F467267

General Info

Members Datasets Scaffolds Average Seq Length
593 317 546 265

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0009625|Ga0495606_0009625_3879_4763
Length 294
Sequence MSRRNANLIKSPEQIVTARVAAQLAADVLTMIGPHIKAGVTTAHLDQLCNDYIVNVQKAIPANVGYGGFPATVCSSVNHVVCHGIPSEDELLKDGDIINIDVAVIKDGWHGDTSRMYYVGEPSKPTRKLVETTYAAMWAGIRAVKPRATLGDVGFAIQTVAEKAGYSVVLDYCGHGIGMVYHEEPQVAHYGRPGQGVVLKPGMLFTIEPMINAGKAATKELSDGWTVETRDKSLSAQWEHMVLVTETGFEVLTLAPGETGAKSQIPNAVPAGAAAAVAEADITGAPSAPPASVA

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2643221569 Achromobacter sp. Root565 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221621 Achromobacter sp. Root83 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
11 2643221645 Massilia sp. Root351 Isolate Unclassified
12 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
13 2643221664 Massilia sp. Root418 Isolate Unclassified
14 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
15 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
16 2738541280 Massilia sp. GV090 Isolate Unclassified
17 2738541297 Duganella sp. GV083 Isolate Unclassified
18 2738541300 Massilia sp. GV016 Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2738541357 Duganella sp. GV053 Isolate Unclassified
21 2738543003 Duganella sp. GV066 Isolate Unclassified
22 2738543018 Massilia sp. GV045 Isolate Unclassified
23 2738543026 Duganella sp. GV089 Isolate Unclassified
24 2738543029 Duganella sp. GV039 Isolate Unclassified
25 2738543030 Massilia sp. GV097 Isolate Unclassified
26 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
27 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
28 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
29 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
30 2821131069 Duganella sp. 1224 Isolate Unclassified
31 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
32 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
33 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
34 2842711865 Duganella sp. R-73148 Isolate Unclassified
35 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
36 2857553236 Duganella sp. R-74557 Isolate Unclassified
37 2857558681 Duganella sp. R-74565 Isolate Unclassified
38 2857564685 Duganella sp. R-74599 Isolate Unclassified
39 2876601092 Pantoea endophytica 596 Isolate Unclassified
40 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
41 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
42 2904424332 Duganella sp. 1411 Isolate Rhizosphere
43 2919476304 Duganella sp. 3397 Isolate Unclassified
44 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
45 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
46 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
47 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
48 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
167 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
171 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
172 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
173 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
174 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
175 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
266 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
268 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
297 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
298 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
299 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
300 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
309 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
313 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
316 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
317 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.07
Metatranscriptomes 0
Isolates 7.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 1.52
Rhizoplane 2.53
Rhizosphere 75.72
Stem 0
Stem Tuber 0
Unclassified 12.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000296 3300002705 Bacteria 33467
2 JGI25156J39149_1000937 3300002705 Bacteria 14067
3 JGI25154J39366_1004078 3300002738 Bacteria 2759
4 JGI25150J39212_1010273 3300002774 Bacteria 1745
5 JGI25159J45721_1016387 3300002987 Bacteria 1581
6 Ga0055529_1000133 3300003763 Bacteria 104484
7 Ga0055526_1000230 3300003771 Bacteria 46917
8 Ga0055526_1000258 3300003771 Bacteria 44725
9 Ga0055526_1003989 3300003771 Bacteria 9084
10 Ga0055531_10001392 3300003794 Bacteria 17911
11 Ga0065165_1000067 3300005262 Bacteria 170811
12 Ga0070658_10027838 3300005327 Bacteria 4535
13 Ga0070683_100074197 3300005329 Bacteria 3177
14 Ga0070690_100006654 3300005330 Bacteria 6566
15 Ga0070670_100003676 3300005331 Bacteria 12785
16 Ga0070666_10023306 3300005335 Bacteria 4030
17 Ga0070666_10411118 3300005335 Bacteria 973
18 Ga0070682_100027515 3300005337 Bacteria 3413
19 Ga0068868_100006907 3300005338 Bacteria 8065
20 Ga0070687_100208037 3300005343 Bacteria 1190
21 Ga0070671_100043419 3300005355 Bacteria 3735
22 Ga0070684_100082244 3300005535 Bacteria 2851
23 Ga0070665_100024470 3300005548 Bacteria 6081
24 Ga0070664_100019280 3300005564 Bacteria 5611
25 Ga0068856_100053824 3300005614 Bacteria 3969
26 Ga0068856_100155246 3300005614 Bacteria 2299
27 Ga0068856_100267290 3300005614 Bacteria 1726
28 Ga0068856_100555734 3300005614 Unclassified 1169
29 Ga0068852_100251381 3300005616 Bacteria 1694
30 Ga0068859_100021941 3300005617 Bacteria 6402
31 Ga0068864_100002439 3300005618 Bacteria 15376
32 Ga0068864_100126250 3300005618 Bacteria 2293
33 Ga0068861_100214826 3300005719 Bacteria 1622
34 Ga0068863_100027333 3300005841 Bacteria 5441
35 Ga0068863_100233339 3300005841 Bacteria 1775
36 Ga0068858_100013508 3300005842 Bacteria 7704
37 Ga0068862_100471286 3300005844 Bacteria 1187
38 Ga0081455_10000999 3300005937 Bacteria 35875
39 Ga0075365_10257250 3300006038 Bacteria 1227
40 Ga0075363_100042590 3300006048 Bacteria 2400
41 Ga0075362_10003441 3300006177 Bacteria 5531
42 Ga0075367_10015518 3300006178 Bacteria 4144
43 Ga0075366_10061573 3300006195 Bacteria 2230
44 Ga0075366_10062019 3300006195 Bacteria 2223
45 Ga0075366_10221852 3300006195 Bacteria 1152
46 Ga0097621_100192077 3300006237 Bacteria 1769
47 Ga0075430_100102222 3300006846 Bacteria 2393
48 Ga0075429_100314454 3300006880 Bacteria 1371
49 Ga0097620_100021941 3300006931 Bacteria 6402
50 Ga0079104_1006106 3300006946 Bacteria 4650
51 Ga0099826_10000003 3300006948 Bacteria 1067817
52 Ga0105251_10001278 3300009011 Bacteria 21757
53 Ga0105244_10001359 3300009036 Bacteria 19896
54 Ga0105244_10003124 3300009036 Bacteria 12059
55 Ga0105244_10003155 3300009036 Bacteria 11977
56 Ga0105244_10094326 3300009036 Bacteria 1469
57 Ga0105245_10009458 3300009098 Bacteria 8500
58 Ga0105243_10057549 3300009148 Bacteria 3096
59 Ga0105248_10000927 3300009177 Bacteria 32633
60 Ga0105248_10320002 3300009177 Bacteria 1747
61 Ga0105249_10175232 3300009553 Bacteria 2083
62 Ga0105239_10368322 3300010375 Bacteria 1623
63 Ga0105239_10938288 3300010375 Bacteria 994
64 Ga0105246_10004756 3300011119 Bacteria 8268
65 Ga0105246_10004791 3300011119 Bacteria 8239
66 Ga0157373_10000911 3300013100 Bacteria 22918
67 Ga0157371_10000491 3300013102 Bacteria 47942
68 Ga0157369_10081321 3300013105 Bacteria 3467
69 Ga0157369_10274606 3300013105 Bacteria 1756
70 Ga0157374_10002219 3300013296 Bacteria 16376
71 Ga0157378_10522155 3300013297 Bacteria 1189
72 Ga0163162_10005133 3300013306 Bacteria 12619
73 Ga0157375_10010140 3300013308 Bacteria 8287
74 Ga0163163_10021084 3300014325 Bacteria 6147
75 Ga0157379_10016987 3300014968 Bacteria 6405
76 Ga0182006_1000070 3300015261 Bacteria 137793
77 Ga0182005_1000003 3300015265 Bacteria 683269
78 Ga0209436_117706 3300025208 Bacteria 1034
79 Ga0209437_108069 3300025233 Bacteria 1692
80 Ga0207425_1000360 3300025245 Bacteria 31520
81 Ga0209646_1000114 3300025246 Bacteria 152958
82 Ga0209677_100535 3300025253 Bacteria 21152
83 Ga0209759_1000033 3300025256 Bacteria 276117
84 Ga0209565_1006289 3300025263 Bacteria 3348
85 Ga0209455_1000063 3300025272 Bacteria 333019
86 Ga0209130_1001240 3300025284 Bacteria 17919
87 Ga0209025_1003724 3300025294 Bacteria 14000
88 Ga0209564_1000006 3300025295 Bacteria 1100927
89 Ga0209564_1000026 3300025295 Bacteria 519154
90 Ga0209758_1000372 3300025297 Bacteria 78825
91 Ga0209256_1000013 3300025299 Bacteria 689442
92 Ga0209257_1006592 3300025304 Bacteria 7402
93 Ga0207696_1000113 3300025711 Bacteria 151878
94 Ga0207655_1001536 3300025728 Bacteria 20891
95 Ga0207655_1003440 3300025728 Bacteria 11778
