F467568

General Info

Members Datasets Scaffolds Average Seq Length
596 321 1192 184

Family's Representative Sequence

Representative Sequence 3300027512|Ga0209179_1019899|Ga0209179_10198991
Length 206
Sequence MSDFDESGVGTNMCSISCARTSYIDLKANRIHLNAPSVSAAGVRNVIQLFAVALGAASLAACAQSSVVTQKSELSVASRQASLEHNRTTSFVTNRRVAITKKHTPYKNAAETQVASHGLASFYTEGTQTASGERFDTHELTAAHRTLPFGTRLRVTNVATGRSVTVRVNDRGPFVPGRVVDVSHSAAETLGMVGGGIAKVKLDVVQ

Samples

Sample ID Description Type Environment
1 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
283 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
284 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
302 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
303 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
315 2791355199
316 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
317 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
318 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
319 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
320 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
321 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.17
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.89
Nodule 0.67
Rhizoplane 3.52
Rhizosphere 82.21
Stem 0
Stem Tuber 0
Unclassified 4.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209179_1019899 3300027512 Bacteria 1297
2 CNAas_1002968 3300000532 Bacteria 1155
3 JGI24750J21931_1010725 3300002070 Bacteria 1197
4 JGI24744J21845_10008218 3300002077 Bacteria 2155
5 JGI24744J21845_10025555 3300002077 Bacteria 1151
6 JGI24034J26672_10027634 3300002239 Bacteria 914
7 JGI24742J22300_10034046 3300002244 Bacteria 896
8 Ga0070670_100336388 3300005331 Bacteria 1325
9 Ga0068869_101160593 3300005334 Unclassified 677
10 Ga0070682_100503917 3300005337 Bacteria 939
11 Ga0068868_100068141 3300005338 Bacteria 2833
12 Ga0070691_10187559 3300005341 Bacteria 1080
13 Ga0070687_100276702 3300005343 Bacteria 1055
14 Ga0070692_10317390 3300005345 Unclassified 957
15 Ga0070668_100006633 3300005347 Bacteria 8579
16 Ga0070668_100273898 3300005347 Bacteria 1407
17 Ga0070675_100054499 3300005354 Bacteria 3290
18 Ga0070675_100127729 3300005354 Bacteria 2164
19 Ga0070674_100014014 3300005356 Bacteria 4975
20 Ga0070674_100054664 3300005356 Bacteria 2762
21 Ga0070674_100176925 3300005356 Bacteria 1631
22 Ga0070673_100807142 3300005364 Bacteria 867
23 Ga0070688_100675382 3300005365 Unclassified 798
24 Ga0070667_100053576 3300005367 Bacteria 3404
25 Ga0070667_100070942 3300005367 Bacteria 2966
26 Ga0070667_100276388 3300005367 Bacteria 1507
27 Ga0070667_100405138 3300005367 Bacteria 1242
28 Ga0070667_100425218 3300005367 Bacteria 1211
29 Ga0070667_100939784 3300005367 Bacteria 805
30 Ga0070709_10002309 3300005434 Bacteria 10357
31 Ga0070714_100003388 3300005435 Bacteria 11883
32 Ga0070714_100090547 3300005435 Bacteria 2679
33 Ga0070713_100007424 3300005436 Bacteria 7692
34 Ga0070713_100008603 3300005436 Bacteria 7247
35 Ga0070710_10000869 3300005437 Bacteria 14456
36 Ga0070711_100003540 3300005439 Bacteria 9111
37 Ga0070705_100581326 3300005440 Unclassified 864
38 Ga0070700_100018292 3300005441 Bacteria 4026
39 Ga0070700_100163750 3300005441 Bacteria 1533
40 Ga0070694_100376627 3300005444 Bacteria 1106
41 Ga0070663_100117852 3300005455 Bacteria 2002
42 Ga0070663_100331020 3300005455 Bacteria 1228
43 Ga0070663_100956726 3300005455 Unclassified 742
44 Ga0070678_100120694 3300005456 Bacteria 2066
45 Ga0070678_100300184 3300005456 Bacteria 1364
46 Ga0070678_100344286 3300005456 Bacteria 1280
47 Ga0070678_100518995 3300005456 Bacteria 1054
48 Ga0070662_100165558 3300005457 Bacteria 1732
49 Ga0070662_100470223 3300005457 Bacteria 1046
50 Ga0070707_100139164 3300005468 Bacteria 2362
51 Ga0070698_100182348 3300005471 Bacteria 2038
52 Ga0070699_100094324 3300005518 Bacteria 2619
53 Ga0070679_101614572 3300005530 Unclassified 596
54 Ga0070684_100300127 3300005535 Bacteria 1474
55 Ga0070672_100115427 3300005543 Bacteria 2193
56 Ga0070672_100386699 3300005543 Bacteria 1197
57 Ga0070686_100166441 3300005544 Bacteria 1556
58 Ga0070695_100169847 3300005545 Bacteria 1538
59 Ga0070696_100666707 3300005546 Bacteria 845
60 Ga0070665_100203227 3300005548 Bacteria 1981
61 Ga0070665_100239421 3300005548 Bacteria 1815
62 Ga0070665_100331801 3300005548 Bacteria 1526
63 Ga0070665_100666272 3300005548 Bacteria 1054
64 Ga0070665_101083601 3300005548 Bacteria 813
65 Ga0068857_100367229 3300005577 Bacteria 1335
66 Ga0068854_100199614 3300005578 Bacteria 1572
67 Ga0068856_101046791 3300005614 Bacteria 834
68 Ga0070702_100060804 3300005615 Bacteria 2197
69 Ga0070702_100168189 3300005615 Bacteria 1423
70 Ga0068852_100306518 3300005616 Bacteria 1539
71 Ga0068859_100029284 3300005617 Bacteria 5525
72 Ga0068859_100251109 3300005617 Bacteria 1859
73 Ga0068864_100046506 3300005618 Bacteria 3723
74 Ga0068866_10023778 3300005718 Bacteria 2854
75 Ga0068866_10045275 3300005718 Bacteria 2206
76 Ga0068866_10057568 3300005718 Bacteria 2003
77 Ga0068861_100068959 3300005719 Bacteria 2734
78 Ga0068861_100840926 3300005719 Bacteria 864
79 Ga0068870_10040279 3300005840 Bacteria 2422
80 Ga0068863_100056068 3300005841 Bacteria 3731
81 Ga0068863_100193746 3300005841 Bacteria 1954
82 Ga0068863_100702801 3300005841 Bacteria 1005
83 Ga0068858_100642780 3300005842 Bacteria 1031
84 Ga0068858_101445801 3300005842 Unclassified 677
85 Ga0068860_100215910 3300005843 Bacteria 1861
86 Ga0068860_100719797 3300005843 Bacteria 1009
