F467267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 317 | 546 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0009625|Ga0495606_0009625_3879_4763 |
| Length | 294 |
| Sequence | MSRRNANLIKSPEQIVTARVAAQLAADVLTMIGPHIKAGVTTAHLDQLCNDYIVNVQKAIPANVGYGGFPATVCSSVNHVVCHGIPSEDELLKDGDIINIDVAVIKDGWHGDTSRMYYVGEPSKPTRKLVETTYAAMWAGIRAVKPRATLGDVGFAIQTVAEKAGYSVVLDYCGHGIGMVYHEEPQVAHYGRPGQGVVLKPGMLFTIEPMINAGKAATKELSDGWTVETRDKSLSAQWEHMVLVTETGFEVLTLAPGETGAKSQIPNAVPAGAAAAVAEADITGAPSAPPASVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 2 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 3 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 4 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 5 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 6 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 7 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 8 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 9 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 10 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 11 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 12 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 13 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 14 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 15 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 16 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 17 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 18 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 19 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 20 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 21 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 22 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 23 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 24 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 25 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 26 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 27 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 28 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 29 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 30 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 31 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 32 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 33 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 34 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 35 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 36 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 37 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 38 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 39 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 40 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 41 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 42 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 43 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 44 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 45 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 46 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 47 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 48 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 83 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 144 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 145 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 152 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 159 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 160 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 164 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 167 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 168 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 170 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 171 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 172 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 173 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 174 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 175 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 176 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 177 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 178 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 181 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 182 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 183 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 297 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 299 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 300 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 309 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 312 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 313 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 316 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 317 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.07 |
| Metatranscriptomes | 0 |
| Isolates | 7.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.25 |
| Nodule | 1.52 |
| Rhizoplane | 2.53 |
| Rhizosphere | 75.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000296 | 3300002705 | Bacteria | 33467 |
| 2 | JGI25156J39149_1000937 | 3300002705 | Bacteria | 14067 |
| 3 | JGI25154J39366_1004078 | 3300002738 | Bacteria | 2759 |
| 4 | JGI25150J39212_1010273 | 3300002774 | Bacteria | 1745 |
| 5 | JGI25159J45721_1016387 | 3300002987 | Bacteria | 1581 |
| 6 | Ga0055529_1000133 | 3300003763 | Bacteria | 104484 |
| 7 | Ga0055526_1000230 | 3300003771 | Bacteria | 46917 |
| 8 | Ga0055526_1000258 | 3300003771 | Bacteria | 44725 |
| 9 | Ga0055526_1003989 | 3300003771 | Bacteria | 9084 |
| 10 | Ga0055531_10001392 | 3300003794 | Bacteria | 17911 |
| 11 | Ga0065165_1000067 | 3300005262 | Bacteria | 170811 |
| 12 | Ga0070658_10027838 | 3300005327 | Bacteria | 4535 |