96 Ga0207655_1004984 3300025728 Bacteria 9197
97 Ga0207655_1010720 3300025728 Bacteria 5535
98 Ga0207713_1000347 3300025735 Bacteria 50780
99 Ga0207680_10119645 3300025903 Bacteria 1720
100 Ga0207695_10407274 3300025913 Bacteria 1244
101 Ga0207662_10077365 3300025918 Bacteria 2024
102 Ga0207650_10068468 3300025925 Bacteria 2666
103 Ga0207687_10031363 3300025927 Bacteria 3591
104 Ga0207687_10389183 3300025927 Bacteria 1144
105 Ga0207644_10048878 3300025931 Bacteria 3026
106 Ga0207706_10152455 3300025933 Bacteria 2033
107 Ga0207670_10047276 3300025936 Bacteria 2865
108 Ga0207711_10016753 3300025941 Bacteria 6086
109 Ga0207711_10022536 3300025941 Bacteria 5268
110 Ga0207711_10325862 3300025941 Bacteria 1420
111 Ga0207689_10091292 3300025942 Bacteria 2502
112 Ga0207689_10315123 3300025942 Bacteria 1298
113 Ga0207679_10036314 3300025945 Bacteria 3494
114 Ga0207658_10406568 3300025986 Bacteria 1197
115 Ga0207677_10014171 3300026023 Bacteria 4646
116 Ga0207702_10197671 3300026078 Bacteria 1862
117 Ga0207641_10040861 3300026088 Bacteria 3885
118 Ga0207641_10194498 3300026088 Bacteria 1866
119 Ga0207676_10013079 3300026095 Bacteria 5957
120 Ga0207676_10197427 3300026095 Bacteria 1775
121 Ga0207683_10514513 3300026121 Bacteria 1106
122 Ga0207698_10088476 3300026142 Bacteria 2526
123 Ga0209281_1009657 3300027111 Bacteria 2251
124 Ga0209282_1000002 3300027666 Bacteria 1067825
125 Ga0268266_10019760 3300028379 Bacteria 5741
126 Ga0268265_10155587 3300028380 Bacteria 1934
127 Ga0268264_10026643 3300028381 Bacteria 4724
128 Ga0307515_10045652 3300028794 Bacteria 6723
129 Ga0316181_1104601 3300030744 Bacteria 4219
130 Ga0316182_1415013 3300030745 Bacteria 1101
131 Ga0265332_10000030 3300031238 Bacteria 175141
132 Ga0307509_10263208 3300031507 Bacteria 1498
133 Ga0307408_100000046 3300031548 Bacteria 167686
134 Ga0307408_100000232 3300031548 Bacteria 58517
135 Ga0307408_100011172 3300031548 Bacteria 5931
136 Ga0316579_10018376 3300031691 Bacteria 3077
137 Ga0265314_10041423 3300031711 Bacteria 3297
138 Ga0316576_10004964 3300031727 Bacteria 8058
139 Ga0316576_10019945 3300031727 Bacteria 4601
140 Ga0316576_10025890 3300031727 Bacteria 4110
141 Ga0316578_10005533 3300031728 Bacteria 6138
142 Ga0316578_10058454 3300031728 Bacteria 2267
143 Ga0307405_10034126 3300031731 Bacteria 3025
144 Ga0307518_10114481 3300031838 Bacteria 1917
145 Ga0307409_100016301 3300031995 Bacteria 4912
146 Ga0307416_100012248 3300032002 Bacteria 5766
147 Ga0307416_101046005 3300032002 Bacteria 920
148 Ga0307411_10005120 3300032005 Bacteria 6400
149 Ga0307411_10025039 3300032005 Bacteria 3568
150 Ga0316580_10018199 3300032139 Bacteria 2162
151 Ga0373939_0123703 3300035114 Bacteria 915
152 Ga0373960_0040717 3300035121 Bacteria 1342
153 Ga0316574_0000055 3300035398 Bacteria 29301
154 Ga0316574_0003649 3300035398 Bacteria 7967
155 Ga0316574_0026414 3300035398 Bacteria 3491
156 Ga0316574_0042090 3300035398 Bacteria 2817
157 Ga0316574_0064741 3300035398 Bacteria 2301
158 Ga0316574_0067518 3300035398 Bacteria 2254
159 Ga0316574_0069807 3300035398 Bacteria 2218
160 Ga0373931_0143585 3300035691 Bacteria 1385
161 Ga0316582_0075867 3300036647 Bacteria 2185
162 Ga0316582_0164775 3300036647 Bacteria 1503
163 Ga0316584_0022384 3300036712 Bacteria 4609
164 Ga0316584_0072962 3300036712 Bacteria 2572
165 Ga0316584_0426597 3300036712 Bacteria 941
166 Ga0395905_0001549 3300037471 Bacteria 27478
167 Ga0400490_29153 3300038726 Bacteria 26709
168 Ga0439453_0010252 3300041408 Bacteria 1542
169 Ga0451800_1070302 3300041459 Bacteria 1102
170 Ga0451853_0584218 3300041512 Bacteria 853
171 Ga0439437_003746 3300042000 Bacteria 1643
172 Ga0439452_000002 3300042010 Bacteria 1377577
173 Ga0450913_001531 3300042117 Bacteria 1290
174 Ga0450888_000330 3300042126 Bacteria 4474
175 Ga0450890_001017 3300042127 Bacteria 4070
176 Ga0450891_000290 3300042129 Bacteria 5139
177 Ga0450892_002966 3300042130 Bacteria 1410
178 Ga0450903_008716 3300042138 Bacteria 1658
179 Ga0450889_000647 3300042144 Bacteria 3844
180 Ga0439446_0010002 3300042156 Bacteria 2548
181 Ga0439464_0012210 3300042439 Bacteria 2284
182 Ga0450916_001625 3300042530 Bacteria 2264
183 Ga0466969_0077630 3300044656 Bacteria 1589
184 Ga0453683_0007447 3300044673 Bacteria 7424
185 Ga0466957_0013506 3300044842 Bacteria 4738
186 Ga0451576_0075742 3300045051 Bacteria 3501
187 Ga0451576_0098633 3300045051 Bacteria 3039
188 Ga0451576_0232729 3300045051 Bacteria 1924
189 Ga0451576_0775869 3300045051 Bacteria 1007
190 Ga0495617_000048 3300046452 Bacteria 113357
191 Ga0495617_003612 3300046452 Bacteria 5776
192 Ga0495617_015555 3300046452 Bacteria 2576
193 Ga0495617_036558 3300046452 Bacteria 1646
194 Ga0495617_069278 3300046452 Bacteria 1160
195 Ga0495627_000046 3300046453 Bacteria 176186
196 Ga0495592_0041458 3300046454 Bacteria 3450
197 Ga0495603_0024142 3300046455 Bacteria 3676
198 Ga0495590_0000030 3300046457 Bacteria 146237
199 Ga0495590_0007818 3300046457 Bacteria 4103
200 Ga0495590_0021775 3300046457 Bacteria 2270
201 Ga0495591_000006 3300046458 Bacteria 390570
202 Ga0495591_000708 3300046458 Bacteria 24252
203 Ga0495591_004286 3300046458 Bacteria 7047
204 Ga0495629_0013743 3300046459 Bacteria 5841
205 Ga0495629_0020594 3300046459 Bacteria 4710
206 Ga0495629_0032249 3300046459 Bacteria 3709
207 Ga0495638_0000105 3300046460 Bacteria 134384
208 Ga0495638_0005690 3300046460 Bacteria 9181
209 Ga0495638_0008635 3300046460 Bacteria 7206
210 Ga0495638_0056593 3300046460 Bacteria 2433
211 Ga0495638_0120078 3300046460 Bacteria 1554
212 Ga0495641_0076187 3300046461 Bacteria 1504
213 Ga0495651_0002299 3300046462 Bacteria 14742
214 Ga0495651_0031041 3300046462 Bacteria 4168
215 Ga0495653_0000018 3300046463 Bacteria 185787
216 Ga0495653_0029195 3300046463 Bacteria 4406
217 Ga0495653_0182344 3300046463 Bacteria 1439
218 Ga0495653_0304947 3300046463 Bacteria 1037
219 Ga0495650_0000099 3300046471 Bacteria 215347
220 Ga0495650_0000212 3300046471 Bacteria 124622
221 Ga0495650_0000227 3300046471 Bacteria 114662
222 Ga0495650_0002015 3300046471 Bacteria 17807
223 Ga0495650_0002885 3300046471 Bacteria 13083
224 Ga0495650_0003344 3300046471 Bacteria 11803
225 Ga0495650_0007225 3300046471 Bacteria 6728
226 Ga0495650_0007378 3300046471 Bacteria 6616
227 Ga0495580_0002864 3300046472 Bacteria 14851
228 Ga0495580_0004033 3300046472 Bacteria 12390
229 Ga0495580_0012883 3300046472 Bacteria 6407
230 Ga0495580_0048073 3300046472 Bacteria 3023
231 Ga0495582_0009034 3300046473 Bacteria 5500
232 Ga0495582_0041510 3300046473 Bacteria 2535
233 Ga0495605_0000005 3300046474 Bacteria 376973
234 Ga0495605_0000105 3300046474 Bacteria 105544
235 Ga0495605_0004455 3300046474 Bacteria 8218
236 Ga0495605_0005132 3300046474 Bacteria 7632
237 Ga0495605_0093870 3300046474 Bacteria 1387
238 Ga0495639_0138339 3300046475 Bacteria 1169
239 Ga0495662_0006294 3300046476 Bacteria 5935
240 Ga0495662_0026476 3300046476 Bacteria 2800
241 Ga0495664_0005206 3300046477 Bacteria 7136
242 Ga0495584_0001843 3300046491 Bacteria 12301
243 Ga0495584_0009209 3300046491 Bacteria 5091
244 Ga0495584_0186006 3300046491 Bacteria 1055
245 Ga0495585_0001802 3300046492 Bacteria 16285
246 Ga0495585_0053310 3300046492 Bacteria 2238
247 Ga0495594_0074435 3300046499 Bacteria 1892
248 Ga0495596_0014593 3300046500 Bacteria 3309
249 Ga0495596_0128004 3300046500 Bacteria 986
250 Ga0495607_0005215 3300046501 Bacteria 9349
251 Ga0495607_0008312 3300046501 Bacteria 7097
252 Ga0495607_0026284 3300046501 Bacteria 3612
253 Ga0495607_0068293 3300046501 Bacteria 1994
254 Ga0495607_0071780 3300046501 Bacteria 1929
255 Ga0495607_0093522 3300046501 Bacteria 1623
256 Ga0495607_0162697 3300046501 Bacteria 1132
257 Ga0495583_0000004 3300046506 Bacteria 655287
258 Ga0495583_0000192 3300046506 Bacteria 102223
259 Ga0495583_0000645 3300046506 Bacteria 46022
260 Ga0495583_0001634 3300046506 Bacteria 21855
261 Ga0495583_0002676 3300046506 Bacteria 14828
262 Ga0495583_0008863 3300046506 Bacteria 6083
263 Ga0495583_0020469 3300046506 Bacteria 3427
264 Ga0495606_0000158 3300046507 Bacteria 118616
265 Ga0495606_0000547 3300046507 Bacteria 60321
266 Ga0495606_0001026 3300046507 Bacteria 40508
267 Ga0495606_0007446 3300046507 Bacteria 9794
268 Ga0495606_0008840 3300046507 Bacteria 8633
269 Ga0495606_0009625 3300046507 Bacteria 8142
270 Ga0495606_0026012 3300046507 Bacteria 4176
271 Ga0495606_0042581 3300046507 Bacteria 3035
272 Ga0495606_0056855 3300046507 Bacteria 2522
273 Ga0495608_0008757 3300046511 Bacteria 7078
