375_10019204
857 Ga0157375_10041810
858 Ga0163163_10109482
859 Ga0163163_10133694
860 Ga0157377_10003768
861 Ga0157379_10007575
862 Ga0157376_10113835
863 Ga0182007_10016942
864 Ga0163161_10028901
865 Ga0163161_10066881
866 Ga0213876_10045089
867 Ga0207697_10002826
868 Ga0207688_10087593
869 Ga0207699_10008984
870 Ga0207645_10000514
871 Ga0207645_10008764
872 Ga0207705_10005035
873 Ga0207705_10013335
874 Ga0207705_10020104
875 Ga0207705_10020618
876 Ga0207654_10004050
877 Ga0207654_10122428
878 Ga0207707_10000715
879 Ga0207707_10001760
880 Ga0207707_10002985
881 Ga0207707_10009643
882 Ga0207707_10058925
883 Ga0207695_10002033
884 Ga0207695_10011060
885 Ga0207671_10024646
886 Ga0207693_10029101
887 Ga0207660_10004526
888 Ga0207660_10008349
889 Ga0207660_10017634
890 Ga0207660_10127358
891 Ga0207662_10010331
892 Ga0207657_10006938
893 Ga0207657_10019716
894 Ga0207657_10028318
895 Ga0207657_10033991
896 Ga0207657_10053199
897 Ga0207657_10088467
898 Ga0207657_10123548
899 Ga0207657_10146269
900 Ga0207649_10005091
901 Ga0207649_10043212
902 Ga0207652_10001243
903 Ga0207652_10002191
904 Ga0207652_10014968
905 Ga0207652_10020279
906 Ga0207652_10020382
907 Ga0207652_10028589
908 Ga0207652_10062994
909 Ga0207652_10063940
910 Ga0207652_10134885
911 Ga0207646_10001901
912 Ga0207646_10019393
913 Ga0207681_10006506
914 Ga0207681_10008060
915 Ga0207681_10049775
916 Ga0207681_10096058
917 Ga0207694_10022165
918 Ga0207650_10026741
919 Ga0207659_10017606
920 Ga0207659_10216316
921 Ga0207687_10085489
922 Ga0207700_10000859
923 Ga0207700_10007066
924 Ga0207700_10158405
925 Ga0207664_10030299
926 Ga0207664_10203129
927 Ga0207644_10204954
928 Ga0207690_10052742
929 Ga0207706_10000703
930 Ga0207706_10001022
931 Ga0207706_10105475
932 Ga0207686_10008025
933 Ga0207686_10074905
934 Ga0207669_10159367
935 Ga0207691_10001158
936 Ga0207691_10010639
937 Ga0207691_10190502
938 Ga0207691_10197232
939 Ga0207711_10037618
940 Ga0207711_10109385
941 Ga0207711_10203360
942 Ga0207689_10020326
943 Ga0207689_10057553
944 Ga0207661_10000603
945 Ga0207661_10008752
946 Ga0207661_10039659
947 Ga0207661_10045187
948 Ga0207661_10052422
949 Ga0207661_10057031
950 Ga0207661_10064684
951 Ga0207661_10081141
952 Ga0207661_10086630
953 Ga0207661_10215466
954 Ga0207679_10001315
955 Ga0207679_10005237
956 Ga0207679_10048639
957 Ga0207679_10193224
958 Ga0207667_10002969
959 Ga0207667_10082504
960 Ga0207712_10000181
961 Ga0207712_10002179
962 Ga0207712_10080479
963 Ga0207640_10026426
964 Ga0207640_10107624
965 Ga0207658_10082353
966 Ga0207658_10124507
967 Ga0207658_10193262
968 Ga0207677_10022072
969 Ga0207703_10129078
970 Ga0207639_10073896
971 Ga0207678_10016684
972 Ga0207708_10004310
973 Ga0207708_10044402
974 Ga0207708_10069418
975 Ga0207702_10065101
976 Ga0207702_10158489
977 Ga0207641_10016919
978 Ga0207648_10013009
979 Ga0207648_10051913
980 Ga0207648_10080445
981 Ga0207676_10004147
982 Ga0207676_10119591
983 Ga0207674_10003042
984 Ga0207674_10003495
985 Ga0207674_10009538
986 Ga0207674_10018239
987 Ga0207675_100000756
988 Ga0207675_100015110
989 Ga0207683_10130954
990 Ga0207698_10018953
991 Ga0207698_10080189