87 Ga0068862_100088676 3300005844 Bacteria 2691
88 Ga0068862_100273439 3300005844 Bacteria 1546
89 Ga0068862_100352018 3300005844 Bacteria 1367
90 Ga0081455_10003527 3300005937 Bacteria 17955
91 Ga0081538_10093221 3300005981 Bacteria 1547
92 Ga0081540_1000495 3300005983 Bacteria 38740
93 Ga0081540_1007798 3300005983 Bacteria 7576
94 Ga0081540_1008944 3300005983 Bacteria 6938
95 Ga0081540_1025960 3300005983 Bacteria 3356
96 Ga0070717_10081285 3300006028 Bacteria 2720
97 Ga0070717_10155482 3300006028 Bacteria 1981
98 Ga0070717_10166677 3300006028 Bacteria 1914
99 Ga0075365_10065802 3300006038 Bacteria 2430
100 Ga0075365_10171925 3300006038 Bacteria 1512
101 Ga0075368_10121303 3300006042 Bacteria 1083
102 Ga0070715_10060758 3300006163 Bacteria 1658
103 Ga0070716_100001146 3300006173 Bacteria 11682
104 Ga0070716_100018019 3300006173 Bacteria 3673
105 Ga0070716_100282932 3300006173 Unclassified 1145
106 Ga0070716_100417616 3300006173 Bacteria 969
107 Ga0070712_100023666 3300006175 Bacteria 4061
108 Ga0070712_100129884 3300006175 Bacteria 1908
109 Ga0075367_10026015 3300006178 Unclassified 3314
110 Ga0075367_10148862 3300006178 Bacteria 1452
111 Ga0075369_10059818 3300006186 Bacteria 1660
112 Ga0075369_10320112 3300006186 Bacteria 725
113 Ga0075366_10194567 3300006195 Bacteria 1232
114 Ga0097621_100096052 3300006237 Bacteria 2487
115 Ga0097621_100321592 3300006237 Bacteria 1370
116 Ga0075370_10109601 3300006353 Bacteria 1602
117 Ga0075370_10462087 3300006353 Bacteria 764
118 Ga0075430_100250993 3300006846 Bacteria 1466
119 Ga0068865_100026519 3300006881 Bacteria 3821
120 Ga0068865_100052843 3300006881 Bacteria 2817
121 Ga0068865_100703378 3300006881 Bacteria 864
122 Ga0097620_100029284 3300006931 Bacteria 5525
123 Ga0097620_100251104 3300006931 Bacteria 1859
124 Ga0099794_10018752 3300007265 Bacteria 3105
125 Ga0099795_10018863 3300007788 Bacteria 2224
126 Ga0099795_10046862 3300007788 Bacteria 1559
127 Ga0099795_10126079 3300007788 Bacteria 1029
128 Ga0099795_10135300 3300007788 Bacteria 998
129 Ga0099795_10160293 3300007788 Bacteria 928
130 Ga0105244_10281193 3300009036 Unclassified 772
131 Ga0105250_10066255 3300009092 Bacteria 1456
132 Ga0105240_10958510 3300009093 Bacteria 917
133 Ga0111539_10690954 3300009094 Bacteria 1188
134 Ga0105245_10099750 3300009098 Bacteria 2685
135 Ga0105245_10153292 3300009098 Bacteria 2181
136 Ga0105245_10161666 3300009098 Bacteria 2125
137 Ga0105245_10372955 3300009098 Bacteria 1419
138 Ga0105247_10039579 3300009101 Bacteria 2880
139 Ga0105247_10185355 3300009101 Bacteria 1391
140 Ga0105247_10808112 3300009101 Bacteria 716
141 Ga0114129_11548311 3300009147 Bacteria 813
142 Ga0105243_10019251 3300009148 Bacteria 5175
143 Ga0105243_11405564 3300009148 Unclassified 719
144 Ga0105241_10038766 3300009174 Bacteria 3592
145 Ga0105241_10361574 3300009174 Bacteria 1263
146 Ga0105241_10412953 3300009174 Bacteria 1186
147 Ga0105241_10523054 3300009174 Bacteria 1061
148 Ga0105242_10178492 3300009176 Bacteria 1872
149 Ga0105248_10022881 3300009177 Bacteria 6939
150 Ga0105248_10267155 3300009177 Bacteria 1926
151 Ga0105248_10670817 3300009177 Bacteria 1170
152 Ga0105237_10593374 3300009545 Bacteria 1115
153 Ga0105238_10320155 3300009551 Bacteria 1537
154 Ga0105238_11030762 3300009551 Bacteria 844
155 Ga0105249_10109950 3300009553 Bacteria 2604
156 Ga0105249_10182677 3300009553 Bacteria 2042
157 Ga0105249_10371710 3300009553 Bacteria 1453
158 Ga0105249_10798776 3300009553 Bacteria 1007
159 Ga0105249_10941327 3300009553 Bacteria 932
160 Ga0099796_10009856 3300010159 Bacteria 2603
161 Ga0099796_10044660 3300010159 Bacteria 1515
162 Ga0099796_10083015 3300010159 Bacteria 1178
163 Ga0099796_10135882 3300010159 Bacteria 957
164 Ga0105239_10106118 3300010375 Bacteria 3112
165 Ga0105239_10155477 3300010375 Bacteria 2554
166 Ga0105239_10550923 3300010375 Bacteria 1313
167 Ga0105246_10027972 3300011119 Bacteria 3701
168 Ga0105246_10096065 3300011119 Bacteria 2147
169 Ga0157373_11053636 3300013100 Unclassified 609
170 Ga0157378_10221022 3300013297 Bacteria 1801
171 Ga0157378_10315190 3300013297 Bacteria 1518
172 Ga0157378_10759933 3300013297 Bacteria 993
173 Ga0163162_10072426 3300013306 Bacteria 3501
174 Ga0163162_10321748 3300013306 Bacteria 1679
175 Ga0157375_10187315 3300013308 Bacteria 2223
176 Ga0157375_10399516 3300013308 Bacteria 1541
177 Ga0157375_10545917 3300013308 Bacteria 1321
178 Ga0163163_10099941 3300014325 Bacteria 2923
179 Ga0163163_10127407 3300014325 Bacteria 2584
180 Ga0163163_10253884 3300014325 Bacteria 1809
181 Ga0163163_10635794 3300014325 Bacteria 1131
182 Ga0157380_10079956 3300014326 Bacteria 2671
183 Ga0157380_10141935 3300014326 Bacteria 2065
184 Ga0157380_10266565 3300014326 Bacteria 1559
185 Ga0157380_10332305 3300014326 Bacteria 1414
186 Ga0157377_10496015 3300014745 Bacteria 852
187 Ga0157377_10921061 3300014745 Bacteria 655
188 Ga0157377_11268901 3300014745 Bacteria 574
189 Ga0157379_10136668 3300014968 Bacteria 2208
190 Ga0157379_10176495 3300014968 Bacteria 1929
191 Ga0157379_10217634 3300014968 Bacteria 1730
192 Ga0157379_10875125 3300014968 Bacteria 851
193 Ga0157376_10037457 3300014969 Bacteria 3938
194 Ga0157376_10050946 3300014969 Bacteria 3437
195 Ga0163161_10990447 3300017792 Bacteria 717
196 Ga0213874_10015671 3300021377 Bacteria 2004
197 Ga0213876_10002386 3300021384 Bacteria 11055
198 Ga0209758_1010372 3300025297 Bacteria 5588
199 Ga0209758_1126507 3300025297 Bacteria 682