274 Ga0495610_0000021 3300046512 Bacteria 336300
275 Ga0495610_0005098 3300046512 Bacteria 9461
276 Ga0495610_0006265 3300046512 Bacteria 8241
277 Ga0495610_0012580 3300046512 Bacteria 5082
278 Ga0495610_0052448 3300046512 Bacteria 1980
279 Ga0495616_0023828 3300046513 Bacteria 3289
280 Ga0495616_0029386 3300046513 Bacteria 2902
281 Ga0495618_0007359 3300046514 Bacteria 6661
282 Ga0495618_0011445 3300046514 Bacteria 5381
283 Ga0495618_0031012 3300046514 Bacteria 3342
284 Ga0495620_0000377 3300046515 Bacteria 30539
285 Ga0495620_0007751 3300046515 Bacteria 5799
286 Ga0495628_0033520 3300046516 Bacteria 4138
287 Ga0495628_0084762 3300046516 Bacteria 2458
288 Ga0495630_0011098 3300046517 Bacteria 6517
289 Ga0495630_0021605 3300046517 Bacteria 4752
290 Ga0495630_0060130 3300046517 Bacteria 2851
291 Ga0495632_0000255 3300046519 Bacteria 52928
292 Ga0495637_0000057 3300046520 Bacteria 97433
293 Ga0495637_0006210 3300046520 Bacteria 6011
294 Ga0495637_0007847 3300046520 Bacteria 5266
295 Ga0495643_0000181 3300046522 Bacteria 100368
296 Ga0495643_0005852 3300046522 Bacteria 8224
297 Ga0495644_0029527 3300046523 Bacteria 2071
298 Ga0495644_0033556 3300046523 Bacteria 1938
299 Ga0495648_0000008 3300046524 Bacteria 336584
300 Ga0495648_0003617 3300046524 Bacteria 13534
301 Ga0495648_0003845 3300046524 Bacteria 13030
302 Ga0495648_0003924 3300046524 Bacteria 12873
303 Ga0495648_0010048 3300046524 Bacteria 7253
304 Ga0495648_0034770 3300046524 Bacteria 3275
305 Ga0495666_0003786 3300046526 Bacteria 7646
306 Ga0495666_0021013 3300046526 Bacteria 3232
307 Ga0495642_0004701 3300046528 Bacteria 5289
308 Ga0495642_0016872 3300046528 Bacteria 2849
309 Ga0495642_0025379 3300046528 Bacteria 2349
310 Ga0495642_0030572 3300046528 Bacteria 2155
311 Ga0495642_0034886 3300046528 Bacteria 2028
312 Ga0495642_0042628 3300046528 Bacteria 1849
313 Ga0495652_0123897 3300046529 Bacteria 2056
314 Ga0495654_0000005 3300046530 Bacteria 491381
315 Ga0495654_0000013 3300046530 Bacteria 327576
316 Ga0495654_0010971 3300046530 Bacteria 4921
317 Ga0495654_0012289 3300046530 Bacteria 4602
318 Ga0495665_0035142 3300046531 Bacteria 2678
319 Ga0495665_0161269 3300046531 Bacteria 1168
320 Ga0495640_0002432 3300046533 Bacteria 14945
321 Ga0495640_0031853 3300046533 Bacteria 3761
322 Ga0495640_0311473 3300046533 Bacteria 976
323 Ga0495587_0001857 3300046536 Bacteria 14058
324 Ga0495609_0000049 3300046538 Bacteria 155608
325 Ga0495609_0002290 3300046538 Bacteria 11922
326 Ga0495609_0008339 3300046538 Bacteria 5077
327 Ga0495609_0009996 3300046538 Bacteria 4569
328 Ga0495609_0018425 3300046538 Bacteria 3235
329 Ga0495609_0028433 3300046538 Bacteria 2551
330 Ga0495609_0028803 3300046538 Bacteria 2532
331 Ga0495609_0100652 3300046538 Bacteria 1252
332 Ga0495597_0003757 3300046542 Bacteria 8652
333 Ga0495597_0005506 3300046542 Bacteria 6698
334 Ga0495645_0002449 3300046543 Bacteria 12598
335 Ga0495622_0000302 3300046557 Bacteria 37049
336 Ga0495622_0000415 3300046557 Bacteria 28325
337 Ga0495622_0000534 3300046557 Bacteria 22878
338 Ga0495622_0089410 3300046557 Bacteria 1415
339 Ga0495633_0000238 3300046558 Bacteria 66595
340 Ga0495633_0000409 3300046558 Bacteria 44723
341 Ga0495633_0005568 3300046558 Bacteria 7649
342 Ga0495633_0039399 3300046558 Bacteria 2255
343 Ga0495633_0045752 3300046558 Bacteria 2071
344 Ga0495633_0216760 3300046558 Bacteria 876
345 Ga0495668_0000482 3300046616 Bacteria 50037
346 Ga0495668_0001995 3300046616 Bacteria 17851
347 Ga0495668_0005088 3300046616 Bacteria 9045
348 Ga0495668_0036226 3300046616 Bacteria 2764
349 Ga0495668_0255778 3300046616 Bacteria 959
350 Ga0495634_0010873 3300046642 Bacteria 6648
351 Ga0495611_0012025 3300046648 Bacteria 3678
352 Ga0495611_0012970 3300046648 Bacteria 3543
353 Ga0495611_0071758 3300046648 Bacteria 1583
354 Ga0495625_0001573 3300046660 Bacteria 27145
355 Ga0495625_0009520 3300046660 Bacteria 8118
356 Ga0495625_0012167 3300046660 Bacteria 6981
357 Ga0495625_0013755 3300046660 Bacteria 6488
358 Ga0495625_0020795 3300046660 Bacteria 5060
359 Ga0495625_0041123 3300046660 Bacteria 3366
360 Ga0495625_0182980 3300046660 Bacteria 1392
361 Ga0495625_0201803 3300046660 Bacteria 1312
362 Ga0495635_0039437 3300046663 Bacteria 3267
363 Ga0495659_0000128 3300046664 Bacteria 33389
364 Ga0495659_0010448 3300046664 Bacteria 2978
365 Ga0495659_0036069 3300046664 Bacteria 1745
366 Ga0495661_0000312 3300046665 Bacteria 54893
367 Ga0495661_0005648 3300046665 Bacteria 8868
368 Ga0495661_0007287 3300046665 Bacteria 7712
369 Ga0495661_0038454 3300046665 Bacteria 2980
370 Ga0495661_0188865 3300046665 Bacteria 1086
371 Ga0495657_0068564 3300046675 Bacteria 2324
372 Ga0495599_0013702 3300046678 Bacteria 5012
373 Ga0495599_0043749 3300046678 Bacteria 2810
374 Ga0495599_0149419 3300046678 Bacteria 1447
375 Ga0495623_0001488 3300046679 Bacteria 15880
376 Ga0495623_0001635 3300046679 Bacteria 15057
377 Ga0495623_0022723 3300046679 Bacteria 4049
378 Ga0495646_0013273 3300046680 Bacteria 5235
379 Ga0495669_0001427 3300046684 Bacteria 9844
380 Ga0495669_0023483 3300046684 Bacteria 2685
381 Ga0495669_0247380 3300046684 Bacteria 856
382 Ga0495613_0068202 3300046689 Bacteria 2594
383 Ga0495613_0102670 3300046689 Bacteria 2064
384 Ga0495624_0000787 3300046690 Bacteria 24989
385 Ga0495624_0035968 3300046690 Bacteria 3194
386 Ga0495624_0050233 3300046690 Bacteria 2642
387 Ga0495670_0008487 3300046691 Bacteria 5054
388 Ga0495670_0011747 3300046691 Bacteria 4310
389 Ga0495670_0036263 3300046691 Bacteria 2457
390 Ga0495670_0059608 3300046691 Bacteria 1916
391 Ga0495671_0000234 3300046692 Bacteria 47760
392 Ga0495671_0000343 3300046692 Bacteria 38705
393 Ga0495671_0023179 3300046692 Bacteria 3245
394 Ga0495649_0003953 3300046694 Bacteria 9792
395 Ga0495649_0005578 3300046694 Bacteria 7964
396 Ga0495649_0111944 3300046694 Bacteria 1447
397 Ga0495589_0015413 3300046794 Bacteria 3934
398 Ga0495589_0030821 3300046794 Bacteria 2701
399 Ga0495589_0047783 3300046794 Bacteria 2120
400 Ga0495660_0001130 3300046810 Bacteria 19023
401 Ga0495660_0002657 3300046810 Bacteria 11324
402 Ga0495660_0003276 3300046810 Bacteria 10049
403 Ga0495660_0012352 3300046810 Bacteria 4956
404 Ga0495660_0016129 3300046810 Bacteria 4309
405 Ga0495660_0024315 3300046810 Bacteria 3451
406 Ga0495660_0038578 3300046810 Bacteria 2655
407 Ga0495581_0019631 3300047315 Bacteria 3923
408 Ga0495581_0020585 3300047315 Bacteria 3827
409 Ga0495604_0003221 3300047317 Bacteria 13043
410 Ga0495604_0071240 3300047317 Bacteria 2630
411 Ga0495604_0232902 3300047317 Bacteria 1262
412 Ga0495636_0002363 3300047318 Bacteria 7242
413 Ga0495636_0005534 3300047318 Bacteria 4959
414 Ga0495636_0132319 3300047318 Bacteria 1110
415 Ga0495674_0038277 3300047319 Bacteria 4306
416 Ga0495674_0119294 3300047319 Bacteria 2229
417 Ga0495674_0140481 3300047319 Bacteria 2030
418 Ga0495672_0000013 3300047320 Bacteria 511827
419 Ga0495672_0000035 3300047320 Bacteria 290329
420 Ga0495672_0000410 3300047320 Bacteria 51954
421 Ga0495672_0040219 3300047320 Bacteria 2837
422 Ga0495672_0071295 3300047320 Bacteria 1966
423 Ga0495672_0089624 3300047320 Bacteria 1692
424 Ga0495676_0047420 3300047321 Bacteria 3474
425 Ga0495676_0057759 3300047321 Bacteria 3057
426 Ga0495676_0069664 3300047321 Bacteria 2713
427 Ga0495680_0023350 3300047322 Bacteria 5144
428 Ga0495680_0031357 3300047322 Bacteria 4328
429 Ga0495680_0237906 3300047322 Bacteria 1294
430 Ga0495683_0004583 3300047323 Bacteria 7805
431 Ga0495683_0009105 3300047323 Bacteria 5289
432 Ga0495683_0015974 3300047323 Bacteria 3899
433 Ga0495683_0017943 3300047323 Bacteria 3663
434 Ga0495687_000487 3300047443 Bacteria 48069
435 Ga0495687_002805 3300047443 Bacteria 13446
436 Ga0495687_003597 3300047443 Bacteria 11100
437 Ga0495687_065092 3300047443 Bacteria 1485
438 Ga0495675_0020309 3300047444 Bacteria 4224
439 Ga0495675_0021583 3300047444 Bacteria 4101
440 Ga0495675_0041955 3300047444 Bacteria 2915
441 Ga0495677_0002848 3300047445 Bacteria 6736
442 Ga0495677_0023871 3300047445 Bacteria 2219
443 Ga0495679_000050 3300047446 Bacteria 125325
444 Ga0495679_000683 3300047446 Bacteria 22224
445 Ga0495685_000132 3300047447 Bacteria 25959
446 Ga0495685_061798 3300047447 Bacteria 1261
447 Ga0495673_0000033 3300047469 Bacteria 354152
448 Ga0495673_0000034 3300047469 Bacteria 326920
449 Ga0495673_0000150 3300047469 Bacteria 122768
450 Ga0495673_0000211 3300047469 Bacteria 87639
451 Ga0495673_0003072 3300047469 Bacteria 11227
452 Ga0495673_0006037 3300047469 Bacteria 7193
453 Ga0495673_0011436 3300047469 Bacteria 4771