992 Ga0209995_1005547
993 Ga0209999_1001477
994 Ga0209998_10001363
995 Ga0207428_10071408
996 Ga0268265_10002895
997 Ga0268265_10055199
998 Ga0268264_10111041
999 Ga0307408_100012196
1000 Ga0307408_100023411
1001 Ga0307408_100034540
1002 Ga0307408_100097796
1003 Ga0307405_10000785
1004 Ga0307405_10001827
1005 Ga0307405_10010986
1006 Ga0307405_10021881
1007 Ga0307413_10005483
1008 Ga0307413_10008117
1009 Ga0307413_10080336
1010 Ga0307410_10000469
1011 Ga0307410_10004748
1012 Ga0307410_10051044
1013 Ga0307410_10085357
1014 Ga0307406_10002964
1015 Ga0307406_10019409
1016 Ga0307406_10044122
1017 Ga0307406_10069418
1018 Ga0307406_10070663
1019 Ga0307407_10000792
1020 Ga0307407_10007733
1021 Ga0307407_10010825
1022 Ga0307407_10020967
1023 Ga0307412_10000533
1024 Ga0307412_10003018
1025 Ga0307412_10037866
1026 Ga0307409_100000335
1027 Ga0307409_100065565
1028 Ga0307409_100133866
1029 Ga0307416_100000531
1030 Ga0307416_100001817
1031 Ga0307416_100005783
1032 Ga0307416_100386712
1033 Ga0307414_10002604
1034 Ga0307411_10002274
1035 Ga0307411_10003255
1036 Ga0307411_10022063
1037 Ga0307415_100001400
1038 Ga0307415_100004652
1039 Ga0307415_100005906
1040 Ga0373923_0011983
1041 Ga0373945_0008584
1042 Ga0373956_0001435
1043 Ga0373943_0028312
1044 Ga0373943_0135298
1045 Ga0373955_0004861
1046 Ga0373931_0003607
1047 Ga0373935_0002991
1048 Ga0373935_0131524
1049 Ga0373935_0145266
1050 Ga0373927_0031004
1051 Ga0373927_0078094
1052 Ga0373933_0001448
1053 Ga0373947_0000019
1054 Ga0373947_0114508
1055 Ga0373937_0001300
1056 Ga0373937_0007555
1057 Ga0373937_0041272
1058 Ga0373937_0142477
1059 Ga0373925_0002119
1060 Ga0395905_0218977
1061 Ga0436365_1096521
1062 Ga0436365_1682455
1063 Ga0436365_1854571
1064 Ga0466966_0012121
1065 Ga0466966_0102375
1066 Ga0451576_0038762
1067 Ga0451576_0175552
1068 Ga0466958_0112013
1069 Ga0495592_0001174
1070 Ga0495603_0001274
1071 Ga0495629_0011508
1072 Ga0495629_0122229
1073 Ga0495651_0003439
1074 Ga0495651_0007089
1075 Ga0495653_0001331
1076 Ga0495653_0042936
1077 Ga0495653_0088755
1078 Ga0495580_0001888
1079 Ga0495580_0013857
1080 Ga0495582_0000045
1081 Ga0495639_0000361
1082 Ga0495639_0017746
1083 Ga0495662_0011241
1084 Ga0495662_0114095
1085 Ga0495664_0012881
1086 Ga0495594_0002844
1087 Ga0495594_0064269
1088 Ga0495594_0129783
1089 Ga0495608_0016580
1090 Ga0495608_0020035
1091 Ga0495608_0090257
1092 Ga0495618_0030409
1093 Ga0495618_0060106
1094 Ga0495628_0004941
1095 Ga0495628_0023645
1096 Ga0495630_0001419
1097 Ga0495630_0009104
1098 Ga0495630_0097181
1099 Ga0495630_0151204
1100 Ga0495652_0006694
1101 Ga0495652_0007869
1102 Ga0495652_0073233
1103 Ga0495665_0000014
1104 Ga0495665_0006158
1105 Ga0495586_0007720
1106 Ga0495587_0000693
1107 Ga0495587_0010815
1108 Ga0495587_0024676
1109 Ga0495645_0000475
1110 Ga0495645_0022805
1111 Ga0495645_0041331
1112 Ga0495667_0001537
1113 Ga0495667_0003741
1114 Ga0495667_0032853
1115 Ga0495667_0042010
1116 Ga0495667_0064204
1117 Ga0495634_0072729
1118 Ga0495634_0094953
1119 Ga0495635_0000743
1120 Ga0495635_0036666
1121 Ga0495635_0115171
1122 Ga0495588_0000549
1123 Ga0495588_0055161
1124 Ga0495657_0000681