200 Ga0207697_10054168 3300025315 Bacteria 1662
201 Ga0207697_10098950 3300025315 Bacteria 1242
202 Ga0207656_10388197 3300025321 Unclassified 701
203 Ga0207682_10022243 3300025893 Bacteria 2497
204 Ga0207692_10001691 3300025898 Bacteria 8334
205 Ga0207692_10227850 3300025898 Bacteria 1108
206 Ga0207710_10017945 3300025900 Bacteria 3006
207 Ga0207710_10143341 3300025900 Bacteria 1155
208 Ga0207688_10104422 3300025901 Bacteria 1639
209 Ga0207688_10160053 3300025901 Bacteria 1334
210 Ga0207680_10075291 3300025903 Bacteria 2105
211 Ga0207647_10046422 3300025904 Bacteria 2707
212 Ga0207647_10062876 3300025904 Bacteria 2260
213 Ga0207685_10058284 3300025905 Bacteria 1518
214 Ga0207699_10004730 3300025906 Bacteria 6504
215 Ga0207684_10078346 3300025910 Bacteria 2811
216 Ga0207654_10216582 3300025911 Bacteria 1268
217 Ga0207654_10458084 3300025911 Bacteria 895
218 Ga0207654_10717167 3300025911 Bacteria 719
219 Ga0207693_10043055 3300025915 Bacteria 3554
220 Ga0207693_10305674 3300025915 Bacteria 1245
221 Ga0207663_10000913 3300025916 Bacteria 13487
222 Ga0207663_10122949 3300025916 Bacteria 1780
223 Ga0207663_10583090 3300025916 Bacteria 877
224 Ga0207649_10096908 3300025920 Bacteria 1944
225 Ga0207646_10229901 3300025922 Bacteria 1676
226 Ga0207659_10195632 3300025926 Bacteria 1611
227 Ga0207659_10334194 3300025926 Bacteria 1253
228 Ga0207687_10094327 3300025927 Bacteria 2190
229 Ga0207700_10035142 3300025928 Bacteria 3606
230 Ga0207700_10082165 3300025928 Bacteria 2518
231 Ga0207664_10005582 3300025929 Bacteria 8609
232 Ga0207664_10872407 3300025929 Bacteria 808
233 Ga0207644_10619765 3300025931 Unclassified 899
234 Ga0207690_10485771 3300025932 Bacteria 997
235 Ga0207706_10016927 3300025933 Bacteria 6576
236 Ga0207706_10586676 3300025933 Bacteria 958
237 Ga0207686_10024560 3300025934 Bacteria 3494
238 Ga0207686_10436864 3300025934 Bacteria 1004
239 Ga0207686_10481199 3300025934 Bacteria 960
240 Ga0207686_10752067 3300025934 Bacteria 778
241 Ga0207709_10136684 3300025935 Bacteria 1679
242 Ga0207709_10184589 3300025935 Bacteria 1476
243 Ga0207670_10031553 3300025936 Bacteria 3397
244 Ga0207670_10312221 3300025936 Bacteria 1235
245 Ga0207670_10398037 3300025936 Bacteria 1100
246 Ga0207669_10057731 3300025937 Bacteria 2364
247 Ga0207669_10269750 3300025937 Bacteria 1277
248 Ga0207704_10212068 3300025938 Bacteria 1426
249 Ga0207704_10239331 3300025938 Bacteria 1355
250 Ga0207704_10387135 3300025938 Bacteria 1099
251 Ga0207704_10409387 3300025938 Bacteria 1072
252 Ga0207665_10003473 3300025939 Bacteria 10529
253 Ga0207665_10018338 3300025939 Bacteria 4599
254 Ga0207665_10063205 3300025939 Bacteria 2514
255 Ga0207665_10750323 3300025939 Unclassified 769
256 Ga0207691_10013018 3300025940 Bacteria 7966
257 Ga0207691_10160925 3300025940 Unclassified 1970
258 Ga0207711_10153214 3300025941 Bacteria 2081
259 Ga0207711_10362000 3300025941 Bacteria 1344
260 Ga0207689_10064471 3300025942 Bacteria 3014
261 Ga0207689_10149863 3300025942 Bacteria 1923
262 Ga0207689_10339724 3300025942 Bacteria 1247
263 Ga0207661_10079488 3300025944 Bacteria 2703
264 Ga0207679_11064795 3300025945 Bacteria 742
265 Ga0207651_10223412 3300025960 Bacteria 1524
266 Ga0207651_10585149 3300025960 Bacteria 974
267 Ga0207712_10013989 3300025961 Bacteria 5150
268 Ga0207712_10193303 3300025961 Bacteria 1608
269 Ga0207712_10280494 3300025961 Bacteria 1360
270 Ga0207668_10219615 3300025972 Bacteria 1525
271 Ga0207668_10268965 3300025972 Bacteria 1392
272 Ga0207668_10641963 3300025972 Unclassified 928
273 Ga0207640_10054381 3300025981 Bacteria 2617
274 Ga0207640_10187204 3300025981 Bacteria 1557
275 Ga0207640_10351064 3300025981 Unclassified 1185
276 Ga0207658_10161489 3300025986 Bacteria 1837
277 Ga0207658_10334040 3300025986 Bacteria 1315
278 Ga0207658_10631385 3300025986 Bacteria 964
279 Ga0207677_10108408 3300026023 Bacteria 2062
280 Ga0207677_10968007 3300026023 Bacteria 770
281 Ga0207703_10075749 3300026035 Bacteria 2789
282 Ga0207703_10194024 3300026035 Bacteria 1801
283 Ga0207703_10942682 3300026035 Bacteria 827
284 Ga0207639_10113994 3300026041 Bacteria 2208
285 Ga0207639_10429629 3300026041 Bacteria 1196
286 Ga0207678_10016553 3300026067 Bacteria 6475
287 Ga0207678_10109499 3300026067 Bacteria 2356
288 Ga0207708_10151052 3300026075 Bacteria 1828
289 Ga0207708_10182524 3300026075 Bacteria 1666
290 Ga0207708_10485143 3300026075 Bacteria 1034
291 Ga0207708_10692570 3300026075 Bacteria 870
292 Ga0207702_10108002 3300026078 Bacteria 2469
293 Ga0207648_10163870 3300026089 Bacteria 1964
294 Ga0207648_10592232 3300026089 Unclassified 1021
295 Ga0207676_10046101 3300026095 Bacteria 3371
296 Ga0207676_10197727 3300026095 Bacteria 1774
297 Ga0207674_10493060 3300026116 Bacteria 1184
298 Ga0207675_100098666 3300026118 Bacteria 2751
299 Ga0207675_100118515 3300026118 Bacteria 2503
300 Ga0207675_100148895 3300026118 Bacteria 2227
301 Ga0207683_10082518 3300026121 Bacteria 2856
302 Ga0207683_10090429 3300026121 Bacteria 2726
303 Ga0207683_10163996 3300026121 Bacteria 2010
304 Ga0207683_10285669 3300026121 Bacteria 1508
305 Ga0207683_10288343 3300026121 Bacteria 1501
306 Ga0207683_10328278 3300026121 Bacteria 1402
307 Ga0207698_10054430 3300026142 Bacteria 3079
308 Ga0207698_10351428 3300026142 Bacteria 1392
309 Ga0209179_1016984 3300027512 Bacteria 1372
310 Ga0268265_10057891 3300028380 Bacteria 2956
311 Ga0268265_10250533 3300028380 Bacteria 1568
312 Ga0268265_10638457 3300028380 Bacteria 1022
313 Ga0268264_10218295 3300028381 Bacteria 1754