454 Ga0495673_0043807 3300047469 Bacteria 2000
455 Ga0495681_0003316 3300047470 Bacteria 11216
456 Ga0495681_0015166 3300047470 Bacteria 4371
457 Ga0495684_0025416 3300047471 Bacteria 4551
458 Ga0495686_0001783 3300047472 Bacteria 21899
459 Ga0495686_0012032 3300047472 Bacteria 6080
460 Ga0495686_0032551 3300047472 Bacteria 3374
461 Ga0495686_0046000 3300047472 Bacteria 2760
462 Ga0495686_0049029 3300047472 Bacteria 2659
463 Ga0495686_0103663 3300047472 Bacteria 1713
464 Ga0495686_0118940 3300047472 Bacteria 1577
465 Ga0495593_0002313 3300047673 Bacteria 11438
466 Ga0495593_0016566 3300047673 Bacteria 4156
467 Ga0495602_0014931 3300048088 Bacteria 7859
468 Ga0495602_0018887 3300048088 Bacteria 6864
469 Ga0495602_0022575 3300048088 Bacteria 6155
470 Ga0495602_0028092 3300048088 Bacteria 5391
471 Ga0495602_0380303 3300048088 Bacteria 1011
472 Ga0495614_0014052 3300048089 Bacteria 3511
473 Ga0496101_0000006 3300048904 Bacteria 329135
474 Ga0496102_0012321 3300048905 Bacteria 7396
475 Ga0496103_0019423 3300048906 Bacteria 4081
476 Ga0496103_0024129 3300048906 Bacteria 3668
477 Ga0496106_0000069 3300048909 Bacteria 82859
478 Ga0496106_0175508 3300048909 Bacteria 1700
479 Ga0496108_0034716 3300048911 Bacteria 4190
480 Ga0496109_0140235 3300048912 Bacteria 2260
481 Ga0496111_0226201 3300048914 Bacteria 1390
482 Ga0496112_0084227 3300048915 Bacteria 3144
483 Ga0496113_0018906 3300048916 Bacteria 4810
484 Ga0496114_0035890 3300048917 Bacteria 4096
485 Ga0496114_0270908 3300048917 Bacteria 1496
486 Ga0496116_0088362 3300048919 Bacteria 1894
487 Ga0496117_0019985 3300048920 Bacteria 5478
488 Ga0496117_0056939 3300048920 Bacteria 2718
489 Ga0496118_0009040 3300048921 Bacteria 10155
490 Ga0496118_0011515 3300048921 Bacteria 8622
491 Ga0496118_0016628 3300048921 Bacteria 6740
492 Ga0496118_0041057 3300048921 Bacteria 3669
493 Ga0496120_0000069 3300048923 Bacteria 165694
494 Ga0496120_0022028 3300048923 Bacteria 4013
495 Ga0496121_0000102 3300048924 Bacteria 195341
496 Ga0496121_0001759 3300048924 Bacteria 35296
497 Ga0496121_0027503 3300048924 Bacteria 5321
498 Ga0496121_0030602 3300048924 Bacteria 4940
499 Ga0496122_0001533 3300048925 Bacteria 36772
500 Ga0496122_0010192 3300048925 Bacteria 9738
501 Ga0496122_0034998 3300048925 Bacteria 4098
502 Ga0496122_0079452 3300048925 Bacteria 2292
503 Ga0496123_0000513 3300048926 Bacteria 67386
504 Ga0496123_0006224 3300048926 Bacteria 11643
505 Ga0496123_0010357 3300048926 Bacteria 8253
506 Ga0496124_0000229 3300048927 Bacteria 109277
507 Ga0496124_0008815 3300048927 Bacteria 10477
508 Ga0496124_0011429 3300048927 Bacteria 8877
509 Ga0496124_0067457 3300048927 Bacteria 2977
510 Ga0496124_0110106 3300048927 Bacteria 2218
511 Ga0496124_0269004 3300048927 Bacteria 1249
512 Ga0496125_0301484 3300048928 Bacteria 981
513 Ga0496126_0001236 3300048929 Bacteria 41467
514 Ga0496126_0001826 3300048929 Bacteria 31097
515 Ga0496126_0009279 3300048929 Bacteria 10481
516 Ga0496126_0043883 3300048929 Bacteria 4121
517 Ga0495678_000001 3300049459 Bacteria 1060340
518 Ga0495678_000076 3300049459 Bacteria 125077
519 Ga0495678_001414 3300049459 Bacteria 19020
520 Ga0495678_061214 3300049459 Bacteria 1413
521 Ga0495678_063019 3300049459 Bacteria 1386
522 Ga0495682_0000763 3300049460 Bacteria 20680
523 Ga0495682_0004796 3300049460 Bacteria 5709
524 Ga0495682_0006175 3300049460 Bacteria 4875
525 Ga0495682_0018388 3300049460 Bacteria 2632
526 Ga0501230_005664 3300049667 Bacteria 1779
527 Ga0501249_004484 3300049679 Bacteria 2835
528 Ga0501255_000368 3300049684 Bacteria 2959
529 Ga0501269_000137 3300049766 Bacteria 23021
530 nmdc:mga03683_10149_c1 3300050489 Bacteria 3371
531 nmdc:mga00v17_68457_c1 3300050491 Bacteria 1163
532 nmdc:mga0k408_132288_c1 3300050493 Bacteria 1481
533 nmdc:mga0k408_44999_c1 3300050493 Bacteria 2546
534 nmdc:mga07m45_213_c2 3300050496 Bacteria 10108
535 nmdc:mga0qj67_208827_c1 3300050509 Bacteria 1586
536 Ga0495655_0018550 3300053083 Bacteria 1531
537 Ga0500583_0013083 3300053092 Bacteria 3194
538 Ga0500651_0041030 3300053093 Bacteria 2917
539 Ga0500617_039511 3300053124 Bacteria 2112
540 Ga0500618_002777 3300053125 Bacteria 6359
541 Ga0500658_0012633 3300053134 Bacteria 3117
542 Ga0500568_0043187 3300053139 Bacteria 1803
543 Ga0500586_000469 3300053145 Bacteria 8068
544 Ga0500586_002702 3300053145 Bacteria 4062
545 Ga0500588_0017608 3300053146 Bacteria 1868
546 Ga0500616_0000032 3300053153 Bacteria 403673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0247380 Ga0495669_0247380_15_677 207
2 3300041512 Ga0451853_0584218 Ga0451853_0584218_23_682 212
3 3300031691 Ga0316579_10018376 Ga0316579_100183763 241
4 3300031728 Ga0316578_10005533 Ga0316578_100055332 241
5 3300032139 Ga0316580_10018199 Ga0316580_100181992 241
6 3300005614 Ga0068856_100555734 Ga0068856_1005557342 247
7 3300006846 Ga0075430_100102222 Ga0075430_1001022222 247
8 3300006880 Ga0075429_100314454 Ga0075429_1003144541 247
9 3300005614 Ga0068856_100053824 Ga0068856_1000538242 249
10 3300025942 Ga0207689_10315123 Ga0207689_103151231 249
11 3300046660 Ga0495625_0182980 Ga0495625_0182980_620_1381 249
12 3300049679 Ga0501249_004484 Ga0501249_004484_918_1682 250
13 3300046558 Ga0495633_0039399 Ga0495633_0039399_14_811 251
14 3300046660 Ga0495625_0201803 Ga0495625_0201803_493_1287 251
15 3300010375 Ga0105239_10938288 Ga0105239_109382881 252
16 3300035398 Ga0316574_0003649 Ga0316574_0003649_2426_3190 253
17 3300037471 Ga0395905_0001549 Ga0395905_0001549_24265_25086 253
18 3300005329 Ga0070683_100074197 Ga0070683_1000741973 254
19 3300005330 Ga0070690_100006654 Ga0070690_1000066545 254
20 3300005331 Ga0070670_100003676 Ga0070670_10000367612 254
21 3300005335 Ga0070666_10023306 Ga0070666_100233062 254
22 3300005338 Ga0068868_100006907 Ga0068868_1000069077 254
23 3300005343 Ga0070687_100208037 Ga0070687_1002080371 254
24 3300005355 Ga0070671_100043419 Ga0070671_1000434194 254
25 3300005535 Ga0070684_100082244 Ga0070684_1000822442 254
26 3300005548 Ga0070665_100024470 Ga0070665_1000244706 254
27 3300005564 Ga0070664_100019280 Ga0070664_1000192804 254
28 3300005614 Ga0068856_100267290 Ga0068856_1002672902 254
29 3300005616 Ga0068852_100251381 Ga0068852_1002513812 254
30 3300005617 Ga0068859_100021941 Ga0068859_1000219412 254
31 3300005618 Ga0068864_100002439 Ga0068864_1000024399 254
32 3300005719 Ga0068861_100214826 Ga0068861_1002148262 254
33 3300005841 Ga0068863_100027333 Ga0068863_1000273335 254
34 3300005842 Ga0068858_100013508 Ga0068858_1000135084 254
35 3300006237 Ga0097621_100192077 Ga0097621_1001920772 254
36 3300006931 Ga0097620_100021941 Ga0097620_1000219412 254
37 3300009098 Ga0105245_10009458 Ga0105245_100094585 254
38 3300009177 Ga0105248_10000927 Ga0105248_1000092723 254
39 3300010375 Ga0105239_10368322 Ga0105239_103683221 254
40 3300011119 Ga0105246_10004756 Ga0105246_100047566 254
41 3300013296 Ga0157374_10002219 Ga0157374_1000221914 254
42 3300013297 Ga0157378_10522155 Ga0157378_105221551 254
43 3300013306 Ga0163162_10005133 Ga0163162_100051337 254
44 3300013308 Ga0157375_10010140 Ga0157375_100101404 254
45 3300014325 Ga0163163_10021084 Ga0163163_100210848 254
46 3300014968 Ga0157379_10016987 Ga0157379_100169877 254
47 3300025903 Ga0207680_10119645 Ga0207680_101196452 254
48 3300025918 Ga0207662_10077365 Ga0207662_100773652 254
49 3300025927 Ga0207687_10031363 Ga0207687_100313632 254
50 3300025931 Ga0207644_10048878 Ga0207644_100488783 254
51 3300025933 Ga0207706_10152455 Ga0207706_101524552 254
52 3300025936 Ga0207670_10047276 Ga0207670_100472762 254
53 3300025941 Ga0207711_10016753 Ga0207711_100167534 254
54 3300025945 Ga0207679_10036314 Ga0207679_100363144 254
55 3300025986 Ga0207658_10406568 Ga0207658_104065682 254
56 3300026023 Ga0207677_10014171 Ga0207677_100141712 254
57 3300026078 Ga0207702_10197671 Ga0207702_101976712 254
58 3300026088 Ga0207641_10040861 Ga0207641_100408612 254
59 3300026095 Ga0207676_10013079 Ga0207676_100130797 254
60 3300026121 Ga0207683_10514513 Ga0207683_105145132 254
61 3300026142 Ga0207698_10088476 Ga0207698_100884762 254
62 3300028379 Ga0268266_10019760 Ga0268266_100197602 254
63 3300028381 Ga0268264_10026643 Ga0268264_100266433 254
64 3300031727 Ga0316576_10019945 Ga0316576_100199453 254
65 3300035121 Ga0373960_0040717 Ga0373960_0040717_492_1259 254
66 3300035398 Ga0316574_0042090 Ga0316574_0042090_320_1087 254
67 3300035398 Ga0316574_0064741 Ga0316574_0064741_1277_2044 254
68 3300035398 Ga0316574_0069807 Ga0316574_0069807_935_1702 254