| 13 | Ga0070683_100074197 | 3300005329 | Bacteria | 3177 |
| 14 | Ga0070690_100006654 | 3300005330 | Bacteria | 6566 |
| 15 | Ga0070670_100003676 | 3300005331 | Bacteria | 12785 |
| 16 | Ga0070666_10023306 | 3300005335 | Bacteria | 4030 |
| 17 | Ga0070666_10411118 | 3300005335 | Bacteria | 973 |
| 18 | Ga0070682_100027515 | 3300005337 | Bacteria | 3413 |
| 19 | Ga0068868_100006907 | 3300005338 | Bacteria | 8065 |
| 20 | Ga0070687_100208037 | 3300005343 | Bacteria | 1190 |
| 21 | Ga0070671_100043419 | 3300005355 | Bacteria | 3735 |
| 22 | Ga0070684_100082244 | 3300005535 | Bacteria | 2851 |
| 23 | Ga0070665_100024470 | 3300005548 | Bacteria | 6081 |
| 24 | Ga0070664_100019280 | 3300005564 | Bacteria | 5611 |
| 25 | Ga0068856_100053824 | 3300005614 | Bacteria | 3969 |
| 26 | Ga0068856_100155246 | 3300005614 | Bacteria | 2299 |
| 27 | Ga0068856_100267290 | 3300005614 | Bacteria | 1726 |
| 28 | Ga0068856_100555734 | 3300005614 | Unclassified | 1169 |
| 29 | Ga0068852_100251381 | 3300005616 | Bacteria | 1694 |
| 30 | Ga0068859_100021941 | 3300005617 | Bacteria | 6402 |
| 31 | Ga0068864_100002439 | 3300005618 | Bacteria | 15376 |
| 32 | Ga0068864_100126250 | 3300005618 | Bacteria | 2293 |
| 33 | Ga0068861_100214826 | 3300005719 | Bacteria | 1622 |
| 34 | Ga0068863_100027333 | 3300005841 | Bacteria | 5441 |
| 35 | Ga0068863_100233339 | 3300005841 | Bacteria | 1775 |
| 36 | Ga0068858_100013508 | 3300005842 | Bacteria | 7704 |
| 37 | Ga0068862_100471286 | 3300005844 | Bacteria | 1187 |
| 38 | Ga0081455_10000999 | 3300005937 | Bacteria | 35875 |
| 39 | Ga0075365_10257250 | 3300006038 | Bacteria | 1227 |
| 40 | Ga0075363_100042590 | 3300006048 | Bacteria | 2400 |
| 41 | Ga0075362_10003441 | 3300006177 | Bacteria | 5531 |
| 42 | Ga0075367_10015518 | 3300006178 | Bacteria | 4144 |
| 43 | Ga0075366_10061573 | 3300006195 | Bacteria | 2230 |
| 44 | Ga0075366_10062019 | 3300006195 | Bacteria | 2223 |
| 45 | Ga0075366_10221852 | 3300006195 | Bacteria | 1152 |
| 46 | Ga0097621_100192077 | 3300006237 | Bacteria | 1769 |
| 47 | Ga0075430_100102222 | 3300006846 | Bacteria | 2393 |
| 48 | Ga0075429_100314454 | 3300006880 | Bacteria | 1371 |
| 49 | Ga0097620_100021941 | 3300006931 | Bacteria | 6402 |
| 50 | Ga0079104_1006106 | 3300006946 | Bacteria | 4650 |
| 51 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 52 | Ga0105251_10001278 | 3300009011 | Bacteria | 21757 |
| 53 | Ga0105244_10001359 | 3300009036 | Bacteria | 19896 |
| 54 | Ga0105244_10003124 | 3300009036 | Bacteria | 12059 |
| 55 | Ga0105244_10003155 | 3300009036 | Bacteria | 11977 |
| 56 | Ga0105244_10094326 | 3300009036 | Bacteria | 1469 |
| 57 | Ga0105245_10009458 | 3300009098 | Bacteria | 8500 |
| 58 | Ga0105243_10057549 | 3300009148 | Bacteria | 3096 |
| 59 | Ga0105248_10000927 | 3300009177 | Bacteria | 32633 |
| 60 | Ga0105248_10320002 | 3300009177 | Bacteria | 1747 |
| 61 | Ga0105249_10175232 | 3300009553 | Bacteria | 2083 |
| 62 | Ga0105239_10368322 | 3300010375 | Bacteria | 1623 |
| 63 | Ga0105239_10938288 | 3300010375 | Bacteria | 994 |
| 64 | Ga0105246_10004756 | 3300011119 | Bacteria | 8268 |
| 65 | Ga0105246_10004791 | 3300011119 | Bacteria | 8239 |
| 66 | Ga0157373_10000911 | 3300013100 | Bacteria | 22918 |
| 67 | Ga0157371_10000491 | 3300013102 | Bacteria | 47942 |
| 68 | Ga0157369_10081321 | 3300013105 | Bacteria | 3467 |
| 69 | Ga0157369_10274606 | 3300013105 | Bacteria | 1756 |
| 70 | Ga0157374_10002219 | 3300013296 | Bacteria | 16376 |
| 71 | Ga0157378_10522155 | 3300013297 | Bacteria | 1189 |
| 72 | Ga0163162_10005133 | 3300013306 | Bacteria | 12619 |
| 73 | Ga0157375_10010140 | 3300013308 | Bacteria | 8287 |
| 74 | Ga0163163_10021084 | 3300014325 | Bacteria | 6147 |
| 75 | Ga0157379_10016987 | 3300014968 | Bacteria | 6405 |
| 76 | Ga0182006_1000070 | 3300015261 | Bacteria | 137793 |
| 77 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 78 | Ga0209436_117706 | 3300025208 | Bacteria | 1034 |
| 79 | Ga0209437_108069 | 3300025233 | Bacteria | 1692 |
| 80 | Ga0207425_1000360 | 3300025245 | Bacteria | 31520 |
| 81 | Ga0209646_1000114 | 3300025246 | Bacteria | 152958 |
| 82 | Ga0209677_100535 | 3300025253 | Bacteria | 21152 |
| 83 | Ga0209759_1000033 | 3300025256 | Bacteria | 276117 |
| 84 | Ga0209565_1006289 | 3300025263 | Bacteria | 3348 |
| 85 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 86 | Ga0209130_1001240 | 3300025284 | Bacteria | 17919 |
| 87 | Ga0209025_1003724 | 3300025294 | Bacteria | 14000 |
| 88 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 89 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 90 | Ga0209758_1000372 | 3300025297 | Bacteria | 78825 |
| 91 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 92 | Ga0209257_1006592 | 3300025304 | Bacteria | 7402 |
| 93 | Ga0207696_1000113 | 3300025711 | Bacteria | 151878 |
| 94 | Ga0207655_1001536 | 3300025728 | Bacteria | 20891 |
| 95 | Ga0207655_1003440 | 3300025728 | Bacteria | 11778 |
| 96 | Ga0207655_1004984 | 3300025728 | Bacteria | 9197 |
| 97 | Ga0207655_1010720 | 3300025728 | Bacteria | 5535 |
| 98 | Ga0207713_1000347 | 3300025735 | Bacteria | 50780 |
| 99 | Ga0207680_10119645 | 3300025903 | Bacteria | 1720 |
| 100 | Ga0207695_10407274 | 3300025913 | Bacteria | 1244 |
| 101 | Ga0207662_10077365 | 3300025918 | Bacteria | 2024 |
| 102 | Ga0207650_10068468 | 3300025925 | Bacteria | 2666 |
| 103 | Ga0207687_10031363 | 3300025927 | Bacteria | 3591 |
| 104 | Ga0207687_10389183 | 3300025927 | Bacteria | 1144 |
| 105 | Ga0207644_10048878 | 3300025931 | Bacteria | 3026 |
| 106 | Ga0207706_10152455 | 3300025933 | Bacteria | 2033 |
| 107 | Ga0207670_10047276 | 3300025936 | Bacteria | 2865 |
| 108 | Ga0207711_10016753 | 3300025941 | Bacteria | 6086 |
| 109 | Ga0207711_10022536 | 3300025941 | Bacteria | 5268 |
| 110 | Ga0207711_10325862 | 3300025941 | Bacteria | 1420 |