1125 Ga0495599_0000654
1126 Ga0495599_0010737
1127 Ga0495599_0022620
1128 Ga0495623_0000637
1129 Ga0495623_0045872
1130 Ga0495623_0080862
1131 Ga0495646_0003218
1132 Ga0495646_0030061
1133 Ga0495646_0042327
1134 Ga0495658_0000476
1135 Ga0495658_0110559
1136 Ga0495669_0047070
1137 Ga0495613_0008517
1138 Ga0495613_0133343
1139 Ga0495600_0000519
1140 Ga0495600_0051570
1141 Ga0495604_0000429
1142 Ga0495604_0044212
1143 Ga0495674_0043010
1144 Ga0495674_0064105
1145 Ga0495674_0106761
1146 Ga0495674_0110344
1147 Ga0495674_0225134
1148 Ga0495672_0028478
1149 Ga0495680_0002640
1150 Ga0495680_0007047
1151 Ga0495680_0026260
1152 Ga0495675_0000489
1153 Ga0495684_0000115
1154 Ga0495684_0008175
1155 Ga0495684_0017008
1156 Ga0495684_0083025
1157 Ga0495684_0143221
1158 Ga0495593_0000460
1159 Ga0495593_0053617
1160 Ga0495602_0060627
1161 Ga0495614_0000512
1162 Ga0496101_0030530
1163 Ga0496104_0247560
1164 Ga0496105_0127209
1165 Ga0496108_0161675
1166 Ga0496112_0009041
1167 Ga0496112_0091307
1168 Ga0496112_0241415
1169 Ga0496115_0028768
1170 Ga0501033_0064382
1171 Ga0501037_0036598
1172 Ga0501047_0091003
1173 Ga0501047_0182238
1174 Ga0501075_0103912
1175 Ga0501233_021716
1176 Ga0501235_000402
1177 Ga0501250_003120
1178 Ga0501221_001170
1179 Ga0501234_001216
1180 Ga0501263_006953
1181 Ga0501044_0005534
1182 Ga0501204_002076
1183 nmdc:mga05p37_13410_c1
1184 nmdc:mga05p37_36882_c1
1185 nmdc:mga0qj67_453_c1
1186 nmdc:mga08y16_10261_c1
1187 nmdc:mga08y16_59585_c1
1188 nmdc:mga0n895_104198_c1
1189 nmdc:mga0n895_205848_c1
1190 nmdc:mga0n895_209299_c1
1191 nmdc:mga0n895_31965_c1
1192 nmdc:mga08x19_24568_c1
1193 nmdc:mga0a205_15562_c1
1194 nmdc:mga0a205_7713_c1
1195 Ga0495601_0082671
1196 Ga0495612_0008479
1197 Ga0495595_0010956
1198 Ga0495619_0063324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6btm-assembly1.cif.gz_F structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8288 23 421
6loe-assembly1.cif.gz_F cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8244 4 409
6btm-assembly1.cif.gz_F structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8093 23 421
6f0k-assembly1.cif.gz_F alternative complex iii 0.8029 24 421
6loe-assembly1.cif.gz_F cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7927 4 409
ID Description Score Start End Superfamily
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6512 48 366 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6303 48 366 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6206 53 362 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6016 53 362 1.20.1630.10
1gs9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.5287 68 225 1.20.120.20
ID Description Score Start End GO Terms
AF-A0A6J4SMH0-F1-model_v4 Molybdopterin oxidoreductase 0.9807 20 437 GO:0016020
AF-A0A257RNK5-F1-model_v4 Cytochrome c domain-containing protein 0.9758 48 237 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A6J4SMH0-F1-model_v4 Molybdopterin oxidoreductase 0.9693 20 437 GO:0016020
AF-A0A2V7RES1-F1-model_v4 Molybdopterin oxidoreductase 0.9686 1 387 GO:0016020
AF-A0A7W1C4Q8-F1-model_v4 Molybdopterin oxidoreductase 0.9613 1 336 GO:0016020

Map