69 3300035691 Ga0373931_0143585 Ga0373931_0143585_441_1208 254
70 3300041459 Ga0451800_1070302 Ga0451800_1070302_30_797 254
71 3300045051 Ga0451576_0232729 Ga0451576_0232729_588_1355 254
72 3300048909 Ga0496106_0175508 Ga0496106_0175508_863_1630 254
73 3300048911 Ga0496108_0034716 Ga0496108_0034716_2076_2843 254
74 3300048912 Ga0496109_0140235 Ga0496109_0140235_77_844 254
75 3300048915 Ga0496112_0084227 Ga0496112_0084227_1085_1852 254
76 3300048916 Ga0496113_0018906 Ga0496113_0018906_249_1016 254
77 3300053153 Ga0500616_0000032 Ga0500616_0000032_285248_286015 254
78 3300005614 Ga0068856_100155246 Ga0068856_1001552462 255
79 3300005618 Ga0068864_100126250 Ga0068864_1001262502 255
80 3300005841 Ga0068863_100233339 Ga0068863_1002333392 255
81 3300006195 Ga0075366_10221852 Ga0075366_102218522 255
82 3300009177 Ga0105248_10320002 Ga0105248_103200022 255
83 3300025304 Ga0209257_1006592 Ga0209257_10065924 255
84 3300025913 Ga0207695_10407274 Ga0207695_104072741 255
85 3300025925 Ga0207650_10068468 Ga0207650_100684682 255
86 3300025941 Ga0207711_10325862 Ga0207711_103258622 255
87 3300026088 Ga0207641_10194498 Ga0207641_101944982 255
88 3300026095 Ga0207676_10197427 Ga0207676_101974272 255
89 3300044656 Ga0466969_0077630 Ga0466969_0077630_145_948 255
90 3300046528 Ga0495642_0034886 Ga0495642_0034886_671_1477 255
91 3300047318 Ga0495636_0132319 Ga0495636_0132319_76_882 255
92 3300050493 nmdc:mga0k408_44999_c1 nmdc:mga0k408_44999_c1_1158_1979 255
93 3300005937 Ga0081455_10000999 Ga0081455_100009999 256
94 3300031507 Ga0307509_10263208 Ga0307509_102632081 256
95 3300046506 Ga0495583_0001634 Ga0495583_0001634_14833_15606 256
96 3300046694 Ga0495649_0111944 Ga0495649_0111944_597_1370 256
97 3300053092 Ga0500583_0013083 Ga0500583_0013083_998_1783 256
98 3300053093 Ga0500651_0041030 Ga0500651_0041030_137_922 256
99 3300053124 Ga0500617_039511 Ga0500617_039511_457_1242 256
100 3300053134 Ga0500658_0012633 Ga0500658_0012633_139_924 256
101 3300053139 Ga0500568_0043187 Ga0500568_0043187_510_1295 256
102 3300053146 Ga0500588_0017608 Ga0500588_0017608_359_1144 256
103 iso_pu_bacteria 2510065045 2510250276 256
104 iso_pu_bacteria 2511231025 2511380677 256
105 iso_pu_bacteria 2511231035 2511433344 256
106 iso_pu_bacteria 2711768156 2712471899 256
107 iso_pu_bacteria 2718217991 2719639427 256
108 iso_pu_bacteria 2744054900 2746092009 256
109 iso_pu_bacteria 2744054901 2746099872 256
110 iso_pu_bacteria 2751185846 2753571297 256
111 iso_pu_bacteria 2842324504 2842330187 256
112 iso_pu_bacteria 2842348783 2842356770 256
113 iso_pu_bacteria 2876601092 2876604760 256
114 iso_pu_bacteria 2881101125 2881101902 256
115 iso_pu_bacteria 2900634093 2900635862 256
116 iso_pu_bacteria 642555113 642620614 256
117 iso_pu_bacteria 8016733728 8016738799 256
118 iso_pu_bacteria 8019499862 8019500445 256
119 3300002987 JGI25159J45721_1016387 JGI25159J45721_10163871 257
120 3300005262 Ga0065165_1000067 Ga0065165_100006713 257
121 3300005844 Ga0068862_100471286 Ga0068862_1004712862 257
122 3300025208 Ga0209436_117706 Ga0209436_1177062 257
123 3300025284 Ga0209130_1001240 Ga0209130_10012401 257
124 3300028380 Ga0268265_10155587 Ga0268265_101555873 257
125 3300031727 Ga0316576_10025890 Ga0316576_100258904 257
126 3300031728 Ga0316578_10058454 Ga0316578_100584543 257
127 3300031838 Ga0307518_10114481 Ga0307518_101144812 257
128 3300035398 Ga0316574_0026414 Ga0316574_0026414_2597_3421 257
129 3300035398 Ga0316574_0067518 Ga0316574_0067518_1280_2104 257
130 3300036647 Ga0316582_0164775 Ga0316582_0164775_637_1416 257
131 3300036712 Ga0316584_0022384 Ga0316584_0022384_2514_3341 257
132 3300036712 Ga0316584_0072962 Ga0316584_0072962_1176_1955 257
133 3300038726 Ga0400490_29153 Ga0400490_29153_2904_3680 257
134 3300046452 Ga0495617_015555 Ga0495617_015555_1545_2330 257
135 3300046452 Ga0495617_069278 Ga0495617_069278_153_938 257
136 3300046457 Ga0495590_0021775 Ga0495590_0021775_982_1767 257
137 3300046460 Ga0495638_0008635 Ga0495638_0008635_1212_1997 257
138 3300046474 Ga0495605_0005132 Ga0495605_0005132_1161_1946 257
139 3300046491 Ga0495584_0001843 Ga0495584_0001843_2710_3495 257
140 3300046491 Ga0495584_0009209 Ga0495584_0009209_393_1211 257
141 3300046491 Ga0495584_0186006 Ga0495584_0186006_174_959 257
142 3300046492 Ga0495585_0053310 Ga0495585_0053310_181_966 257
143 3300046501 Ga0495607_0026284 Ga0495607_0026284_1824_2642 257
144 3300046501 Ga0495607_0068293 Ga0495607_0068293_1029_1814 257
145 3300046501 Ga0495607_0071780 Ga0495607_0071780_984_1769 257
146 3300046501 Ga0495607_0093522 Ga0495607_0093522_180_965 257
147 3300046501 Ga0495607_0162697 Ga0495607_0162697_192_977 257
148 3300046506 Ga0495583_0000004 Ga0495583_0000004_552247_553032 257
149 3300046506 Ga0495583_0020469 Ga0495583_0020469_228_1046 257
150 3300046507 Ga0495606_0042581 Ga0495606_0042581_1863_2651 257
151 3300046507 Ga0495606_0056855 Ga0495606_0056855_1468_2253 257
152 3300046512 Ga0495610_0052448 Ga0495610_0052448_1102_1887 257
153 3300046513 Ga0495616_0023828 Ga0495616_0023828_210_995 257
154 3300046513 Ga0495616_0029386 Ga0495616_0029386_1101_1886 257
155 3300046523 Ga0495644_0029527 Ga0495644_0029527_169_954 257
156 3300046523 Ga0495644_0033556 Ga0495644_0033556_973_1758 257
157 3300046524 Ga0495648_0003845 Ga0495648_0003845_10942_11727 257
158 3300046528 Ga0495642_0042628 Ga0495642_0042628_213_998 257
159 3300046530 Ga0495654_0010971 Ga0495654_0010971_325_1113 257
160 3300046538 Ga0495609_0002290 Ga0495609_0002290_2878_3696 257
161 3300046538 Ga0495609_0008339 Ga0495609_0008339_203_988 257
162 3300046538 Ga0495609_0018425 Ga0495609_0018425_1505_2290 257
163 3300046557 Ga0495622_0089410 Ga0495622_0089410_541_1326 257
164 3300046558 Ga0495633_0216760 Ga0495633_0216760_46_831 257
165 3300046616 Ga0495668_0036226 Ga0495668_0036226_592_1410 257
166 3300046616 Ga0495668_0255778 Ga0495668_0255778_138_923 257
167 3300046648 Ga0495611_0012970 Ga0495611_0012970_181_966 257
168 3300046648 Ga0495611_0071758 Ga0495611_0071758_630_1415 257
169 3300046660 Ga0495625_0013755 Ga0495625_0013755_2091_2879 257
170 3300046660 Ga0495625_0020795 Ga0495625_0020795_1981_2799 257
171 3300046664 Ga0495659_0000128 Ga0495659_0000128_29531_30319 257
172 3300046664 Ga0495659_0010448 Ga0495659_0010448_1217_2002 257
173 3300046664 Ga0495659_0036069 Ga0495659_0036069_656_1474 257
174 3300046665 Ga0495661_0188865 Ga0495661_0188865_55_840 257
175 3300046684 Ga0495669_0001427 Ga0495669_0001427_2396_3214 257
176 3300046691 Ga0495670_0008487 Ga0495670_0008487_172_957 257
177 3300046691 Ga0495670_0011747 Ga0495670_0011747_2232_3017 257
178 3300046692 Ga0495671_0000234 Ga0495671_0000234_2734_3522 257
179 3300046794 Ga0495589_0030821 Ga0495589_0030821_1402_2187 257
180 3300046810 Ga0495660_0002657 Ga0495660_0002657_2067_2852 257
181 3300046810 Ga0495660_0038578 Ga0495660_0038578_1450_2238 257
182 3300047318 Ga0495636_0002363 Ga0495636_0002363_1068_1853 257
183 3300047318 Ga0495636_0005534 Ga0495636_0005534_20_838 257
184 3300047320 Ga0495672_0000035 Ga0495672_0000035_30479_31267 257
185 3300047320 Ga0495672_0071295 Ga0495672_0071295_1134_1919 257
186 3300047320 Ga0495672_0089624 Ga0495672_0089624_181_966 257
187 3300047323 Ga0495683_0015974 Ga0495683_0015974_1460_2245 257
188 3300047443 Ga0495687_000487 Ga0495687_000487_47152_47937 257
189 3300047443 Ga0495687_065092 Ga0495687_065092_398_1216 257
190 3300047445 Ga0495677_0002848 Ga0495677_0002848_2930_3715 257
191 3300047447 Ga0495685_000132 Ga0495685_000132_13648_14433 257
192 3300047447 Ga0495685_061798 Ga0495685_061798_296_1114 257
193 3300047469 Ga0495673_0011436 Ga0495673_0011436_1343_2128 257
194 3300047470 Ga0495681_0015166 Ga0495681_0015166_1841_2659 257
195 3300047472 Ga0495686_0001783 Ga0495686_0001783_18766_19554 257
196 3300047472 Ga0495686_0032551 Ga0495686_0032551_2322_3107 257
197 3300047472 Ga0495686_0046000 Ga0495686_0046000_1917_2702 257
198 3300049459 Ga0495678_001414 Ga0495678_001414_16906_17691 257
199 3300049460 Ga0495682_0000763 Ga0495682_0000763_10182_10967 257
200 3300049460 Ga0495682_0004796 Ga0495682_0004796_905_1690 257
201 iso_pu_bacteria 2643221639 2644220825 257
202 iso_pu_bacteria 2643221646 2644256533 257
203 iso_pu_bacteria 2738541280 2738740712 257
204 iso_pu_bacteria 2738541300 2738845030 257
205 iso_pu_bacteria 2738541337 2739057247 257
206 iso_pu_bacteria 2738543018 2739274609 257
207 iso_pu_bacteria 2738543030 2739343653 257
208 3300006948 Ga0099826_10000003 Ga0099826_10000003941 258
209 3300009036 Ga0105244_10001359 Ga0105244_1000135918 258