| 111 | Ga0207689_10091292 | 3300025942 | Bacteria | 2502 |
| 112 | Ga0207689_10315123 | 3300025942 | Bacteria | 1298 |
| 113 | Ga0207679_10036314 | 3300025945 | Bacteria | 3494 |
| 114 | Ga0207658_10406568 | 3300025986 | Bacteria | 1197 |
| 115 | Ga0207677_10014171 | 3300026023 | Bacteria | 4646 |
| 116 | Ga0207702_10197671 | 3300026078 | Bacteria | 1862 |
| 117 | Ga0207641_10040861 | 3300026088 | Bacteria | 3885 |
| 118 | Ga0207641_10194498 | 3300026088 | Bacteria | 1866 |
| 119 | Ga0207676_10013079 | 3300026095 | Bacteria | 5957 |
| 120 | Ga0207676_10197427 | 3300026095 | Bacteria | 1775 |
| 121 | Ga0207683_10514513 | 3300026121 | Bacteria | 1106 |
| 122 | Ga0207698_10088476 | 3300026142 | Bacteria | 2526 |
| 123 | Ga0209281_1009657 | 3300027111 | Bacteria | 2251 |
| 124 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 125 | Ga0268266_10019760 | 3300028379 | Bacteria | 5741 |
| 126 | Ga0268265_10155587 | 3300028380 | Bacteria | 1934 |
| 127 | Ga0268264_10026643 | 3300028381 | Bacteria | 4724 |
| 128 | Ga0307515_10045652 | 3300028794 | Bacteria | 6723 |
| 129 | Ga0316181_1104601 | 3300030744 | Bacteria | 4219 |
| 130 | Ga0316182_1415013 | 3300030745 | Bacteria | 1101 |
| 131 | Ga0265332_10000030 | 3300031238 | Bacteria | 175141 |
| 132 | Ga0307509_10263208 | 3300031507 | Bacteria | 1498 |
| 133 | Ga0307408_100000046 | 3300031548 | Bacteria | 167686 |
| 134 | Ga0307408_100000232 | 3300031548 | Bacteria | 58517 |
| 135 | Ga0307408_100011172 | 3300031548 | Bacteria | 5931 |
| 136 | Ga0316579_10018376 | 3300031691 | Bacteria | 3077 |
| 137 | Ga0265314_10041423 | 3300031711 | Bacteria | 3297 |
| 138 | Ga0316576_10004964 | 3300031727 | Bacteria | 8058 |
| 139 | Ga0316576_10019945 | 3300031727 | Bacteria | 4601 |
| 140 | Ga0316576_10025890 | 3300031727 | Bacteria | 4110 |
| 141 | Ga0316578_10005533 | 3300031728 | Bacteria | 6138 |
| 142 | Ga0316578_10058454 | 3300031728 | Bacteria | 2267 |
| 143 | Ga0307405_10034126 | 3300031731 | Bacteria | 3025 |
| 144 | Ga0307518_10114481 | 3300031838 | Bacteria | 1917 |
| 145 | Ga0307409_100016301 | 3300031995 | Bacteria | 4912 |
| 146 | Ga0307416_100012248 | 3300032002 | Bacteria | 5766 |
| 147 | Ga0307416_101046005 | 3300032002 | Bacteria | 920 |
| 148 | Ga0307411_10005120 | 3300032005 | Bacteria | 6400 |
| 149 | Ga0307411_10025039 | 3300032005 | Bacteria | 3568 |
| 150 | Ga0316580_10018199 | 3300032139 | Bacteria | 2162 |
| 151 | Ga0373939_0123703 | 3300035114 | Bacteria | 915 |
| 152 | Ga0373960_0040717 | 3300035121 | Bacteria | 1342 |
| 153 | Ga0316574_0000055 | 3300035398 | Bacteria | 29301 |
| 154 | Ga0316574_0003649 | 3300035398 | Bacteria | 7967 |
| 155 | Ga0316574_0026414 | 3300035398 | Bacteria | 3491 |
| 156 | Ga0316574_0042090 | 3300035398 | Bacteria | 2817 |
| 157 | Ga0316574_0064741 | 3300035398 | Bacteria | 2301 |
| 158 | Ga0316574_0067518 | 3300035398 | Bacteria | 2254 |
| 159 | Ga0316574_0069807 | 3300035398 | Bacteria | 2218 |
| 160 | Ga0373931_0143585 | 3300035691 | Bacteria | 1385 |
| 161 | Ga0316582_0075867 | 3300036647 | Bacteria | 2185 |
| 162 | Ga0316582_0164775 | 3300036647 | Bacteria | 1503 |
| 163 | Ga0316584_0022384 | 3300036712 | Bacteria | 4609 |
| 164 | Ga0316584_0072962 | 3300036712 | Bacteria | 2572 |
| 165 | Ga0316584_0426597 | 3300036712 | Bacteria | 941 |
| 166 | Ga0395905_0001549 | 3300037471 | Bacteria | 27478 |
| 167 | Ga0400490_29153 | 3300038726 | Bacteria | 26709 |
| 168 | Ga0439453_0010252 | 3300041408 | Bacteria | 1542 |
| 169 | Ga0451800_1070302 | 3300041459 | Bacteria | 1102 |
| 170 | Ga0451853_0584218 | 3300041512 | Bacteria | 853 |
| 171 | Ga0439437_003746 | 3300042000 | Bacteria | 1643 |
| 172 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 173 | Ga0450913_001531 | 3300042117 | Bacteria | 1290 |
| 174 | Ga0450888_000330 | 3300042126 | Bacteria | 4474 |
| 175 | Ga0450890_001017 | 3300042127 | Bacteria | 4070 |
| 176 | Ga0450891_000290 | 3300042129 | Bacteria | 5139 |
| 177 | Ga0450892_002966 | 3300042130 | Bacteria | 1410 |
| 178 | Ga0450903_008716 | 3300042138 | Bacteria | 1658 |
| 179 | Ga0450889_000647 | 3300042144 | Bacteria | 3844 |
| 180 | Ga0439446_0010002 | 3300042156 | Bacteria | 2548 |
| 181 | Ga0439464_0012210 | 3300042439 | Bacteria | 2284 |
| 182 | Ga0450916_001625 | 3300042530 | Bacteria | 2264 |
| 183 | Ga0466969_0077630 | 3300044656 | Bacteria | 1589 |
| 184 | Ga0453683_0007447 | 3300044673 | Bacteria | 7424 |
| 185 | Ga0466957_0013506 | 3300044842 | Bacteria | 4738 |
| 186 | Ga0451576_0075742 | 3300045051 | Bacteria | 3501 |
| 187 | Ga0451576_0098633 | 3300045051 | Bacteria | 3039 |
| 188 | Ga0451576_0232729 | 3300045051 | Bacteria | 1924 |
| 189 | Ga0451576_0775869 | 3300045051 | Bacteria | 1007 |
| 190 | Ga0495617_000048 | 3300046452 | Bacteria | 113357 |
| 191 | Ga0495617_003612 | 3300046452 | Bacteria | 5776 |
| 192 | Ga0495617_015555 | 3300046452 | Bacteria | 2576 |
| 193 | Ga0495617_036558 | 3300046452 | Bacteria | 1646 |
| 194 | Ga0495617_069278 | 3300046452 | Bacteria | 1160 |
| 195 | Ga0495627_000046 | 3300046453 | Bacteria | 176186 |
| 196 | Ga0495592_0041458 | 3300046454 | Bacteria | 3450 |
| 197 | Ga0495603_0024142 | 3300046455 | Bacteria | 3676 |
| 198 | Ga0495590_0000030 | 3300046457 | Bacteria | 146237 |
| 199 | Ga0495590_0007818 | 3300046457 | Bacteria | 4103 |
| 200 | Ga0495590_0021775 | 3300046457 | Bacteria | 2270 |
| 201 | Ga0495591_000006 | 3300046458 | Bacteria | 390570 |
| 202 | Ga0495591_000708 | 3300046458 | Bacteria | 24252 |
| 203 | Ga0495591_004286 | 3300046458 | Bacteria | 7047 |
| 204 | Ga0495629_0013743 | 3300046459 | Bacteria | 5841 |
| 205 | Ga0495629_0020594 | 3300046459 | Bacteria | 4710 |
| 206 | Ga0495629_0032249 | 3300046459 | Bacteria | 3709 |
| 207 | Ga0495638_0000105 | 3300046460 | Bacteria | 134384 |
| 208 | Ga0495638_0005690 | 3300046460 | Bacteria | 9181 |