314 Ga0268264_10265686 3300028381 Bacteria 1601
315 Ga0268264_10303307 3300028381 Bacteria 1504
316 Ga0307517_10125888 3300028786 Bacteria 1870
317 Ga0307517_10148529 3300028786 Bacteria 1617
318 Ga0307515_10375225 3300028794 Bacteria 1057
319 Ga0307508_10278024 3300031616 Bacteria 1268
320 Ga0307410_10326565 3300031852 Bacteria 1219
321 Ga0307415_100194199 3300032126 Bacteria 1604
322 Ga0307507_10207332 3300033179 Bacteria 1344
323 Ga0307507_10444279 3300033179 Bacteria 719
324 Ga0316215_1001455 3300033544 Bacteria 2278
325 Ga0316215_1011467 3300033544 Unclassified 878
326 Ga0373936_0001864 3300035113 Bacteria 7777
327 Ga0373945_0024482 3300035116 Bacteria 2092
328 Ga0373954_0010183 3300035118 Bacteria 4144
329 Ga0373957_0023439 3300035120 Bacteria 2208
330 Ga0373943_0051126 3300035170 Bacteria 2033
331 Ga0373943_0331234 3300035170 Bacteria 869
332 Ga0373955_0151247 3300035172 Bacteria 1366
333 Ga0373931_0246858 3300035691 Bacteria 1084
334 Ga0373935_0004206 3300035692 Bacteria 8433
335 Ga0373935_0071982 3300035692 Bacteria 2231
336 Ga0373935_0125574 3300035692 Bacteria 1719
337 Ga0373935_0364022 3300035692 Bacteria 1033
338 Ga0373927_0000346 3300035695 Bacteria 36389
339 Ga0373947_0004475 3300035725 Bacteria 8204
340 Ga0373947_0014011 3300035725 Bacteria 4596
341 Ga0373947_0101668 3300035725 Bacteria 1807
342 Ga0373947_0104181 3300035725 Bacteria 1786
343 Ga0373937_0013906 3300036401 Bacteria 7096
344 Ga0372808_003542 3300036459 Bacteria 1926
345 Ga0373925_0019952 3300037068 Bacteria 4876
346 Ga0373925_0044895 3300037068 Bacteria 3282
347 Ga0373925_0553978 3300037068 Bacteria 946
348 Ga0436365_0167764 3300039437 Bacteria 15121
349 Ga0436363_0631978 3300039450 Bacteria 3584
350 Ga0436362_0566712 3300039453 Bacteria 6863
351 Ga0439465_0033482 3300041413 Bacteria 1643
352 Ga0451833_0677466 3300041491 Bacteria 1074
353 Ga0451851_0357819 3300041507 Bacteria 823
354 Ga0451855_1787388 3300041511 Bacteria 666
355 Ga0495617_044435 3300046452 Bacteria 1482
356 Ga0495617_107410 3300046452 Bacteria 904
357 Ga0495592_0184729 3300046454 Bacteria 1417
358 Ga0495592_0494402 3300046454 Bacteria 760
359 Ga0495603_0000092 3300046455 Bacteria 40980
360 Ga0495603_0037672 3300046455 Bacteria 2901
361 Ga0495603_0038436 3300046455 Bacteria 2870
362 Ga0495603_0159101 3300046455 Bacteria 1310
363 Ga0495603_0296606 3300046455 Bacteria 928
364 Ga0495629_0000181 3300046459 Bacteria 56739
365 Ga0495629_0160791 3300046459 Bacteria 1560
366 Ga0495629_0434548 3300046459 Bacteria 890
367 Ga0495638_0078390 3300046460 Bacteria 2010
368 Ga0495638_0233949 3300046460 Bacteria 1021
369 Ga0495638_0266238 3300046460 Bacteria 937
370 Ga0495641_0011146 3300046461 Bacteria 5147
371 Ga0495641_0108798 3300046461 Bacteria 1237
372 Ga0495641_0151856 3300046461 Bacteria 1035
373 Ga0495651_0039984 3300046462 Bacteria 3647
374 Ga0495580_0001467 3300046472 Bacteria 20684
375 Ga0495580_0225765 3300046472 Bacteria 1286
376 Ga0495580_0250639 3300046472 Bacteria 1212
377 Ga0495582_0000039 3300046473 Bacteria 66883
378 Ga0495605_0030388 3300046474 Bacteria 2771
379 Ga0495639_0000441 3300046475 Bacteria 19762
380 Ga0495639_0170231 3300046475 Bacteria 1057
381 Ga0495662_0005888 3300046476 Bacteria 6129
382 Ga0495664_0003150 3300046477 Bacteria 8954
383 Ga0495664_0081494 3300046477 Bacteria 1940
384 Ga0495584_0100044 3300046491 Bacteria 1465
385 Ga0495584_0158030 3300046491 Bacteria 1152
386 Ga0495584_0292238 3300046491 Bacteria 828
387 Ga0495585_0034574 3300046492 Bacteria 2857
388 Ga0495585_0053318 3300046492 Bacteria 2238
389 Ga0495585_0288459 3300046492 Bacteria 809
390 Ga0495585_0328772 3300046492 Bacteria 746
391 Ga0495594_0003721 3300046499 Bacteria 7825
392 Ga0495594_0065159 3300046499 Bacteria 2021
393 Ga0495596_0025606 3300046500 Bacteria 2384
394 Ga0495596_0039506 3300046500 Bacteria 1864
395 Ga0495583_0107245 3300046506 Bacteria 1187
396 Ga0495606_0091946 3300046507 Bacteria 1864
397 Ga0495606_0312934 3300046507 Bacteria 847
398 Ga0495608_0072459 3300046511 Bacteria 2247
399 Ga0495610_0038651 3300046512 Bacteria 2421
400 Ga0495618_0254870 3300046514 Bacteria 1100
401 Ga0495620_0085936 3300046515 Bacteria 1267
402 Ga0495620_0190567 3300046515 Bacteria 791
403 Ga0495628_0018693 3300046516 Bacteria 5735
404 Ga0495628_0072270 3300046516 Bacteria 2688
405 Ga0495630_0006011 3300046517 Bacteria 8588
406 Ga0495630_0187259 3300046517 Bacteria 1579
407 Ga0495631_0114076 3300046518 Bacteria 1162
408 Ga0495632_0129796 3300046519 Bacteria 1173
409 Ga0495643_0373089 3300046522 Bacteria 634
410 Ga0495644_0026609 3300046523 Bacteria 2194
411 Ga0495644_0034953 3300046523 Bacteria 1897
412 Ga0495644_0303845 3300046523 Bacteria 624
413 Ga0495648_0003582 3300046524 Bacteria 13586
414 Ga0495648_0088529 3300046524 Bacteria 1740
415 Ga0495648_0154974 3300046524 Bacteria 1191
416 Ga0495648_0270865 3300046524 Bacteria 810
417 Ga0495663_0050520 3300046525 Bacteria 1286
418 Ga0495663_0188494 3300046525 Bacteria 716
419 Ga0495666_0258054 3300046526 Bacteria 793
420 Ga0495652_0225938 3300046529 Bacteria 1403
421 Ga0495665_0000079 3300046531 Bacteria 42321
422 Ga0495586_0207482 3300046535 Bacteria 1111
423 Ga0495587_0017867 3300046536 Bacteria 4399
424 Ga0495598_0119691 3300046537 Bacteria 891
425 Ga0495609_0031905 3300046538 Bacteria 2394
426 Ga0495609_0081094 3300046538 Bacteria 1418
427 Ga0495621_0133165 3300046539 Bacteria 968
428 Ga0495621_0143384 3300046539 Bacteria 936
429 Ga0495597_0015074 3300046542 Bacteria 3666