210 3300009553 Ga0105249_10175232 Ga0105249_101752322 258
211 3300025263 Ga0209565_1006289 Ga0209565_10062895 258
212 3300025299 Ga0209256_1000013 Ga0209256_1000013536 258
213 3300025941 Ga0207711_10022536 Ga0207711_100225365 258
214 3300025942 Ga0207689_10091292 Ga0207689_100912921 258
215 3300027666 Ga0209282_1000002 Ga0209282_100000267 258
216 3300030745 Ga0316182_1415013 Ga0316182_14150132 258
217 3300031548 Ga0307408_100000232 Ga0307408_10000023251 258
218 3300031727 Ga0316576_10004964 Ga0316576_100049647 258
219 3300035398 Ga0316574_0000055 Ga0316574_0000055_16245_17066 258
220 3300036647 Ga0316582_0075867 Ga0316582_0075867_1146_1967 258
221 3300036712 Ga0316584_0426597 Ga0316584_0426597_121_915 258
222 3300046810 Ga0495660_0012352 Ga0495660_0012352_1815_2606 258
223 3300047320 Ga0495672_0000013 Ga0495672_0000013_76692_77483 258
224 3300047472 Ga0495686_0118940 Ga0495686_0118940_278_1069 258
225 3300048906 Ga0496103_0019423 Ga0496103_0019423_1689_2477 258
226 3300048917 Ga0496114_0035890 Ga0496114_0035890_398_1186 258
227 3300049459 Ga0495678_063019 Ga0495678_063019_538_1329 258
228 3300049667 Ga0501230_005664 Ga0501230_005664_913_1704 258
229 3300049766 Ga0501269_000137 Ga0501269_000137_18493_19281 258
230 iso_pu_bacteria 2599185292 2599903649 258
231 iso_pu_bacteria 2643221569 2643860130 258
232 iso_pu_bacteria 2643221594 2643979244 258
233 iso_pu_bacteria 2643221621 2644120162 258
234 iso_pu_bacteria 2643221645 2644249289 258
235 iso_pu_bacteria 2643221664 2644359387 258
236 iso_pu_bacteria 2808606395 2809035878 258
237 iso_pu_bacteria 2857537821 2857538869 258
238 iso_pu_bacteria 2941479691 2941483428 258
239 3300048917 Ga0496114_0270908 Ga0496114_0270908_205_1071 259
240 iso_pu_bacteria 2643221644 2644244185 259
241 3300002705 JGI25156J39149_1000937 JGI25156J39149_100093715 260
242 3300006038 Ga0075365_10257250 Ga0075365_102572501 260
243 3300006048 Ga0075363_100042590 Ga0075363_1000425902 260
244 3300006178 Ga0075367_10015518 Ga0075367_100155182 260
245 3300006195 Ga0075366_10062019 Ga0075366_100620191 260
246 3300009011 Ga0105251_10001278 Ga0105251_100012787 260
247 3300009036 Ga0105244_10003124 Ga0105244_100031246 260
248 3300009036 Ga0105244_10003155 Ga0105244_100031559 260
249 3300011119 Ga0105246_10004791 Ga0105246_100047914 260
250 3300013100 Ga0157373_10000911 Ga0157373_1000091120 260
251 3300013102 Ga0157371_10000491 Ga0157371_1000049122 260
252 3300013105 Ga0157369_10081321 Ga0157369_100813213 260
253 3300013105 Ga0157369_10274606 Ga0157369_102746062 260
254 3300025256 Ga0209759_1000033 Ga0209759_1000033107 260
255 3300025711 Ga0207696_1000113 Ga0207696_1000113111 260
256 3300025728 Ga0207655_1003440 Ga0207655_100344012 260
257 3300025728 Ga0207655_1010720 Ga0207655_10107207 260
258 3300025735 Ga0207713_1000347 Ga0207713_10003478 260
259 3300031548 Ga0307408_100011172 Ga0307408_1000111726 260
260 3300031731 Ga0307405_10034126 Ga0307405_100341263 260
261 3300031995 Ga0307409_100016301 Ga0307409_1000163014 260
262 3300032002 Ga0307416_100012248 Ga0307416_1000122484 260
263 3300032002 Ga0307416_101046005 Ga0307416_1010460051 260
264 3300032005 Ga0307411_10025039 Ga0307411_100250394 260
265 3300041408 Ga0439453_0010252 Ga0439453_0010252_374_1174 260
266 3300042010 Ga0439452_000002 Ga0439452_000002_1208376_1209158 260
267 3300042138 Ga0450903_008716 Ga0450903_008716_648_1448 260
268 3300042156 Ga0439446_0010002 Ga0439446_0010002_1053_1853 260
269 3300042439 Ga0439464_0012210 Ga0439464_0012210_306_1106 260
270 3300044673 Ga0453683_0007447 Ga0453683_0007447_1891_2697 260
271 3300045051 Ga0451576_0075742 Ga0451576_0075742_1339_2145 260
272 3300046452 Ga0495617_036558 Ga0495617_036558_473_1255 260
273 3300046454 Ga0495592_0041458 Ga0495592_0041458_2421_3206 260
274 3300046455 Ga0495603_0024142 Ga0495603_0024142_2695_3480 260
275 3300046457 Ga0495590_0007818 Ga0495590_0007818_3291_4076 260
276 3300046458 Ga0495591_000006 Ga0495591_000006_145654_146436 260
277 3300046458 Ga0495591_000708 Ga0495591_000708_13583_14368 260
278 3300046458 Ga0495591_004286 Ga0495591_004286_2331_3116 260
279 3300046459 Ga0495629_0013743 Ga0495629_0013743_2785_3570 260
280 3300046459 Ga0495629_0020594 Ga0495629_0020594_517_1302 260
281 3300046459 Ga0495629_0032249 Ga0495629_0032249_1014_1799 260
282 3300046460 Ga0495638_0005690 Ga0495638_0005690_6533_7318 260
283 3300046461 Ga0495641_0076187 Ga0495641_0076187_479_1264 260
284 3300046462 Ga0495651_0002299 Ga0495651_0002299_1958_2743 260
285 3300046462 Ga0495651_0031041 Ga0495651_0031041_1668_2453 260
286 3300046463 Ga0495653_0029195 Ga0495653_0029195_2737_3522 260
287 3300046463 Ga0495653_0182344 Ga0495653_0182344_69_854 260
288 3300046463 Ga0495653_0304947 Ga0495653_0304947_228_1013 260
289 3300046471 Ga0495650_0002885 Ga0495650_0002885_5727_6512 260
290 3300046471 Ga0495650_0003344 Ga0495650_0003344_3635_4420 260
291 3300046471 Ga0495650_0007225 Ga0495650_0007225_4193_4978 260
292 3300046472 Ga0495580_0002864 Ga0495580_0002864_213_998 260
293 3300046472 Ga0495580_0004033 Ga0495580_0004033_7574_8359 260
294 3300046472 Ga0495580_0048073 Ga0495580_0048073_311_1096 260
295 3300046473 Ga0495582_0009034 Ga0495582_0009034_66_851 260
296 3300046473 Ga0495582_0041510 Ga0495582_0041510_469_1254 260
297 3300046474 Ga0495605_0004455 Ga0495605_0004455_961_1746 260
298 3300046476 Ga0495662_0006294 Ga0495662_0006294_3832_4617 260
299 3300046476 Ga0495662_0026476 Ga0495662_0026476_1465_2250 260
300 3300046477 Ga0495664_0005206 Ga0495664_0005206_2126_2911 260
301 3300046499 Ga0495594_0074435 Ga0495594_0074435_971_1756 260
302 3300046500 Ga0495596_0014593 Ga0495596_0014593_1843_2628 260
303 3300046500 Ga0495596_0128004 Ga0495596_0128004_125_910 260
304 3300046506 Ga0495583_0000192 Ga0495583_0000192_12132_12917 260
305 3300046506 Ga0495583_0002676 Ga0495583_0002676_9021_9806 260
306 3300046507 Ga0495606_0007446 Ga0495606_0007446_6778_7563 260
307 3300046511 Ga0495608_0008757 Ga0495608_0008757_55_840 260
308 3300046512 Ga0495610_0006265 Ga0495610_0006265_2457_3242 260
309 3300046514 Ga0495618_0007359 Ga0495618_0007359_3788_4573 260
310 3300046514 Ga0495618_0011445 Ga0495618_0011445_2695_3480 260
311 3300046514 Ga0495618_0031012 Ga0495618_0031012_2284_3069 260
312 3300046515 Ga0495620_0000377 Ga0495620_0000377_4399_5184 260
313 3300046515 Ga0495620_0007751 Ga0495620_0007751_4017_4802 260
314 3300046516 Ga0495628_0033520 Ga0495628_0033520_1144_1929 260
315 3300046516 Ga0495628_0084762 Ga0495628_0084762_69_854 260
316 3300046517 Ga0495630_0011098 Ga0495630_0011098_2199_2984 260
317 3300046517 Ga0495630_0021605 Ga0495630_0021605_3768_4553 260
318 3300046517 Ga0495630_0060130 Ga0495630_0060130_21_806 260
319 3300046519 Ga0495632_0000255 Ga0495632_0000255_10814_11599 260
320 3300046520 Ga0495637_0007847 Ga0495637_0007847_3521_4306 260
321 3300046524 Ga0495648_0003924 Ga0495648_0003924_11141_11926 260
322 3300046526 Ga0495666_0003786 Ga0495666_0003786_6665_7450 260
323 3300046526 Ga0495666_0021013 Ga0495666_0021013_1289_2074 260
324 3300046528 Ga0495642_0025379 Ga0495642_0025379_1484_2269 260
325 3300046529 Ga0495652_0123897 Ga0495652_0123897_827_1612 260
326 3300046530 Ga0495654_0000013 Ga0495654_0000013_192288_193070 260
327 3300046531 Ga0495665_0035142 Ga0495665_0035142_1213_1998 260
328 3300046531 Ga0495665_0161269 Ga0495665_0161269_69_854 260
329 3300046533 Ga0495640_0002432 Ga0495640_0002432_832_1617 260
330 3300046533 Ga0495640_0031853 Ga0495640_0031853_1005_1790 260
331 3300046533 Ga0495640_0311473 Ga0495640_0311473_56_841 260
332 3300046536 Ga0495587_0001857 Ga0495587_0001857_3737_4522 260
333 3300046538 Ga0495609_0028433 Ga0495609_0028433_410_1195 260
334 3300046543 Ga0495645_0002449 Ga0495645_0002449_6953_7738 260
335 3300046557 Ga0495622_0000302 Ga0495622_0000302_14241_15026 260
336 3300046642 Ga0495634_0010873 Ga0495634_0010873_2079_2864 260
337 3300046648 Ga0495611_0012025 Ga0495611_0012025_1730_2515 260
338 3300046660 Ga0495625_0041123 Ga0495625_0041123_2148_2933 260
339 3300046663 Ga0495635_0039437 Ga0495635_0039437_1035_1820 260
340 3300046665 Ga0495661_0000312 Ga0495661_0000312_39919_40704 260
341 3300046665 Ga0495661_0007287 Ga0495661_0007287_6142_6927 260
342 3300046665 Ga0495661_0038454 Ga0495661_0038454_2017_2802 260
343 3300046675 Ga0495657_0068564 Ga0495657_0068564_1133_1918 260
344 3300046678 Ga0495599_0013702 Ga0495599_0013702_2659_3444 260
345 3300046678 Ga0495599_0043749 Ga0495599_0043749_1488_2273 260
346 3300046678 Ga0495599_0149419 Ga0495599_0149419_650_1435 260