| 209 | Ga0495638_0008635 | 3300046460 | Bacteria | 7206 |
| 210 | Ga0495638_0056593 | 3300046460 | Bacteria | 2433 |
| 211 | Ga0495638_0120078 | 3300046460 | Bacteria | 1554 |
| 212 | Ga0495641_0076187 | 3300046461 | Bacteria | 1504 |
| 213 | Ga0495651_0002299 | 3300046462 | Bacteria | 14742 |
| 214 | Ga0495651_0031041 | 3300046462 | Bacteria | 4168 |
| 215 | Ga0495653_0000018 | 3300046463 | Bacteria | 185787 |
| 216 | Ga0495653_0029195 | 3300046463 | Bacteria | 4406 |
| 217 | Ga0495653_0182344 | 3300046463 | Bacteria | 1439 |
| 218 | Ga0495653_0304947 | 3300046463 | Bacteria | 1037 |
| 219 | Ga0495650_0000099 | 3300046471 | Bacteria | 215347 |
| 220 | Ga0495650_0000212 | 3300046471 | Bacteria | 124622 |
| 221 | Ga0495650_0000227 | 3300046471 | Bacteria | 114662 |
| 222 | Ga0495650_0002015 | 3300046471 | Bacteria | 17807 |
| 223 | Ga0495650_0002885 | 3300046471 | Bacteria | 13083 |
| 224 | Ga0495650_0003344 | 3300046471 | Bacteria | 11803 |
| 225 | Ga0495650_0007225 | 3300046471 | Bacteria | 6728 |
| 226 | Ga0495650_0007378 | 3300046471 | Bacteria | 6616 |
| 227 | Ga0495580_0002864 | 3300046472 | Bacteria | 14851 |
| 228 | Ga0495580_0004033 | 3300046472 | Bacteria | 12390 |
| 229 | Ga0495580_0012883 | 3300046472 | Bacteria | 6407 |
| 230 | Ga0495580_0048073 | 3300046472 | Bacteria | 3023 |
| 231 | Ga0495582_0009034 | 3300046473 | Bacteria | 5500 |
| 232 | Ga0495582_0041510 | 3300046473 | Bacteria | 2535 |
| 233 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 234 | Ga0495605_0000105 | 3300046474 | Bacteria | 105544 |
| 235 | Ga0495605_0004455 | 3300046474 | Bacteria | 8218 |
| 236 | Ga0495605_0005132 | 3300046474 | Bacteria | 7632 |
| 237 | Ga0495605_0093870 | 3300046474 | Bacteria | 1387 |
| 238 | Ga0495639_0138339 | 3300046475 | Bacteria | 1169 |
| 239 | Ga0495662_0006294 | 3300046476 | Bacteria | 5935 |
| 240 | Ga0495662_0026476 | 3300046476 | Bacteria | 2800 |
| 241 | Ga0495664_0005206 | 3300046477 | Bacteria | 7136 |
| 242 | Ga0495584_0001843 | 3300046491 | Bacteria | 12301 |
| 243 | Ga0495584_0009209 | 3300046491 | Bacteria | 5091 |
| 244 | Ga0495584_0186006 | 3300046491 | Bacteria | 1055 |
| 245 | Ga0495585_0001802 | 3300046492 | Bacteria | 16285 |
| 246 | Ga0495585_0053310 | 3300046492 | Bacteria | 2238 |
| 247 | Ga0495594_0074435 | 3300046499 | Bacteria | 1892 |
| 248 | Ga0495596_0014593 | 3300046500 | Bacteria | 3309 |
| 249 | Ga0495596_0128004 | 3300046500 | Bacteria | 986 |
| 250 | Ga0495607_0005215 | 3300046501 | Bacteria | 9349 |
| 251 | Ga0495607_0008312 | 3300046501 | Bacteria | 7097 |
| 252 | Ga0495607_0026284 | 3300046501 | Bacteria | 3612 |
| 253 | Ga0495607_0068293 | 3300046501 | Bacteria | 1994 |
| 254 | Ga0495607_0071780 | 3300046501 | Bacteria | 1929 |
| 255 | Ga0495607_0093522 | 3300046501 | Bacteria | 1623 |
| 256 | Ga0495607_0162697 | 3300046501 | Bacteria | 1132 |
| 257 | Ga0495583_0000004 | 3300046506 | Bacteria | 655287 |
| 258 | Ga0495583_0000192 | 3300046506 | Bacteria | 102223 |
| 259 | Ga0495583_0000645 | 3300046506 | Bacteria | 46022 |
| 260 | Ga0495583_0001634 | 3300046506 | Bacteria | 21855 |
| 261 | Ga0495583_0002676 | 3300046506 | Bacteria | 14828 |
| 262 | Ga0495583_0008863 | 3300046506 | Bacteria | 6083 |
| 263 | Ga0495583_0020469 | 3300046506 | Bacteria | 3427 |
| 264 | Ga0495606_0000158 | 3300046507 | Bacteria | 118616 |
| 265 | Ga0495606_0000547 | 3300046507 | Bacteria | 60321 |
| 266 | Ga0495606_0001026 | 3300046507 | Bacteria | 40508 |
| 267 | Ga0495606_0007446 | 3300046507 | Bacteria | 9794 |
| 268 | Ga0495606_0008840 | 3300046507 | Bacteria | 8633 |
| 269 | Ga0495606_0009625 | 3300046507 | Bacteria | 8142 |
| 270 | Ga0495606_0026012 | 3300046507 | Bacteria | 4176 |
| 271 | Ga0495606_0042581 | 3300046507 | Bacteria | 3035 |
| 272 | Ga0495606_0056855 | 3300046507 | Bacteria | 2522 |
| 273 | Ga0495608_0008757 | 3300046511 | Bacteria | 7078 |
| 274 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 275 | Ga0495610_0005098 | 3300046512 | Bacteria | 9461 |
| 276 | Ga0495610_0006265 | 3300046512 | Bacteria | 8241 |
| 277 | Ga0495610_0012580 | 3300046512 | Bacteria | 5082 |
| 278 | Ga0495610_0052448 | 3300046512 | Bacteria | 1980 |
| 279 | Ga0495616_0023828 | 3300046513 | Bacteria | 3289 |
| 280 | Ga0495616_0029386 | 3300046513 | Bacteria | 2902 |
| 281 | Ga0495618_0007359 | 3300046514 | Bacteria | 6661 |
| 282 | Ga0495618_0011445 | 3300046514 | Bacteria | 5381 |
| 283 | Ga0495618_0031012 | 3300046514 | Bacteria | 3342 |
| 284 | Ga0495620_0000377 | 3300046515 | Bacteria | 30539 |
| 285 | Ga0495620_0007751 | 3300046515 | Bacteria | 5799 |
| 286 | Ga0495628_0033520 | 3300046516 | Bacteria | 4138 |
| 287 | Ga0495628_0084762 | 3300046516 | Bacteria | 2458 |
| 288 | Ga0495630_0011098 | 3300046517 | Bacteria | 6517 |
| 289 | Ga0495630_0021605 | 3300046517 | Bacteria | 4752 |
| 290 | Ga0495630_0060130 | 3300046517 | Bacteria | 2851 |
| 291 | Ga0495632_0000255 | 3300046519 | Bacteria | 52928 |
| 292 | Ga0495637_0000057 | 3300046520 | Bacteria | 97433 |
| 293 | Ga0495637_0006210 | 3300046520 | Bacteria | 6011 |
| 294 | Ga0495637_0007847 | 3300046520 | Bacteria | 5266 |
| 295 | Ga0495643_0000181 | 3300046522 | Bacteria | 100368 |
| 296 | Ga0495643_0005852 | 3300046522 | Bacteria | 8224 |
| 297 | Ga0495644_0029527 | 3300046523 | Bacteria | 2071 |
| 298 | Ga0495644_0033556 | 3300046523 | Bacteria | 1938 |
| 299 | Ga0495648_0000008 | 3300046524 | Bacteria | 336584 |
| 300 | Ga0495648_0003617 | 3300046524 | Bacteria | 13534 |
| 301 | Ga0495648_0003845 | 3300046524 | Bacteria | 13030 |
| 302 | Ga0495648_0003924 | 3300046524 | Bacteria | 12873 |
| 303 | Ga0495648_0010048 | 3300046524 | Bacteria | 7253 |
| 304 | Ga0495648_0034770 | 3300046524 | Bacteria | 3275 |
| 305 | Ga0495666_0003786 | 3300046526 | Bacteria | 7646 |
| 306 | Ga0495666_0021013 | 3300046526 | Bacteria | 3232 |