430 Ga0495645_0004402 3300046543 Bacteria 9625
431 Ga0495622_0010703 3300046557 Bacteria 4232
432 Ga0495622_0164283 3300046557 Bacteria 1000
433 Ga0495633_0031646 3300046558 Bacteria 2562
434 Ga0495667_0056172 3300046559 Bacteria 2589
435 Ga0495667_0433923 3300046559 Bacteria 826
436 Ga0495667_0434757 3300046559 Bacteria 825
437 Ga0495656_0042510 3300046615 Bacteria 1903
438 Ga0495656_0205744 3300046615 Bacteria 978
439 Ga0495668_0102886 3300046616 Bacteria 1562
440 Ga0495634_0003577 3300046642 Bacteria 12427
441 Ga0495611_0075709 3300046648 Bacteria 1542
442 Ga0495611_0234414 3300046648 Bacteria 852
443 Ga0495625_0080148 3300046660 Bacteria 2274
444 Ga0495625_0279369 3300046660 Bacteria 1075
445 Ga0495635_0005863 3300046663 Bacteria 8560
446 Ga0495659_0090238 3300046664 Bacteria 1175
447 Ga0495661_0133635 3300046665 Bacteria 1357
448 Ga0495661_0168305 3300046665 Bacteria 1171
449 Ga0495661_0347529 3300046665 Unclassified 731
450 Ga0495588_0003177 3300046674 Bacteria 7110
451 Ga0495657_0351107 3300046675 Bacteria 873
452 Ga0495599_0085930 3300046678 Bacteria 1964
453 Ga0495623_0011342 3300046679 Bacteria 5766
454 Ga0495646_0222366 3300046680 Bacteria 1020
455 Ga0495647_0001821 3300046681 Bacteria 6593
456 Ga0495647_0082329 3300046681 Bacteria 1307
457 Ga0495647_0333745 3300046681 Bacteria 688
458 Ga0495658_0002050 3300046683 Bacteria 10251
459 Ga0495669_0009639 3300046684 Bacteria 4074
460 Ga0495669_0027352 3300046684 Bacteria 2495
461 Ga0495669_0040182 3300046684 Bacteria 2074
462 Ga0495669_0063135 3300046684 Bacteria 1680
463 Ga0495669_0079955 3300046684 Bacteria 1499
464 Ga0495669_0157906 3300046684 Bacteria 1076
465 Ga0495613_0036095 3300046689 Bacteria 3665
466 Ga0495613_0078062 3300046689 Bacteria 2409
467 Ga0495624_0001851 3300046690 Bacteria 16133
468 Ga0495624_0164762 3300046690 Bacteria 1353
469 Ga0495624_0172577 3300046690 Bacteria 1319
470 Ga0495670_0099798 3300046691 Bacteria 1494
471 Ga0495670_0195448 3300046691 Bacteria 1070
472 Ga0495671_0143601 3300046692 Bacteria 1163
473 Ga0495649_0061839 3300046694 Bacteria 2013
474 Ga0495589_0168281 3300046794 Bacteria 1042
475 Ga0495600_0067336 3300046809 Bacteria 2341
476 Ga0495600_0084110 3300046809 Bacteria 2076
477 Ga0495660_0077235 3300046810 Bacteria 1753
478 Ga0495660_0152311 3300046810 Bacteria 1141
479 Ga0495660_0246813 3300046810 Bacteria 830
480 Ga0495581_0006605 3300047315 Bacteria 6720
481 Ga0495581_0244044 3300047315 Bacteria 1050
482 Ga0495604_0333904 3300047317 Bacteria 1010
483 Ga0495674_0017939 3300047319 Bacteria 6589
484 Ga0495674_0240090 3300047319 Bacteria 1493
485 Ga0495676_0060339 3300047321 Bacteria 2973
486 Ga0495676_0232085 3300047321 Bacteria 1267
487 Ga0495680_0036741 3300047322 Bacteria 3929
488 Ga0495683_0185831 3300047323 Bacteria 946
489 Ga0495683_0379169 3300047323 Bacteria 592
490 Ga0495677_0138805 3300047445 Unclassified 933
491 Ga0495685_070258 3300047447 Bacteria 1173
492 Ga0495685_229438 3300047447 Bacteria 591
493 Ga0495673_0021367 3300047469 Bacteria 3197
494 Ga0495673_0035858 3300047469 Bacteria 2281
495 Ga0495673_0139508 3300047469 Bacteria 946
496 Ga0495681_0055461 3300047470 Bacteria 1848
497 Ga0495681_0205025 3300047470 Bacteria 798
498 Ga0495686_0098312 3300047472 Bacteria 1769
499 Ga0495686_0119997 3300047472 Bacteria 1569
500 Ga0495686_0293251 3300047472 Bacteria 900
501 Ga0495686_0380402 3300047472 Unclassified 762
502 Ga0495593_0016763 3300047673 Bacteria 4126
503 Ga0495593_0060687 3300047673 Bacteria 1980
504 Ga0495602_0385272 3300048088 Bacteria 1003
505 Ga0495615_0033921 3300048090 Unclassified 1239
506 Ga0495626_0051688 3300048091 Bacteria 1895
507 Ga0496102_0088442 3300048905 Bacteria 2864
508 Ga0496102_0122254 3300048905 Bacteria 2432
509 Ga0496102_0466803 3300048905 Unclassified 1183
510 Ga0496102_0737139 3300048905 Bacteria 908
511 Ga0496103_0177716 3300048906 Bacteria 1368
512 Ga0496104_0308317 3300048907 Bacteria 1496
513 Ga0496106_0588347 3300048909 Bacteria 892
514 Ga0496108_0051359 3300048911 Bacteria 3454
515 Ga0496108_0153916 3300048911 Bacteria 1985
516 Ga0496109_0364977 3300048912 Bacteria 1364
517 Ga0496111_0801562 3300048914 Bacteria 682
518 Ga0496112_0126686 3300048915 Bacteria 2524
519 Ga0496112_0574688 3300048915 Bacteria 1060
520 Ga0496113_0896402 3300048916 Bacteria 702
521 Ga0496114_0067698 3300048917 Bacteria 2996
522 Ga0496114_0296517 3300048917 Bacteria 1427
523 Ga0496114_0554036 3300048917 Bacteria 1016
524 Ga0496115_0132306 3300048918 Bacteria 2056
525 Ga0496115_0167659 3300048918 Bacteria 1816
526 Ga0496115_0329939 3300048918 Bacteria 1247
527 Ga0496115_0436182 3300048918 Bacteria 1060
528 Ga0496118_0164602 3300048921 Bacteria 1365
529 Ga0496118_0246039 3300048921 Bacteria 1020
530 Ga0496121_0071763 3300048924 Bacteria 2783
531 Ga0496121_0238890 3300048924 Bacteria 1267
532 Ga0496124_0336558 3300048927 Bacteria 1074
533 Ga0496124_0621202 3300048927 Bacteria 699
534 Ga0496126_0043411 3300048929 Bacteria 4147
535 Ga0496126_0551026 3300048929 Bacteria 915
536 Ga0495678_087702 3300049459 Bacteria 1103
537 Ga0495682_0122970 3300049460 Bacteria 929
538 Ga0501208_092493 3300049655 Bacteria 637
539 nmdc:mga03683_30494_c1 3300050489 Bacteria 2158
540 nmdc:mga03683_36173_c1 3300050489 Bacteria 2007
541 nmdc:mga03n38_537543_c1 3300050490 Bacteria 660
542 nmdc:mga03n38_63452_c1 3300050490 Bacteria 1688
543 nmdc:mga00v17_28474_c1 3300050491 Bacteria 3272
544 nmdc:mga00v17_286035_c1 3300050491 Bacteria 1070