347 3300046679 Ga0495623_0001488 Ga0495623_0001488_10541_11326 260
348 3300046679 Ga0495623_0001635 Ga0495623_0001635_3741_4526 260
349 3300046679 Ga0495623_0022723 Ga0495623_0022723_2229_3014 260
350 3300046680 Ga0495646_0013273 Ga0495646_0013273_2417_3202 260
351 3300046684 Ga0495669_0023483 Ga0495669_0023483_1276_2061 260
352 3300046689 Ga0495613_0068202 Ga0495613_0068202_315_1100 260
353 3300046689 Ga0495613_0102670 Ga0495613_0102670_843_1628 260
354 3300046690 Ga0495624_0000787 Ga0495624_0000787_22168_22953 260
355 3300046690 Ga0495624_0035968 Ga0495624_0035968_1472_2257 260
356 3300046690 Ga0495624_0050233 Ga0495624_0050233_1841_2626 260
357 3300046691 Ga0495670_0036263 Ga0495670_0036263_761_1546 260
358 3300046692 Ga0495671_0023179 Ga0495671_0023179_1180_1965 260
359 3300046694 Ga0495649_0003953 Ga0495649_0003953_7352_8137 260
360 3300046794 Ga0495589_0015413 Ga0495589_0015413_1539_2324 260
361 3300046794 Ga0495589_0047783 Ga0495589_0047783_41_826 260
362 3300047315 Ga0495581_0019631 Ga0495581_0019631_1202_1987 260
363 3300047315 Ga0495581_0020585 Ga0495581_0020585_1921_2706 260
364 3300047317 Ga0495604_0003221 Ga0495604_0003221_6494_7279 260
365 3300047317 Ga0495604_0071240 Ga0495604_0071240_215_1000 260
366 3300047317 Ga0495604_0232902 Ga0495604_0232902_224_1009 260
367 3300047319 Ga0495674_0038277 Ga0495674_0038277_2223_3008 260
368 3300047319 Ga0495674_0119294 Ga0495674_0119294_1402_2187 260
369 3300047319 Ga0495674_0140481 Ga0495674_0140481_957_1742 260
370 3300047320 Ga0495672_0040219 Ga0495672_0040219_1961_2746 260
371 3300047321 Ga0495676_0047420 Ga0495676_0047420_2046_2831 260
372 3300047321 Ga0495676_0057759 Ga0495676_0057759_271_1056 260
373 3300047321 Ga0495676_0069664 Ga0495676_0069664_69_854 260
374 3300047322 Ga0495680_0023350 Ga0495680_0023350_2755_3540 260
375 3300047322 Ga0495680_0031357 Ga0495680_0031357_2567_3352 260
376 3300047322 Ga0495680_0237906 Ga0495680_0237906_194_979 260
377 3300047323 Ga0495683_0009105 Ga0495683_0009105_814_1599 260
378 3300047323 Ga0495683_0017943 Ga0495683_0017943_1287_2072 260
379 3300047444 Ga0495675_0020309 Ga0495675_0020309_2430_3215 260
380 3300047444 Ga0495675_0021583 Ga0495675_0021583_2239_3024 260
381 3300047444 Ga0495675_0041955 Ga0495675_0041955_1885_2670 260
382 3300047446 Ga0495679_000050 Ga0495679_000050_25532_26317 260
383 3300047446 Ga0495679_000683 Ga0495679_000683_14590_15375 260
384 3300047469 Ga0495673_0000211 Ga0495673_0000211_5514_6299 260
385 3300047469 Ga0495673_0003072 Ga0495673_0003072_6433_7218 260
386 3300047471 Ga0495684_0025416 Ga0495684_0025416_1985_2770 260
387 3300047673 Ga0495593_0002313 Ga0495593_0002313_5459_6244 260
388 3300047673 Ga0495593_0016566 Ga0495593_0016566_2458_3243 260
389 3300048088 Ga0495602_0014931 Ga0495602_0014931_4814_5599 260
390 3300048088 Ga0495602_0018887 Ga0495602_0018887_21_806 260
391 3300048088 Ga0495602_0022575 Ga0495602_0022575_4833_5618 260
392 3300048088 Ga0495602_0028092 Ga0495602_0028092_2770_3555 260
393 3300048088 Ga0495602_0380303 Ga0495602_0380303_21_806 260
394 3300048089 Ga0495614_0014052 Ga0495614_0014052_1014_1799 260
395 3300048904 Ga0496101_0000006 Ga0496101_0000006_197647_198429 260
396 3300048905 Ga0496102_0012321 Ga0496102_0012321_5067_5852 260
397 3300048906 Ga0496103_0024129 Ga0496103_0024129_2747_3532 260
398 3300048920 Ga0496117_0019985 Ga0496117_0019985_4613_5398 260
399 3300048920 Ga0496117_0056939 Ga0496117_0056939_305_1090 260
400 3300048921 Ga0496118_0009040 Ga0496118_0009040_2215_3000 260
401 3300048921 Ga0496118_0011515 Ga0496118_0011515_4028_4813 260
402 3300048921 Ga0496118_0016628 Ga0496118_0016628_4253_5038 260
403 3300048921 Ga0496118_0041057 Ga0496118_0041057_2628_3413 260
404 3300048923 Ga0496120_0000069 Ga0496120_0000069_48830_49612 260
405 3300048924 Ga0496121_0001759 Ga0496121_0001759_20889_21674 260
406 3300048924 Ga0496121_0030602 Ga0496121_0030602_4124_4909 260
407 3300048925 Ga0496122_0001533 Ga0496122_0001533_14628_15413 260
408 3300048925 Ga0496122_0010192 Ga0496122_0010192_299_1081 260
409 3300048926 Ga0496123_0000513 Ga0496123_0000513_49339_50124 260
410 3300048926 Ga0496123_0010357 Ga0496123_0010357_3370_4152 260
411 3300048927 Ga0496124_0000229 Ga0496124_0000229_20149_20934 260
412 3300048927 Ga0496124_0008815 Ga0496124_0008815_529_1311 260
413 3300048927 Ga0496124_0011429 Ga0496124_0011429_6720_7502 260
414 3300048929 Ga0496126_0001236 Ga0496126_0001236_32365_33150 260
415 3300048929 Ga0496126_0001826 Ga0496126_0001826_8266_9051 260
416 3300048929 Ga0496126_0043883 Ga0496126_0043883_1943_2725 260
417 3300049459 Ga0495678_061214 Ga0495678_061214_595_1380 260
418 3300049460 Ga0495682_0006175 Ga0495682_0006175_961_1746 260
419 3300049460 Ga0495682_0018388 Ga0495682_0018388_644_1429 260
420 3300050493 nmdc:mga0k408_132288_c1 nmdc:mga0k408_132288_c1_637_1440 260
421 3300050509 nmdc:mga0qj67_208827_c1 nmdc:mga0qj67_208827_c1_382_1185 260
422 3300053083 Ga0495655_0018550 Ga0495655_0018550_50_835 260
423 3300002738 JGI25154J39366_1004078 JGI25154J39366_10040783 261
424 3300002774 JGI25150J39212_1010273 JGI25150J39212_10102732 261
425 3300003763 Ga0055529_1000133 Ga0055529_100013382 261
426 3300003771 Ga0055526_1000230 Ga0055526_10002304 261
427 3300003771 Ga0055526_1000258 Ga0055526_10002585 261
428 3300003794 Ga0055531_10001392 Ga0055531_1000139215 261
429 3300005335 Ga0070666_10411118 Ga0070666_104111181 261
430 3300005337 Ga0070682_100027515 Ga0070682_1000275152 261
431 3300006177 Ga0075362_10003441 Ga0075362_100034411 261
432 3300006195 Ga0075366_10061573 Ga0075366_100615732 261
433 3300006946 Ga0079104_1006106 Ga0079104_10061063 261
434 3300009148 Ga0105243_10057549 Ga0105243_100575492 261
435 3300015261 Ga0182006_1000070 Ga0182006_1000070113 261
436 3300015265 Ga0182005_1000003 Ga0182005_1000003115 261
437 3300025233 Ga0209437_108069 Ga0209437_1080692 261
438 3300025245 Ga0207425_1000360 Ga0207425_10003608 261
439 3300025246 Ga0209646_1000114 Ga0209646_1000114120 261
440 3300025253 Ga0209677_100535 Ga0209677_10053515 261
441 3300025272 Ga0209455_1000063 Ga0209455_1000063211 261
442 3300025294 Ga0209025_1003724 Ga0209025_100372412 261
443 3300025295 Ga0209564_1000006 Ga0209564_1000006894 261
444 3300025295 Ga0209564_1000026 Ga0209564_1000026369 261
445 3300025297 Ga0209758_1000372 Ga0209758_100037233 261
446 3300025728 Ga0207655_1001536 Ga0207655_100153618 261
447 3300025728 Ga0207655_1004984 Ga0207655_10049845 261
448 3300025927 Ga0207687_10389183 Ga0207687_103891832 261
449 3300027111 Ga0209281_1009657 Ga0209281_10096572 261
450 3300028794 Ga0307515_10045652 Ga0307515_100456525 261
451 3300030744 Ga0316181_1104601 Ga0316181_11046012 261
452 3300031548 Ga0307408_100000046 Ga0307408_10000004672 261
453 3300032005 Ga0307411_10005120 Ga0307411_100051205 261
454 3300035114 Ga0373939_0123703 Ga0373939_0123703_53_898 261
455 3300042000 Ga0439437_003746 Ga0439437_003746_540_1361 261
456 3300042117 Ga0450913_001531 Ga0450913_001531_298_1101 261
457 3300042126 Ga0450888_000330 Ga0450888_000330_3138_3959 261
458 3300042127 Ga0450890_001017 Ga0450890_001017_2488_3309 261
459 3300042129 Ga0450891_000290 Ga0450891_000290_702_1523 261
460 3300042130 Ga0450892_002966 Ga0450892_002966_65_886 261
461 3300042144 Ga0450889_000647 Ga0450889_000647_1407_2228 261
462 3300042530 Ga0450916_001625 Ga0450916_001625_1049_1870 261
463 3300044842 Ga0466957_0013506 Ga0466957_0013506_3378_4205 261
464 3300045051 Ga0451576_0098633 Ga0451576_0098633_1203_2024 261
465 3300046452 Ga0495617_000048 Ga0495617_000048_111226_112071 261
466 3300046452 Ga0495617_003612 Ga0495617_003612_3573_4415 261
467 3300046453 Ga0495627_000046 Ga0495627_000046_124160_124969 261
468 3300046457 Ga0495590_0000030 Ga0495590_0000030_27967_28776 261
469 3300046460 Ga0495638_0000105 Ga0495638_0000105_43436_44245 261
470 3300046460 Ga0495638_0056593 Ga0495638_0056593_529_1374 261
471 3300046460 Ga0495638_0120078 Ga0495638_0120078_52_903 261
472 3300046463 Ga0495653_0000018 Ga0495653_0000018_43597_44436 261
473 3300046471 Ga0495650_0000212 Ga0495650_0000212_3449_4294 261
474 3300046471 Ga0495650_0000227 Ga0495650_0000227_112332_113177 261
475 3300046471 Ga0495650_0002015 Ga0495650_0002015_15428_16237 261
476 3300046471 Ga0495650_0007378 Ga0495650_0007378_3900_4745 261
477 3300046474 Ga0495605_0000005 Ga0495605_0000005_114473_115327 261
478 3300046474 Ga0495605_0000105 Ga0495605_0000105_90286_91095 261
479 3300046474 Ga0495605_0093870 Ga0495605_0093870_144_953 261
480 3300046475 Ga0495639_0138339 Ga0495639_0138339_250_1059 261