| 307 | Ga0495642_0004701 | 3300046528 | Bacteria | 5289 |
| 308 | Ga0495642_0016872 | 3300046528 | Bacteria | 2849 |
| 309 | Ga0495642_0025379 | 3300046528 | Bacteria | 2349 |
| 310 | Ga0495642_0030572 | 3300046528 | Bacteria | 2155 |
| 311 | Ga0495642_0034886 | 3300046528 | Bacteria | 2028 |
| 312 | Ga0495642_0042628 | 3300046528 | Bacteria | 1849 |
| 313 | Ga0495652_0123897 | 3300046529 | Bacteria | 2056 |
| 314 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 315 | Ga0495654_0000013 | 3300046530 | Bacteria | 327576 |
| 316 | Ga0495654_0010971 | 3300046530 | Bacteria | 4921 |
| 317 | Ga0495654_0012289 | 3300046530 | Bacteria | 4602 |
| 318 | Ga0495665_0035142 | 3300046531 | Bacteria | 2678 |
| 319 | Ga0495665_0161269 | 3300046531 | Bacteria | 1168 |
| 320 | Ga0495640_0002432 | 3300046533 | Bacteria | 14945 |
| 321 | Ga0495640_0031853 | 3300046533 | Bacteria | 3761 |
| 322 | Ga0495640_0311473 | 3300046533 | Bacteria | 976 |
| 323 | Ga0495587_0001857 | 3300046536 | Bacteria | 14058 |
| 324 | Ga0495609_0000049 | 3300046538 | Bacteria | 155608 |
| 325 | Ga0495609_0002290 | 3300046538 | Bacteria | 11922 |
| 326 | Ga0495609_0008339 | 3300046538 | Bacteria | 5077 |
| 327 | Ga0495609_0009996 | 3300046538 | Bacteria | 4569 |
| 328 | Ga0495609_0018425 | 3300046538 | Bacteria | 3235 |
| 329 | Ga0495609_0028433 | 3300046538 | Bacteria | 2551 |
| 330 | Ga0495609_0028803 | 3300046538 | Bacteria | 2532 |
| 331 | Ga0495609_0100652 | 3300046538 | Bacteria | 1252 |
| 332 | Ga0495597_0003757 | 3300046542 | Bacteria | 8652 |
| 333 | Ga0495597_0005506 | 3300046542 | Bacteria | 6698 |
| 334 | Ga0495645_0002449 | 3300046543 | Bacteria | 12598 |
| 335 | Ga0495622_0000302 | 3300046557 | Bacteria | 37049 |
| 336 | Ga0495622_0000415 | 3300046557 | Bacteria | 28325 |
| 337 | Ga0495622_0000534 | 3300046557 | Bacteria | 22878 |
| 338 | Ga0495622_0089410 | 3300046557 | Bacteria | 1415 |
| 339 | Ga0495633_0000238 | 3300046558 | Bacteria | 66595 |
| 340 | Ga0495633_0000409 | 3300046558 | Bacteria | 44723 |
| 341 | Ga0495633_0005568 | 3300046558 | Bacteria | 7649 |
| 342 | Ga0495633_0039399 | 3300046558 | Bacteria | 2255 |
| 343 | Ga0495633_0045752 | 3300046558 | Bacteria | 2071 |
| 344 | Ga0495633_0216760 | 3300046558 | Bacteria | 876 |
| 345 | Ga0495668_0000482 | 3300046616 | Bacteria | 50037 |
| 346 | Ga0495668_0001995 | 3300046616 | Bacteria | 17851 |
| 347 | Ga0495668_0005088 | 3300046616 | Bacteria | 9045 |
| 348 | Ga0495668_0036226 | 3300046616 | Bacteria | 2764 |
| 349 | Ga0495668_0255778 | 3300046616 | Bacteria | 959 |
| 350 | Ga0495634_0010873 | 3300046642 | Bacteria | 6648 |
| 351 | Ga0495611_0012025 | 3300046648 | Bacteria | 3678 |
| 352 | Ga0495611_0012970 | 3300046648 | Bacteria | 3543 |
| 353 | Ga0495611_0071758 | 3300046648 | Bacteria | 1583 |
| 354 | Ga0495625_0001573 | 3300046660 | Bacteria | 27145 |
| 355 | Ga0495625_0009520 | 3300046660 | Bacteria | 8118 |
| 356 | Ga0495625_0012167 | 3300046660 | Bacteria | 6981 |
| 357 | Ga0495625_0013755 | 3300046660 | Bacteria | 6488 |
| 358 | Ga0495625_0020795 | 3300046660 | Bacteria | 5060 |
| 359 | Ga0495625_0041123 | 3300046660 | Bacteria | 3366 |
| 360 | Ga0495625_0182980 | 3300046660 | Bacteria | 1392 |
| 361 | Ga0495625_0201803 | 3300046660 | Bacteria | 1312 |
| 362 | Ga0495635_0039437 | 3300046663 | Bacteria | 3267 |
| 363 | Ga0495659_0000128 | 3300046664 | Bacteria | 33389 |
| 364 | Ga0495659_0010448 | 3300046664 | Bacteria | 2978 |
| 365 | Ga0495659_0036069 | 3300046664 | Bacteria | 1745 |
| 366 | Ga0495661_0000312 | 3300046665 | Bacteria | 54893 |
| 367 | Ga0495661_0005648 | 3300046665 | Bacteria | 8868 |
| 368 | Ga0495661_0007287 | 3300046665 | Bacteria | 7712 |
| 369 | Ga0495661_0038454 | 3300046665 | Bacteria | 2980 |
| 370 | Ga0495661_0188865 | 3300046665 | Bacteria | 1086 |
| 371 | Ga0495657_0068564 | 3300046675 | Bacteria | 2324 |
| 372 | Ga0495599_0013702 | 3300046678 | Bacteria | 5012 |
| 373 | Ga0495599_0043749 | 3300046678 | Bacteria | 2810 |
| 374 | Ga0495599_0149419 | 3300046678 | Bacteria | 1447 |
| 375 | Ga0495623_0001488 | 3300046679 | Bacteria | 15880 |
| 376 | Ga0495623_0001635 | 3300046679 | Bacteria | 15057 |
| 377 | Ga0495623_0022723 | 3300046679 | Bacteria | 4049 |
| 378 | Ga0495646_0013273 | 3300046680 | Bacteria | 5235 |
| 379 | Ga0495669_0001427 | 3300046684 | Bacteria | 9844 |
| 380 | Ga0495669_0023483 | 3300046684 | Bacteria | 2685 |
| 381 | Ga0495669_0247380 | 3300046684 | Bacteria | 856 |
| 382 | Ga0495613_0068202 | 3300046689 | Bacteria | 2594 |
| 383 | Ga0495613_0102670 | 3300046689 | Bacteria | 2064 |
| 384 | Ga0495624_0000787 | 3300046690 | Bacteria | 24989 |
| 385 | Ga0495624_0035968 | 3300046690 | Bacteria | 3194 |
| 386 | Ga0495624_0050233 | 3300046690 | Bacteria | 2642 |
| 387 | Ga0495670_0008487 | 3300046691 | Bacteria | 5054 |
| 388 | Ga0495670_0011747 | 3300046691 | Bacteria | 4310 |
| 389 | Ga0495670_0036263 | 3300046691 | Bacteria | 2457 |
| 390 | Ga0495670_0059608 | 3300046691 | Bacteria | 1916 |
| 391 | Ga0495671_0000234 | 3300046692 | Bacteria | 47760 |
| 392 | Ga0495671_0000343 | 3300046692 | Bacteria | 38705 |
| 393 | Ga0495671_0023179 | 3300046692 | Bacteria | 3245 |
| 394 | Ga0495649_0003953 | 3300046694 | Bacteria | 9792 |
| 395 | Ga0495649_0005578 | 3300046694 | Bacteria | 7964 |
| 396 | Ga0495649_0111944 | 3300046694 | Bacteria | 1447 |
| 397 | Ga0495589_0015413 | 3300046794 | Bacteria | 3934 |
| 398 | Ga0495589_0030821 | 3300046794 | Bacteria | 2701 |
| 399 | Ga0495589_0047783 | 3300046794 | Bacteria | 2120 |
| 400 | Ga0495660_0001130 | 3300046810 | Bacteria | 19023 |
| 401 | Ga0495660_0002657 | 3300046810 | Bacteria | 11324 |
| 402 | Ga0495660_0003276 | 3300046810 | Bacteria | 10049 |
| 403 | Ga0495660_0012352 | 3300046810 | Bacteria | 4956 |
| 404 | Ga0495660_0016129 | 3300046810 | Bacteria | 4309 |