545 nmdc:mga0yw44_20761_c1 3300050492 Bacteria 3652
546 nmdc:mga0yw44_31687_c1 3300050492 Bacteria 3076
547 nmdc:mga0yw44_55344_c1 3300050492 Bacteria 2414
548 nmdc:mga0yw44_75243_c1 3300050492 Bacteria 2105
549 nmdc:mga0k408_15156_c1 3300050493 Bacteria 4260
550 nmdc:mga0k408_69445_c1 3300050493 Bacteria 2056
551 nmdc:mga0k408_735429_c1 3300050493 Bacteria 577
552 nmdc:mga06z11_31990_c1 3300050494 Bacteria 2562
553 nmdc:mga06z11_6909_c1 3300050494 Bacteria 4647
554 nmdc:mga07m45_21870_c1 3300050496 Bacteria 3487
555 nmdc:mga07m45_360741_c1 3300050496 Bacteria 844
556 nmdc:mga05p37_34988_c1 3300050507 Bacteria 6157
557 nmdc:mga0qj67_260558_c1 3300050509 Bacteria 1406
558 nmdc:mga08y16_230510_c1 3300050511 Bacteria 1915
559 nmdc:mga08y16_84329_c1 3300050511 Bacteria 3312
560 nmdc:mga0sz30_21752_c1 3300050516 Bacteria 2598
561 Ga0495601_0018781 3300053077 Bacteria 4209
562 Ga0495595_0020835 3300053084 Bacteria 2857
563 Ga0495595_0217972 3300053084 Bacteria 952
564 Ga0495619_0284272 3300053085 Bacteria 1146
565 Ga0495619_0390426 3300053085 Bacteria 961
566 Ga0500646_0066222 3300053090 Bacteria 1074
567 Ga0500646_0183575 3300053090 Bacteria 710
568 Ga0500583_0014620 3300053092 Bacteria 3080
569 Ga0500583_0089442 3300053092 Bacteria 1497
570 Ga0500641_0014496 3300053096 Bacteria 2910
571 Ga0500641_0056557 3300053096 Bacteria 1625
572 Ga0500641_0190025 3300053096 Bacteria 879
573 Ga0500650_0112753 3300053098 Bacteria 1269
574 Ga0500594_0011707 3300053118 Bacteria 2052
575 Ga0500642_0197602 3300053130 Bacteria 937
576 Ga0500642_0242865 3300053130 Bacteria 829
577 Ga0500655_070224 3300053133 Bacteria 713
578 Ga0500658_0005778 3300053134 Bacteria 4609
579 Ga0500658_0061664 3300053134 Bacteria 1560
580 Ga0500568_0142650 3300053139 Bacteria 887
581 Ga0500588_0046052 3300053146 Bacteria 1339
582 Ga0500589_240509 3300053147 Bacteria 670
583 Ga0500627_0154569 3300053158 Bacteria 1036
584 Ga0500633_0014628 3300053160 Bacteria 2232
585 Ga0500634_0020472 3300053161 Bacteria 3577
586 Ga0500634_0050881 3300053161 Bacteria 2230
587 Ga0500645_003078 3300053730 Bacteria 6991
588 Ga0500645_077088 3300053730 Bacteria 953
589 2723845097 2721755755 Bacteria 8322773
590 2793082035
591 2889039855 2889033259 Bacteria 9099371
592 2908742689 2908739725 Bacteria 8628932
593 2922365340 2922361189 Bacteria 7436256
594 8006930167 8006926726 Bacteria 6749210
595 8006987062 8006984368 Bacteria 9651211
596 8056673881 8056673599 Bacteria 7871253
597 Ga0209179_1019899
598 CNAas_1002968
599 JGI24750J21931_1010725
600 JGI24744J21845_10008218
601 JGI24744J21845_10025555
602 JGI24034J26672_10027634
603 JGI24742J22300_10034046
604 Ga0070670_100336388
605 Ga0068869_101160593
606 Ga0070682_100503917
607 Ga0068868_100068141
608 Ga0070691_10187559
609 Ga0070687_100276702
610 Ga0070692_10317390
611 Ga0070668_100006633
612 Ga0070668_100273898
613 Ga0070675_100054499
614 Ga0070675_100127729
615 Ga0070674_100014014
616 Ga0070674_100054664
617 Ga0070674_100176925
618 Ga0070673_100807142
619 Ga0070688_100675382
620 Ga0070667_100053576
621 Ga0070667_100070942
622 Ga0070667_100276388
623 Ga0070667_100405138
624 Ga0070667_100425218
625 Ga0070667_100939784
626 Ga0070709_10002309
627 Ga0070714_100003388
628 Ga0070714_100090547
629 Ga0070713_100007424
630 Ga0070713_100008603
631 Ga0070710_10000869
632 Ga0070711_100003540
633 Ga0070705_100581326
634 Ga0070700_100018292
635 Ga0070700_100163750
636 Ga0070694_100376627
637 Ga0070663_100117852
638 Ga0070663_100331020
639 Ga0070663_100956726
640 Ga0070678_100120694
641 Ga0070678_100300184
642 Ga0070678_100344286
643 Ga0070678_100518995
644 Ga0070662_100165558
645 Ga0070662_100470223
646 Ga0070707_100139164
647 Ga0070698_100182348
648 Ga0070699_100094324
649 Ga0070679_101614572
650 Ga0070684_100300127
651 Ga0070672_100115427
652 Ga0070672_100386699
653 Ga0070686_100166441
654 Ga0070695_100169847
655 Ga0070696_100666707
656 Ga0070665_100203227
657 Ga0070665_100239421
658 Ga0070665_100331801
659 Ga0070665_100666272
660 Ga0070665_101083601
661 Ga0068857_100367229
662 Ga0068854_100199614
663 Ga0068856_101046791
664 Ga0070702_100060804
665 Ga0070702_100168189
666 Ga0068852_100306518
667 Ga0068859_100029284
668 Ga0068859_100251109
669 Ga0068864_100046506
670 Ga0068866_10023778
671 Ga0068866_10045275
672 Ga0068866_10057568
673 Ga0068861_100068959
674 Ga0068861_100840926
675 Ga0068870_10040279
676 Ga0068863_100056068
677 Ga0068863_100193746
678 Ga0068863_100702801
679 Ga0068858_100642780
680 Ga0068858_101445801
681 Ga0068860_100215910
682 Ga0068860_100719797
683 Ga0068862_100088676
684 Ga0068862_100273439
685 Ga0068862_100352018
686 Ga0081455_10003527
687 Ga0081538_10093221
688 Ga0081540_1000495
689 Ga0081540_1007798
690 Ga0081540_1008944
691 Ga0081540_1025960
692 Ga0070717_10081285
693 Ga0070717_10155482
694 Ga0070717_10166677
695 Ga0075365_10065802
696 Ga0075365_10171925
697 Ga0075368_10121303
698 Ga0070715_10060758
699 Ga0070716_100001146
700 Ga0070716_100018019
701 Ga0070716_100282932
702 Ga0070716_100417616
703 Ga0070712_100023666
704 Ga0070712_100129884
705 Ga0075367_10026015
706 Ga0075367_10148862
707 Ga0075369_10059818
708 Ga0075369_10320112
709 Ga0075366_10194567
710 Ga0097621_100096052
711 Ga0097621_100321592
712 Ga0075370_10109601
713 Ga0075370_10462087
714 Ga0075430_100250993
715 Ga0068865_100026519
716 Ga0068865_100052843
717 Ga0068865_100703378
718 Ga0097620_100029284
719 Ga0097620_100251104
720 Ga0099794_10018752
721 Ga0099795_10018863
722 Ga0099795_10046862