481 3300046492 Ga0495585_0001802 Ga0495585_0001802_6908_7750 261
482 3300046501 Ga0495607_0005215 Ga0495607_0005215_5833_6642 261
483 3300046501 Ga0495607_0008312 Ga0495607_0008312_3673_4482 261
484 3300046506 Ga0495583_0000645 Ga0495583_0000645_33254_34063 261
485 3300046506 Ga0495583_0008863 Ga0495583_0008863_3537_4346 261
486 3300046507 Ga0495606_0000158 Ga0495606_0000158_4699_5541 261
487 3300046507 Ga0495606_0000547 Ga0495606_0000547_14020_14865 261
488 3300046507 Ga0495606_0001026 Ga0495606_0001026_15352_16191 261
489 3300046507 Ga0495606_0008840 Ga0495606_0008840_2035_2901 261
490 3300046507 Ga0495606_0009625 Ga0495606_0009625_3879_4763 261
491 3300046507 Ga0495606_0026012 Ga0495606_0026012_728_1537 261
492 3300046512 Ga0495610_0000021 Ga0495610_0000021_118535_119374 261
493 3300046512 Ga0495610_0005098 Ga0495610_0005098_5748_6614 261
494 3300046512 Ga0495610_0012580 Ga0495610_0012580_711_1550 261
495 3300046520 Ga0495637_0000057 Ga0495637_0000057_88647_89486 261
496 3300046520 Ga0495637_0006210 Ga0495637_0006210_3435_4277 261
497 3300046522 Ga0495643_0000181 Ga0495643_0000181_95821_96660 261
498 3300046522 Ga0495643_0005852 Ga0495643_0005852_3632_4441 261
499 3300046524 Ga0495648_0000008 Ga0495648_0000008_275916_276725 261
500 3300046524 Ga0495648_0003617 Ga0495648_0003617_7333_8172 261
501 3300046524 Ga0495648_0010048 Ga0495648_0010048_3612_4451 261
502 3300046524 Ga0495648_0034770 Ga0495648_0034770_1658_2503 261
503 3300046528 Ga0495642_0004701 Ga0495642_0004701_796_1605 261
504 3300046528 Ga0495642_0030572 Ga0495642_0030572_290_1099 261
505 3300046530 Ga0495654_0000005 Ga0495654_0000005_104044_104883 261
506 3300046530 Ga0495654_0012289 Ga0495654_0012289_2052_2894 261
507 3300046538 Ga0495609_0000049 Ga0495609_0000049_138891_139700 261
508 3300046538 Ga0495609_0009996 Ga0495609_0009996_2465_3274 261
509 3300046538 Ga0495609_0028803 Ga0495609_0028803_73_882 261
510 3300046538 Ga0495609_0100652 Ga0495609_0100652_323_1162 261
511 3300046542 Ga0495597_0003757 Ga0495597_0003757_3707_4516 261
512 3300046542 Ga0495597_0005506 Ga0495597_0005506_2074_2922 261
513 3300046557 Ga0495622_0000415 Ga0495622_0000415_3181_3990 261
514 3300046557 Ga0495622_0000534 Ga0495622_0000534_20990_21790 261
515 3300046558 Ga0495633_0000238 Ga0495633_0000238_45581_46390 261
516 3300046558 Ga0495633_0000409 Ga0495633_0000409_42791_43627 261
517 3300046558 Ga0495633_0005568 Ga0495633_0005568_3670_4500 261
518 3300046558 Ga0495633_0045752 Ga0495633_0045752_354_1199 261
519 3300046616 Ga0495668_0000482 Ga0495668_0000482_30625_31470 261
520 3300046616 Ga0495668_0001995 Ga0495668_0001995_8757_9566 261
521 3300046616 Ga0495668_0005088 Ga0495668_0005088_1282_2124 261
522 3300046660 Ga0495625_0001573 Ga0495625_0001573_1832_2641 261
523 3300046660 Ga0495625_0009520 Ga0495625_0009520_3631_4482 261
524 3300046660 Ga0495625_0012167 Ga0495625_0012167_3553_4398 261
525 3300046665 Ga0495661_0005648 Ga0495661_0005648_1685_2527 261
526 3300046691 Ga0495670_0059608 Ga0495670_0059608_1061_1870 261
527 3300046692 Ga0495671_0000343 Ga0495671_0000343_28595_29431 261
528 3300046694 Ga0495649_0005578 Ga0495649_0005578_3511_4350 261
529 3300046810 Ga0495660_0001130 Ga0495660_0001130_3924_4733 261
530 3300046810 Ga0495660_0003276 Ga0495660_0003276_1231_2073 261
531 3300046810 Ga0495660_0016129 Ga0495660_0016129_1954_2763 261
532 3300046810 Ga0495660_0024315 Ga0495660_0024315_1725_2534 261
533 3300047320 Ga0495672_0000410 Ga0495672_0000410_3794_4633 261
534 3300047323 Ga0495683_0004583 Ga0495683_0004583_1289_2128 261
535 3300047443 Ga0495687_002805 Ga0495687_002805_10299_11108 261
536 3300047443 Ga0495687_003597 Ga0495687_003597_171_980 261
537 3300047445 Ga0495677_0023871 Ga0495677_0023871_1176_2015 261
538 3300047469 Ga0495673_0000033 Ga0495673_0000033_107157_107996 261
539 3300047469 Ga0495673_0000034 Ga0495673_0000034_206397_207254 261
540 3300047469 Ga0495673_0000150 Ga0495673_0000150_2993_3838 261
541 3300047469 Ga0495673_0006037 Ga0495673_0006037_889_1698 261
542 3300047469 Ga0495673_0043807 Ga0495673_0043807_944_1801 261
543 3300047470 Ga0495681_0003316 Ga0495681_0003316_1958_2767 261
544 3300047472 Ga0495686_0012032 Ga0495686_0012032_1736_2581 261
545 3300047472 Ga0495686_0049029 Ga0495686_0049029_1112_1954 261
546 3300048914 Ga0496111_0226201 Ga0496111_0226201_435_1292 261
547 3300048919 Ga0496116_0088362 Ga0496116_0088362_792_1601 261
548 3300048923 Ga0496120_0022028 Ga0496120_0022028_1777_2616 261
549 3300048924 Ga0496121_0027503 Ga0496121_0027503_3315_4154 261
550 3300048925 Ga0496122_0034998 Ga0496122_0034998_1675_2514 261
551 3300048925 Ga0496122_0079452 Ga0496122_0079452_821_1666 261
552 3300048926 Ga0496123_0006224 Ga0496123_0006224_7174_8013 261
553 3300048927 Ga0496124_0067457 Ga0496124_0067457_1854_2663 261
554 3300048927 Ga0496124_0110106 Ga0496124_0110106_1037_1876 261
555 3300048927 Ga0496124_0269004 Ga0496124_0269004_79_924 261
556 3300048928 Ga0496125_0301484 Ga0496125_0301484_98_937 261
557 3300048929 Ga0496126_0009279 Ga0496126_0009279_1771_2610 261
558 3300049459 Ga0495678_000001 Ga0495678_000001_1055848_1056687 261
559 3300049459 Ga0495678_000076 Ga0495678_000076_2411_3220 261
560 3300049684 Ga0501255_000368 Ga0501255_000368_2120_2941 261
561 3300050489 nmdc:mga03683_10149_c1 nmdc:mga03683_10149_c1_2309_3118 261
562 3300050496 nmdc:mga07m45_213_c2 nmdc:mga07m45_213_c2_3422_4243 261
563 3300053125 Ga0500618_002777 Ga0500618_002777_1913_2752 261
564 3300053145 Ga0500586_000469 Ga0500586_000469_3580_4410 261
565 3300053145 Ga0500586_002702 Ga0500586_002702_1971_2813 261
566 iso_pu_bacteria 2574179768 2574431484 261
567 iso_pu_bacteria 2738541297 2738825905 261
568 iso_pu_bacteria 2738541357 2739149702 261
569 iso_pu_bacteria 2738543003 2739191621 261
570 iso_pu_bacteria 2738543026 2739318098 261
571 iso_pu_bacteria 2738543029 2739336339 261
572 iso_pu_bacteria 2821131069 2821135547 261
573 iso_pu_bacteria 2842711865 2842713974 261
574 iso_pu_bacteria 2857553236 2857555024 261
575 iso_pu_bacteria 2857558681 2857562462 261
576 iso_pu_bacteria 2857564685 2857566308 261
577 iso_pu_bacteria 2904424332 2904429968 261
578 iso_pu_bacteria 2919476304 2919478875 261
579 3300009036 Ga0105244_10094326 Ga0105244_100943261 262
580 3300031711 Ga0265314_10041423 Ga0265314_100414233 262
581 3300046471 Ga0495650_0000099 Ga0495650_0000099_132034_132882 262
582 3300046528 Ga0495642_0016872 Ga0495642_0016872_1378_2184 262
583 3300046472 Ga0495580_0012883 Ga0495580_0012883_1937_2761 263
584 3300048909 Ga0496106_0000069 Ga0496106_0000069_36702_37535 263
585 3300048924 Ga0496121_0000102 Ga0496121_0000102_149157_149990 263
586 3300050491 nmdc:mga00v17_68457_c1 nmdc:mga00v17_68457_c1_336_1127 263
587 iso_pu_bacteria 2842454564 2842457771 263
588 3300002705 JGI25156J39149_1000296 JGI25156J39149_100029628 264
589 3300003771 Ga0055526_1003989 Ga0055526_10039898 264
590 3300005327 Ga0070658_10027838 Ga0070658_100278383 264
591 3300031238 Ga0265332_10000030 Ga0265332_1000003096 264
592 3300045051 Ga0451576_0775869 Ga0451576_0775869_101_940 264
593 3300047472 Ga0495686_0103663 Ga0495686_0103663_741_1535 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

17

246

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9966 8 253
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9893 8 252
2b3k-assembly1.cif.gz_A crystal structure of human methionine aminopeptidase type i in the holo form 0.981 8 256
5yoh-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine 0.9805 7 252
5yxf-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine 0.9804 7 252
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.996 8 255 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9877 18 128 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9844 8 252 3.90.230.10
af_A0A1D6PU20_39_318_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9833 7 253 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9832 52 252 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A4Q6F1R4-F1-model_v4 deleted 1.001 40 252
AF-A0A3C0LYD4-F1-model_v4 deleted 1 107 207
AF-A0A3M3I911-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9995 43 207 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-V6F6N4-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9983 8 253 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A6B0TU55-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9983 18 251 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
95.22 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map