| 405 | Ga0495660_0024315 | 3300046810 | Bacteria | 3451 |
| 406 | Ga0495660_0038578 | 3300046810 | Bacteria | 2655 |
| 407 | Ga0495581_0019631 | 3300047315 | Bacteria | 3923 |
| 408 | Ga0495581_0020585 | 3300047315 | Bacteria | 3827 |
| 409 | Ga0495604_0003221 | 3300047317 | Bacteria | 13043 |
| 410 | Ga0495604_0071240 | 3300047317 | Bacteria | 2630 |
| 411 | Ga0495604_0232902 | 3300047317 | Bacteria | 1262 |
| 412 | Ga0495636_0002363 | 3300047318 | Bacteria | 7242 |
| 413 | Ga0495636_0005534 | 3300047318 | Bacteria | 4959 |
| 414 | Ga0495636_0132319 | 3300047318 | Bacteria | 1110 |
| 415 | Ga0495674_0038277 | 3300047319 | Bacteria | 4306 |
| 416 | Ga0495674_0119294 | 3300047319 | Bacteria | 2229 |
| 417 | Ga0495674_0140481 | 3300047319 | Bacteria | 2030 |
| 418 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 419 | Ga0495672_0000035 | 3300047320 | Bacteria | 290329 |
| 420 | Ga0495672_0000410 | 3300047320 | Bacteria | 51954 |
| 421 | Ga0495672_0040219 | 3300047320 | Bacteria | 2837 |
| 422 | Ga0495672_0071295 | 3300047320 | Bacteria | 1966 |
| 423 | Ga0495672_0089624 | 3300047320 | Bacteria | 1692 |
| 424 | Ga0495676_0047420 | 3300047321 | Bacteria | 3474 |
| 425 | Ga0495676_0057759 | 3300047321 | Bacteria | 3057 |
| 426 | Ga0495676_0069664 | 3300047321 | Bacteria | 2713 |
| 427 | Ga0495680_0023350 | 3300047322 | Bacteria | 5144 |
| 428 | Ga0495680_0031357 | 3300047322 | Bacteria | 4328 |
| 429 | Ga0495680_0237906 | 3300047322 | Bacteria | 1294 |
| 430 | Ga0495683_0004583 | 3300047323 | Bacteria | 7805 |
| 431 | Ga0495683_0009105 | 3300047323 | Bacteria | 5289 |
| 432 | Ga0495683_0015974 | 3300047323 | Bacteria | 3899 |
| 433 | Ga0495683_0017943 | 3300047323 | Bacteria | 3663 |
| 434 | Ga0495687_000487 | 3300047443 | Bacteria | 48069 |
| 435 | Ga0495687_002805 | 3300047443 | Bacteria | 13446 |
| 436 | Ga0495687_003597 | 3300047443 | Bacteria | 11100 |
| 437 | Ga0495687_065092 | 3300047443 | Bacteria | 1485 |
| 438 | Ga0495675_0020309 | 3300047444 | Bacteria | 4224 |
| 439 | Ga0495675_0021583 | 3300047444 | Bacteria | 4101 |
| 440 | Ga0495675_0041955 | 3300047444 | Bacteria | 2915 |
| 441 | Ga0495677_0002848 | 3300047445 | Bacteria | 6736 |
| 442 | Ga0495677_0023871 | 3300047445 | Bacteria | 2219 |
| 443 | Ga0495679_000050 | 3300047446 | Bacteria | 125325 |
| 444 | Ga0495679_000683 | 3300047446 | Bacteria | 22224 |
| 445 | Ga0495685_000132 | 3300047447 | Bacteria | 25959 |
| 446 | Ga0495685_061798 | 3300047447 | Bacteria | 1261 |
| 447 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 448 | Ga0495673_0000034 | 3300047469 | Bacteria | 326920 |
| 449 | Ga0495673_0000150 | 3300047469 | Bacteria | 122768 |
| 450 | Ga0495673_0000211 | 3300047469 | Bacteria | 87639 |
| 451 | Ga0495673_0003072 | 3300047469 | Bacteria | 11227 |
| 452 | Ga0495673_0006037 | 3300047469 | Bacteria | 7193 |
| 453 | Ga0495673_0011436 | 3300047469 | Bacteria | 4771 |
| 454 | Ga0495673_0043807 | 3300047469 | Bacteria | 2000 |
| 455 | Ga0495681_0003316 | 3300047470 | Bacteria | 11216 |
| 456 | Ga0495681_0015166 | 3300047470 | Bacteria | 4371 |
| 457 | Ga0495684_0025416 | 3300047471 | Bacteria | 4551 |
| 458 | Ga0495686_0001783 | 3300047472 | Bacteria | 21899 |
| 459 | Ga0495686_0012032 | 3300047472 | Bacteria | 6080 |
| 460 | Ga0495686_0032551 | 3300047472 | Bacteria | 3374 |
| 461 | Ga0495686_0046000 | 3300047472 | Bacteria | 2760 |
| 462 | Ga0495686_0049029 | 3300047472 | Bacteria | 2659 |
| 463 | Ga0495686_0103663 | 3300047472 | Bacteria | 1713 |
| 464 | Ga0495686_0118940 | 3300047472 | Bacteria | 1577 |
| 465 | Ga0495593_0002313 | 3300047673 | Bacteria | 11438 |
| 466 | Ga0495593_0016566 | 3300047673 | Bacteria | 4156 |
| 467 | Ga0495602_0014931 | 3300048088 | Bacteria | 7859 |
| 468 | Ga0495602_0018887 | 3300048088 | Bacteria | 6864 |
| 469 | Ga0495602_0022575 | 3300048088 | Bacteria | 6155 |
| 470 | Ga0495602_0028092 | 3300048088 | Bacteria | 5391 |
| 471 | Ga0495602_0380303 | 3300048088 | Bacteria | 1011 |
| 472 | Ga0495614_0014052 | 3300048089 | Bacteria | 3511 |
| 473 | Ga0496101_0000006 | 3300048904 | Bacteria | 329135 |
| 474 | Ga0496102_0012321 | 3300048905 | Bacteria | 7396 |
| 475 | Ga0496103_0019423 | 3300048906 | Bacteria | 4081 |
| 476 | Ga0496103_0024129 | 3300048906 | Bacteria | 3668 |
| 477 | Ga0496106_0000069 | 3300048909 | Bacteria | 82859 |
| 478 | Ga0496106_0175508 | 3300048909 | Bacteria | 1700 |
| 479 | Ga0496108_0034716 | 3300048911 | Bacteria | 4190 |
| 480 | Ga0496109_0140235 | 3300048912 | Bacteria | 2260 |
| 481 | Ga0496111_0226201 | 3300048914 | Bacteria | 1390 |
| 482 | Ga0496112_0084227 | 3300048915 | Bacteria | 3144 |
| 483 | Ga0496113_0018906 | 3300048916 | Bacteria | 4810 |
| 484 | Ga0496114_0035890 | 3300048917 | Bacteria | 4096 |
| 485 | Ga0496114_0270908 | 3300048917 | Bacteria | 1496 |
| 486 | Ga0496116_0088362 | 3300048919 | Bacteria | 1894 |
| 487 | Ga0496117_0019985 | 3300048920 | Bacteria | 5478 |
| 488 | Ga0496117_0056939 | 3300048920 | Bacteria | 2718 |
| 489 | Ga0496118_0009040 | 3300048921 | Bacteria | 10155 |
| 490 | Ga0496118_0011515 | 3300048921 | Bacteria | 8622 |
| 491 | Ga0496118_0016628 | 3300048921 | Bacteria | 6740 |
| 492 | Ga0496118_0041057 | 3300048921 | Bacteria | 3669 |
| 493 | Ga0496120_0000069 | 3300048923 | Bacteria | 165694 |
| 494 | Ga0496120_0022028 | 3300048923 | Bacteria | 4013 |
| 495 | Ga0496121_0000102 | 3300048924 | Bacteria | 195341 |
| 496 | Ga0496121_0001759 | 3300048924 | Bacteria | 35296 |
| 497 | Ga0496121_0027503 | 3300048924 | Bacteria | 5321 |
| 498 | Ga0496121_0030602 | 3300048924 | Bacteria | 4940 |
| 499 | Ga0496122_0001533 | 3300048925 | Bacteria | 36772 |
| 500 | Ga0496122_0010192 | 3300048925 | Bacteria | 9738 |
| 501 | Ga0496122_0034998 | 3300048925 | Bacteria | 4098 |
| 502 | Ga0496122_0079452 | 3300048925 | Bacteria | 2292 |