723 Ga0099795_10126079
724 Ga0099795_10135300
725 Ga0099795_10160293
726 Ga0105244_10281193
727 Ga0105250_10066255
728 Ga0105240_10958510
729 Ga0111539_10690954
730 Ga0105245_10099750
731 Ga0105245_10153292
732 Ga0105245_10161666
733 Ga0105245_10372955
734 Ga0105247_10039579
735 Ga0105247_10185355
736 Ga0105247_10808112
737 Ga0114129_11548311
738 Ga0105243_10019251
739 Ga0105243_11405564
740 Ga0105241_10038766
741 Ga0105241_10361574
742 Ga0105241_10412953
743 Ga0105241_10523054
744 Ga0105242_10178492
745 Ga0105248_10022881
746 Ga0105248_10267155
747 Ga0105248_10670817
748 Ga0105237_10593374
749 Ga0105238_10320155
750 Ga0105238_11030762
751 Ga0105249_10109950
752 Ga0105249_10182677
753 Ga0105249_10371710
754 Ga0105249_10798776
755 Ga0105249_10941327
756 Ga0099796_10009856
757 Ga0099796_10044660
758 Ga0099796_10083015
759 Ga0099796_10135882
760 Ga0105239_10106118
761 Ga0105239_10155477
762 Ga0105239_10550923
763 Ga0105246_10027972
764 Ga0105246_10096065
765 Ga0157373_11053636
766 Ga0157378_10221022
767 Ga0157378_10315190
768 Ga0157378_10759933
769 Ga0163162_10072426
770 Ga0163162_10321748
771 Ga0157375_10187315
772 Ga0157375_10399516
773 Ga0157375_10545917
774 Ga0163163_10099941
775 Ga0163163_10127407
776 Ga0163163_10253884
777 Ga0163163_10635794
778 Ga0157380_10079956
779 Ga0157380_10141935
780 Ga0157380_10266565
781 Ga0157380_10332305
782 Ga0157377_10496015
783 Ga0157377_10921061
784 Ga0157377_11268901
785 Ga0157379_10136668
786 Ga0157379_10176495
787 Ga0157379_10217634
788 Ga0157379_10875125
789 Ga0157376_10037457
790 Ga0157376_10050946
791 Ga0163161_10990447
792 Ga0213874_10015671
793 Ga0213876_10002386
794 Ga0209758_1010372
795 Ga0209758_1126507
796 Ga0207697_10054168
797 Ga0207697_10098950
798 Ga0207656_10388197
799 Ga0207682_10022243
800 Ga0207692_10001691
801 Ga0207692_10227850
802 Ga0207710_10017945
803 Ga0207710_10143341
804 Ga0207688_10104422
805 Ga0207688_10160053
806 Ga0207680_10075291
807 Ga0207647_10046422
808 Ga0207647_10062876
809 Ga0207685_10058284
810 Ga0207699_10004730
811 Ga0207684_10078346
812 Ga0207654_10216582
813 Ga0207654_10458084
814 Ga0207654_10717167
815 Ga0207693_10043055
816 Ga0207693_10305674
817 Ga0207663_10000913
818 Ga0207663_10122949
819 Ga0207663_10583090
820 Ga0207649_10096908
821 Ga0207646_10229901
822 Ga0207659_10195632
823 Ga0207659_10334194
824 Ga0207687_10094327
825 Ga0207700_10035142
826 Ga0207700_10082165
827 Ga0207664_10005582
828 Ga0207664_10872407
829 Ga0207644_10619765
830 Ga0207690_10485771
831 Ga0207706_10016927
832 Ga0207706_10586676
833 Ga0207686_10024560
834 Ga0207686_10436864
835 Ga0207686_10481199
836 Ga0207686_10752067
837 Ga0207709_10136684
838 Ga0207709_10184589
839 Ga0207670_10031553
840 Ga0207670_10312221
841 Ga0207670_10398037
842 Ga0207669_10057731
843 Ga0207669_10269750
844 Ga0207704_10212068
845 Ga0207704_10239331
846 Ga0207704_10387135
847 Ga0207704_10409387
848 Ga0207665_10003473
849 Ga0207665_10018338
850 Ga0207665_10063205
851 Ga0207665_10750323
852 Ga0207691_10013018
853 Ga0207691_10160925
854 Ga0207711_10153214
855 Ga0207711_10362000
856 Ga0207689_10064471
857 Ga0207689_10149863
858 Ga0207689_10339724
859 Ga0207661_10079488
860 Ga0207679_11064795
861 Ga0207651_10223412
862 Ga0207651_10585149
863 Ga0207712_10013989
864 Ga0207712_10193303
865 Ga0207712_10280494
866 Ga0207668_10219615
867 Ga0207668_10268965
868 Ga0207668_10641963
869 Ga0207640_10054381
870 Ga0207640_10187204
871 Ga0207640_10351064
872 Ga0207658_10161489
873 Ga0207658_10334040
874 Ga0207658_10631385
875 Ga0207677_10108408
876 Ga0207677_10968007
877 Ga0207703_10075749
878 Ga0207703_10194024
879 Ga0207703_10942682
880 Ga0207639_10113994
881 Ga0207639_10429629
882 Ga0207678_10016553
883 Ga0207678_10109499
884 Ga0207708_10151052
885 Ga0207708_10182524
886 Ga0207708_10485143
887 Ga0207708_10692570
888 Ga0207702_10108002
889 Ga0207648_10163870
890 Ga0207648_10592232
891 Ga0207676_10046101
892 Ga0207676_10197727
893 Ga0207674_10493060
894 Ga0207675_100098666
895 Ga0207675_100118515
896 Ga0207675_100148895
897 Ga0207683_10082518
898 Ga0207683_10090429
899 Ga0207683_10163996
900 Ga0207683_10285669
901 Ga0207683_10288343
902 Ga0207683_10328278
903 Ga0207698_10054430
904 Ga0207698_10351428
905 Ga0209179_1016984
906 Ga0268265_10057891
907 Ga0268265_10250533
908 Ga0268265_10638457
909 Ga0268264_10218295
910 Ga0268264_10265686
911 Ga0268264_10303307
912 Ga0307517_10125888
913 Ga0307517_10148529
914 Ga0307515_10375225
915 Ga0307508_10278024
916 Ga0307410_10326565
917 Ga0307415_100194199
918 Ga0307507_10207332
919 Ga0307507_10444279
920 Ga0316215_1001455
921 Ga0316215_1011467
922 Ga0373936_0001864
923 Ga0373945_0024482
924 Ga0373954_0010183
925 Ga0373957_0023439
926 Ga0373943_0051126
927 Ga0373943_0331234
928 Ga0373955_0151247
929 Ga0373931_0246858
930 Ga0373935_0004206
931 Ga0373935_0071982
932 Ga0373935_0125574
933 Ga0373935_0364022
934 Ga0373927_0000346
935 Ga0373947_0004475
936 Ga0373947_0014011
937 Ga0373947_0101668
938 Ga0373947_0104181
939 Ga0373937_0013906
940 Ga0372808_003542
941 Ga0373925_0019952
942 Ga0373925_0044895
943 Ga0373925_0553978
944 Ga0436365_0167764
945 Ga0436363_0631978
946 Ga0436362_0566712
947 Ga0439465_0033482
948 Ga0451833_0677466
949 Ga0451851_0357819
950 Ga0451855_1787388
951 Ga0495617_044435
952 Ga0495617_107410
953 Ga0495592_0184729
954 Ga0495592_0494402
955 Ga0495603_0000092
956 Ga0495603_0037672
957 Ga0495603_0038436
958 Ga0495603_0159101
959 Ga0495603_0296606
960 Ga0495629_0000181