| 503 | Ga0496123_0000513 | 3300048926 | Bacteria | 67386 |
| 504 | Ga0496123_0006224 | 3300048926 | Bacteria | 11643 |
| 505 | Ga0496123_0010357 | 3300048926 | Bacteria | 8253 |
| 506 | Ga0496124_0000229 | 3300048927 | Bacteria | 109277 |
| 507 | Ga0496124_0008815 | 3300048927 | Bacteria | 10477 |
| 508 | Ga0496124_0011429 | 3300048927 | Bacteria | 8877 |
| 509 | Ga0496124_0067457 | 3300048927 | Bacteria | 2977 |
| 510 | Ga0496124_0110106 | 3300048927 | Bacteria | 2218 |
| 511 | Ga0496124_0269004 | 3300048927 | Bacteria | 1249 |
| 512 | Ga0496125_0301484 | 3300048928 | Bacteria | 981 |
| 513 | Ga0496126_0001236 | 3300048929 | Bacteria | 41467 |
| 514 | Ga0496126_0001826 | 3300048929 | Bacteria | 31097 |
| 515 | Ga0496126_0009279 | 3300048929 | Bacteria | 10481 |
| 516 | Ga0496126_0043883 | 3300048929 | Bacteria | 4121 |
| 517 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 518 | Ga0495678_000076 | 3300049459 | Bacteria | 125077 |
| 519 | Ga0495678_001414 | 3300049459 | Bacteria | 19020 |
| 520 | Ga0495678_061214 | 3300049459 | Bacteria | 1413 |
| 521 | Ga0495678_063019 | 3300049459 | Bacteria | 1386 |
| 522 | Ga0495682_0000763 | 3300049460 | Bacteria | 20680 |
| 523 | Ga0495682_0004796 | 3300049460 | Bacteria | 5709 |
| 524 | Ga0495682_0006175 | 3300049460 | Bacteria | 4875 |
| 525 | Ga0495682_0018388 | 3300049460 | Bacteria | 2632 |
| 526 | Ga0501230_005664 | 3300049667 | Bacteria | 1779 |
| 527 | Ga0501249_004484 | 3300049679 | Bacteria | 2835 |
| 528 | Ga0501255_000368 | 3300049684 | Bacteria | 2959 |
| 529 | Ga0501269_000137 | 3300049766 | Bacteria | 23021 |
| 530 | nmdc:mga03683_10149_c1 | 3300050489 | Bacteria | 3371 |
| 531 | nmdc:mga00v17_68457_c1 | 3300050491 | Bacteria | 1163 |
| 532 | nmdc:mga0k408_132288_c1 | 3300050493 | Bacteria | 1481 |
| 533 | nmdc:mga0k408_44999_c1 | 3300050493 | Bacteria | 2546 |
| 534 | nmdc:mga07m45_213_c2 | 3300050496 | Bacteria | 10108 |
| 535 | nmdc:mga0qj67_208827_c1 | 3300050509 | Bacteria | 1586 |
| 536 | Ga0495655_0018550 | 3300053083 | Bacteria | 1531 |
| 537 | Ga0500583_0013083 | 3300053092 | Bacteria | 3194 |
| 538 | Ga0500651_0041030 | 3300053093 | Bacteria | 2917 |
| 539 | Ga0500617_039511 | 3300053124 | Bacteria | 2112 |
| 540 | Ga0500618_002777 | 3300053125 | Bacteria | 6359 |
| 541 | Ga0500658_0012633 | 3300053134 | Bacteria | 3117 |
| 542 | Ga0500568_0043187 | 3300053139 | Bacteria | 1803 |
| 543 | Ga0500586_000469 | 3300053145 | Bacteria | 8068 |
| 544 | Ga0500586_002702 | 3300053145 | Bacteria | 4062 |
| 545 | Ga0500588_0017608 | 3300053146 | Bacteria | 1868 |
| 546 | Ga0500616_0000032 | 3300053153 | Bacteria | 403673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046684 | Ga0495669_0247380 | Ga0495669_0247380_15_677 | 207 |
| 2 | 3300041512 | Ga0451853_0584218 | Ga0451853_0584218_23_682 | 212 |
| 3 | 3300031691 | Ga0316579_10018376 | Ga0316579_100183763 | 241 |
| 4 | 3300031728 | Ga0316578_10005533 | Ga0316578_100055332 | 241 |
| 5 | 3300032139 | Ga0316580_10018199 | Ga0316580_100181992 | 241 |
| 6 | 3300005614 | Ga0068856_100555734 | Ga0068856_1005557342 | 247 |
| 7 | 3300006846 | Ga0075430_100102222 | Ga0075430_1001022222 | 247 |
| 8 | 3300006880 | Ga0075429_100314454 | Ga0075429_1003144541 | 247 |
| 9 | 3300005614 | Ga0068856_100053824 | Ga0068856_1000538242 | 249 |
| 10 | 3300025942 | Ga0207689_10315123 | Ga0207689_103151231 | 249 |
| 11 | 3300046660 | Ga0495625_0182980 | Ga0495625_0182980_620_1381 | 249 |
| 12 | 3300049679 | Ga0501249_004484 | Ga0501249_004484_918_1682 | 250 |
| 13 | 3300046558 | Ga0495633_0039399 | Ga0495633_0039399_14_811 | 251 |
| 14 | 3300046660 | Ga0495625_0201803 | Ga0495625_0201803_493_1287 | 251 |
| 15 | 3300010375 | Ga0105239_10938288 | Ga0105239_109382881 | 252 |
| 16 | 3300035398 | Ga0316574_0003649 | Ga0316574_0003649_2426_3190 | 253 |
| 17 | 3300037471 | Ga0395905_0001549 | Ga0395905_0001549_24265_25086 | 253 |
| 18 | 3300005329 | Ga0070683_100074197 | Ga0070683_1000741973 | 254 |
| 19 | 3300005330 | Ga0070690_100006654 | Ga0070690_1000066545 | 254 |
| 20 | 3300005331 | Ga0070670_100003676 | Ga0070670_10000367612 | 254 |
| 21 | 3300005335 | Ga0070666_10023306 | Ga0070666_100233062 | 254 |
| 22 | 3300005338 | Ga0068868_100006907 | Ga0068868_1000069077 | 254 |
| 23 | 3300005343 | Ga0070687_100208037 | Ga0070687_1002080371 | 254 |
| 24 | 3300005355 | Ga0070671_100043419 | Ga0070671_1000434194 | 254 |
| 25 | 3300005535 | Ga0070684_100082244 | Ga0070684_1000822442 | 254 |
| 26 | 3300005548 | Ga0070665_100024470 | Ga0070665_1000244706 | 254 |
| 27 | 3300005564 | Ga0070664_100019280 | Ga0070664_1000192804 | 254 |
| 28 | 3300005614 | Ga0068856_100267290 | Ga0068856_1002672902 | 254 |
| 29 | 3300005616 | Ga0068852_100251381 | Ga0068852_1002513812 | 254 |
| 30 | 3300005617 | Ga0068859_100021941 | Ga0068859_1000219412 | 254 |
| 31 | 3300005618 | Ga0068864_100002439 | Ga0068864_1000024399 | 254 |
| 32 | 3300005719 | Ga0068861_100214826 | Ga0068861_1002148262 | 254 |
| 33 | 3300005841 | Ga0068863_100027333 | Ga0068863_1000273335 | 254 |
| 34 | 3300005842 | Ga0068858_100013508 | Ga0068858_1000135084 | 254 |
| 35 | 3300006237 | Ga0097621_100192077 | Ga0097621_1001920772 | 254 |
| 36 | 3300006931 | Ga0097620_100021941 | Ga0097620_1000219412 | 254 |
| 37 | 3300009098 | Ga0105245_10009458 | Ga0105245_100094585 | 254 |
| 38 | 3300009177 | Ga0105248_10000927 | Ga0105248_1000092723 | 254 |
| 39 | 3300010375 | Ga0105239_10368322 | Ga0105239_103683221 | 254 |
| 40 | 3300011119 | Ga0105246_10004756 | Ga0105246_100047566 | 254 |
| 41 | 3300013296 | Ga0157374_10002219 | Ga0157374_1000221914 | 254 |
| 42 | 3300013297 | Ga0157378_10522155 | Ga0157378_105221551 | 254 |
| 43 | 3300013306 | Ga0163162_10005133 | Ga0163162_100051337 | 254 |
| 44 | 3300013308 | Ga0157375_10010140 | Ga0157375_100101404 | 254 |