961 Ga0495629_0160791
962 Ga0495629_0434548
963 Ga0495638_0078390
964 Ga0495638_0233949
965 Ga0495638_0266238
966 Ga0495641_0011146
967 Ga0495641_0108798
968 Ga0495641_0151856
969 Ga0495651_0039984
970 Ga0495580_0001467
971 Ga0495580_0225765
972 Ga0495580_0250639
973 Ga0495582_0000039
974 Ga0495605_0030388
975 Ga0495639_0000441
976 Ga0495639_0170231
977 Ga0495662_0005888
978 Ga0495664_0003150
979 Ga0495664_0081494
980 Ga0495584_0100044
981 Ga0495584_0158030
982 Ga0495584_0292238
983 Ga0495585_0034574
984 Ga0495585_0053318
985 Ga0495585_0288459
986 Ga0495585_0328772
987 Ga0495594_0003721
988 Ga0495594_0065159
989 Ga0495596_0025606
990 Ga0495596_0039506
991 Ga0495583_0107245
992 Ga0495606_0091946
993 Ga0495606_0312934
994 Ga0495608_0072459
995 Ga0495610_0038651
996 Ga0495618_0254870
997 Ga0495620_0085936
998 Ga0495620_0190567
999 Ga0495628_0018693
1000 Ga0495628_0072270
1001 Ga0495630_0006011
1002 Ga0495630_0187259
1003 Ga0495631_0114076
1004 Ga0495632_0129796
1005 Ga0495643_0373089
1006 Ga0495644_0026609
1007 Ga0495644_0034953
1008 Ga0495644_0303845
1009 Ga0495648_0003582
1010 Ga0495648_0088529
1011 Ga0495648_0154974
1012 Ga0495648_0270865
1013 Ga0495663_0050520
1014 Ga0495663_0188494
1015 Ga0495666_0258054
1016 Ga0495652_0225938
1017 Ga0495665_0000079
1018 Ga0495586_0207482
1019 Ga0495587_0017867
1020 Ga0495598_0119691
1021 Ga0495609_0031905
1022 Ga0495609_0081094
1023 Ga0495621_0133165
1024 Ga0495621_0143384
1025 Ga0495597_0015074
1026 Ga0495645_0004402
1027 Ga0495622_0010703
1028 Ga0495622_0164283
1029 Ga0495633_0031646
1030 Ga0495667_0056172
1031 Ga0495667_0433923
1032 Ga0495667_0434757
1033 Ga0495656_0042510
1034 Ga0495656_0205744
1035 Ga0495668_0102886
1036 Ga0495634_0003577
1037 Ga0495611_0075709
1038 Ga0495611_0234414
1039 Ga0495625_0080148
1040 Ga0495625_0279369
1041 Ga0495635_0005863
1042 Ga0495659_0090238
1043 Ga0495661_0133635
1044 Ga0495661_0168305
1045 Ga0495661_0347529
1046 Ga0495588_0003177
1047 Ga0495657_0351107
1048 Ga0495599_0085930
1049 Ga0495623_0011342
1050 Ga0495646_0222366
1051 Ga0495647_0001821
1052 Ga0495647_0082329
1053 Ga0495647_0333745
1054 Ga0495658_0002050
1055 Ga0495669_0009639
1056 Ga0495669_0027352
1057 Ga0495669_0040182
1058 Ga0495669_0063135
1059 Ga0495669_0079955
1060 Ga0495669_0157906
1061 Ga0495613_0036095
1062 Ga0495613_0078062
1063 Ga0495624_0001851
1064 Ga0495624_0164762
1065 Ga0495624_0172577
1066 Ga0495670_0099798
1067 Ga0495670_0195448
1068 Ga0495671_0143601
1069 Ga0495649_0061839
1070 Ga0495589_0168281
1071 Ga0495600_0067336
1072 Ga0495600_0084110
1073 Ga0495660_0077235
1074 Ga0495660_0152311
1075 Ga0495660_0246813
1076 Ga0495581_0006605
1077 Ga0495581_0244044
1078 Ga0495604_0333904
1079 Ga0495674_0017939
1080 Ga0495674_0240090
1081 Ga0495676_0060339
1082 Ga0495676_0232085
1083 Ga0495680_0036741
1084 Ga0495683_0185831
1085 Ga0495683_0379169
1086 Ga0495677_0138805
1087 Ga0495685_070258
1088 Ga0495685_229438
1089 Ga0495673_0021367
1090 Ga0495673_0035858
1091 Ga0495673_0139508
1092 Ga0495681_0055461
1093 Ga0495681_0205025
1094 Ga0495686_0098312
1095 Ga0495686_0119997
1096 Ga0495686_0293251
1097 Ga0495686_0380402
1098 Ga0495593_0016763
1099 Ga0495593_0060687
1100 Ga0495602_0385272
1101 Ga0495615_0033921
1102 Ga0495626_0051688
1103 Ga0496102_0088442
1104 Ga0496102_0122254
1105 Ga0496102_0466803
1106 Ga0496102_0737139
1107 Ga0496103_0177716
1108 Ga0496104_0308317
1109 Ga0496106_0588347
1110 Ga0496108_0051359
1111 Ga0496108_0153916
1112 Ga0496109_0364977
1113 Ga0496111_0801562
1114 Ga0496112_0126686
1115 Ga0496112_0574688
1116 Ga0496113_0896402
1117 Ga0496114_0067698
1118 Ga0496114_0296517
1119 Ga0496114_0554036
1120 Ga0496115_0132306
1121 Ga0496115_0167659
1122 Ga0496115_0329939
1123 Ga0496115_0436182
1124 Ga0496118_0164602
1125 Ga0496118_0246039
1126 Ga0496121_0071763
1127 Ga0496121_0238890
1128 Ga0496124_0336558
1129 Ga0496124_0621202
1130 Ga0496126_0043411
1131 Ga0496126_0551026
1132 Ga0495678_087702
1133 Ga0495682_0122970
1134 Ga0501208_092493
1135 nmdc:mga03683_30494_c1
1136 nmdc:mga03683_36173_c1
1137 nmdc:mga03n38_537543_c1
1138 nmdc:mga03n38_63452_c1
1139 nmdc:mga00v17_28474_c1
1140 nmdc:mga00v17_286035_c1
1141 nmdc:mga0yw44_20761_c1
1142 nmdc:mga0yw44_31687_c1
1143 nmdc:mga0yw44_55344_c1
1144 nmdc:mga0yw44_75243_c1
1145 nmdc:mga0k408_15156_c1
1146 nmdc:mga0k408_69445_c1
1147 nmdc:mga0k408_735429_c1
1148 nmdc:mga06z11_31990_c1
1149 nmdc:mga06z11_6909_c1
1150 nmdc:mga07m45_21870_c1
1151 nmdc:mga07m45_360741_c1
1152 nmdc:mga05p37_34988_c1
1153 nmdc:mga0qj67_260558_c1
1154 nmdc:mga08y16_230510_c1
1155 nmdc:mga08y16_84329_c1
1156 nmdc:mga0sz30_21752_c1
1157 Ga0495601_0018781
1158 Ga0495595_0020835
1159 Ga0495595_0217972
1160 Ga0495619_0284272
1161 Ga0495619_0390426
1162 Ga0500646_0066222
1163 Ga0500646_0183575
1164 Ga0500583_0014620
1165 Ga0500583_0089442
1166 Ga0500641_0014496
1167 Ga0500641_0056557
1168 Ga0500641_0190025
1169 Ga0500650_0112753
1170 Ga0500594_0011707
1171 Ga0500642_0197602
1172 Ga0500642_0242865
1173 Ga0500655_070224
1174 Ga0500658_0005778
1175 Ga0500658_0061664
1176 Ga0500568_0142650
1177 Ga0500588_0046052
1178 Ga0500589_240509
1179 Ga0500627_0154569
1180 Ga0500633_0014628
1181 Ga0500634_0020472
1182 Ga0500634_0050881
1183 Ga0500645_003078
1184 Ga0500645_077088
1185 2723845097
1186 2793082035
1187 2889039855
1188 2908742689
1189 2922365340
1190 8006930167
1191 8006987062
1192 8056673881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03330

DPBB_1

Lytic transglycolase

115

202

0.95

Map