| 45 | 3300014325 | Ga0163163_10021084 | Ga0163163_100210848 | 254 |
| 46 | 3300014968 | Ga0157379_10016987 | Ga0157379_100169877 | 254 |
| 47 | 3300025903 | Ga0207680_10119645 | Ga0207680_101196452 | 254 |
| 48 | 3300025918 | Ga0207662_10077365 | Ga0207662_100773652 | 254 |
| 49 | 3300025927 | Ga0207687_10031363 | Ga0207687_100313632 | 254 |
| 50 | 3300025931 | Ga0207644_10048878 | Ga0207644_100488783 | 254 |
| 51 | 3300025933 | Ga0207706_10152455 | Ga0207706_101524552 | 254 |
| 52 | 3300025936 | Ga0207670_10047276 | Ga0207670_100472762 | 254 |
| 53 | 3300025941 | Ga0207711_10016753 | Ga0207711_100167534 | 254 |
| 54 | 3300025945 | Ga0207679_10036314 | Ga0207679_100363144 | 254 |
| 55 | 3300025986 | Ga0207658_10406568 | Ga0207658_104065682 | 254 |
| 56 | 3300026023 | Ga0207677_10014171 | Ga0207677_100141712 | 254 |
| 57 | 3300026078 | Ga0207702_10197671 | Ga0207702_101976712 | 254 |
| 58 | 3300026088 | Ga0207641_10040861 | Ga0207641_100408612 | 254 |
| 59 | 3300026095 | Ga0207676_10013079 | Ga0207676_100130797 | 254 |
| 60 | 3300026121 | Ga0207683_10514513 | Ga0207683_105145132 | 254 |
| 61 | 3300026142 | Ga0207698_10088476 | Ga0207698_100884762 | 254 |
| 62 | 3300028379 | Ga0268266_10019760 | Ga0268266_100197602 | 254 |
| 63 | 3300028381 | Ga0268264_10026643 | Ga0268264_100266433 | 254 |
| 64 | 3300031727 | Ga0316576_10019945 | Ga0316576_100199453 | 254 |
| 65 | 3300035121 | Ga0373960_0040717 | Ga0373960_0040717_492_1259 | 254 |
| 66 | 3300035398 | Ga0316574_0042090 | Ga0316574_0042090_320_1087 | 254 |
| 67 | 3300035398 | Ga0316574_0064741 | Ga0316574_0064741_1277_2044 | 254 |
| 68 | 3300035398 | Ga0316574_0069807 | Ga0316574_0069807_935_1702 | 254 |
| 69 | 3300035691 | Ga0373931_0143585 | Ga0373931_0143585_441_1208 | 254 |
| 70 | 3300041459 | Ga0451800_1070302 | Ga0451800_1070302_30_797 | 254 |
| 71 | 3300045051 | Ga0451576_0232729 | Ga0451576_0232729_588_1355 | 254 |
| 72 | 3300048909 | Ga0496106_0175508 | Ga0496106_0175508_863_1630 | 254 |
| 73 | 3300048911 | Ga0496108_0034716 | Ga0496108_0034716_2076_2843 | 254 |
| 74 | 3300048912 | Ga0496109_0140235 | Ga0496109_0140235_77_844 | 254 |
| 75 | 3300048915 | Ga0496112_0084227 | Ga0496112_0084227_1085_1852 | 254 |
| 76 | 3300048916 | Ga0496113_0018906 | Ga0496113_0018906_249_1016 | 254 |
| 77 | 3300053153 | Ga0500616_0000032 | Ga0500616_0000032_285248_286015 | 254 |
| 78 | 3300005614 | Ga0068856_100155246 | Ga0068856_1001552462 | 255 |
| 79 | 3300005618 | Ga0068864_100126250 | Ga0068864_1001262502 | 255 |
| 80 | 3300005841 | Ga0068863_100233339 | Ga0068863_1002333392 | 255 |
| 81 | 3300006195 | Ga0075366_10221852 | Ga0075366_102218522 | 255 |
| 82 | 3300009177 | Ga0105248_10320002 | Ga0105248_103200022 | 255 |
| 83 | 3300025304 | Ga0209257_1006592 | Ga0209257_10065924 | 255 |
| 84 | 3300025913 | Ga0207695_10407274 | Ga0207695_104072741 | 255 |
| 85 | 3300025925 | Ga0207650_10068468 | Ga0207650_100684682 | 255 |
| 86 | 3300025941 | Ga0207711_10325862 | Ga0207711_103258622 | 255 |
| 87 | 3300026088 | Ga0207641_10194498 | Ga0207641_101944982 | 255 |
| 88 | 3300026095 | Ga0207676_10197427 | Ga0207676_101974272 | 255 |
| 89 | 3300044656 | Ga0466969_0077630 | Ga0466969_0077630_145_948 | 255 |
| 90 | 3300046528 | Ga0495642_0034886 | Ga0495642_0034886_671_1477 | 255 |
| 91 | 3300047318 | Ga0495636_0132319 | Ga0495636_0132319_76_882 | 255 |
| 92 | 3300050493 | nmdc:mga0k408_44999_c1 | nmdc:mga0k408_44999_c1_1158_1979 | 255 |
| 93 | 3300005937 | Ga0081455_10000999 | Ga0081455_100009999 | 256 |
| 94 | 3300031507 | Ga0307509_10263208 | Ga0307509_102632081 | 256 |
| 95 | 3300046506 | Ga0495583_0001634 | Ga0495583_0001634_14833_15606 | 256 |
| 96 | 3300046694 | Ga0495649_0111944 | Ga0495649_0111944_597_1370 | 256 |
| 97 | 3300053092 | Ga0500583_0013083 | Ga0500583_0013083_998_1783 | 256 |
| 98 | 3300053093 | Ga0500651_0041030 | Ga0500651_0041030_137_922 | 256 |
| 99 | 3300053124 | Ga0500617_039511 | Ga0500617_039511_457_1242 | 256 |
| 100 | 3300053134 | Ga0500658_0012633 | Ga0500658_0012633_139_924 | 256 |
| 101 | 3300053139 | Ga0500568_0043187 | Ga0500568_0043187_510_1295 | 256 |
| 102 | 3300053146 | Ga0500588_0017608 | Ga0500588_0017608_359_1144 | 256 |
| 103 | iso_pu_bacteria | 2510065045 | 2510250276 | 256 |
| 104 | iso_pu_bacteria | 2511231025 | 2511380677 | 256 |
| 105 | iso_pu_bacteria | 2511231035 | 2511433344 | 256 |
| 106 | iso_pu_bacteria | 2711768156 | 2712471899 | 256 |
| 107 | iso_pu_bacteria | 2718217991 | 2719639427 | 256 |
| 108 | iso_pu_bacteria | 2744054900 | 2746092009 | 256 |
| 109 | iso_pu_bacteria | 2744054901 | 2746099872 | 256 |
| 110 | iso_pu_bacteria | 2751185846 | 2753571297 | 256 |
| 111 | iso_pu_bacteria | 2842324504 | 2842330187 | 256 |
| 112 | iso_pu_bacteria | 2842348783 | 2842356770 | 256 |
| 113 | iso_pu_bacteria | 2876601092 | 2876604760 | 256 |
| 114 | iso_pu_bacteria | 2881101125 | 2881101902 | 256 |
| 115 | iso_pu_bacteria | 2900634093 | 2900635862 | 256 |
| 116 | iso_pu_bacteria | 642555113 | 642620614 | 256 |
| 117 | iso_pu_bacteria | 8016733728 | 8016738799 | 256 |
| 118 | iso_pu_bacteria | 8019499862 | 8019500445 | 256 |
| 119 | 3300002987 | JGI25159J45721_1016387 | JGI25159J45721_10163871 | 257 |
| 120 | 3300005262 | Ga0065165_1000067 | Ga0065165_100006713 | 257 |
| 121 | 3300005844 | Ga0068862_100471286 | Ga0068862_1004712862 | 257 |
| 122 | 3300025208 | Ga0209436_117706 | Ga0209436_1177062 | 257 |
| 123 | 3300025284 | Ga0209130_1001240 | Ga0209130_10012401 | 257 |
| 124 | 3300028380 | Ga0268265_10155587 | Ga0268265_101555873 | 257 |
| 125 | 3300031727 | Ga0316576_10025890 | Ga0316576_100258904 | 257 |
| 126 | 3300031728 | Ga0316578_10058454 | Ga0316578_100584543 | 257 |
| 127 | 3300031838 | Ga0307518_10114481 | Ga0307518_101144812 | 257 |
| 128 | 3300035398 | Ga0316574_0026414 | Ga0316574_0026414_2597_3421 | 257 |
| 129 | 3300035398 | Ga0316574_0067518 | Ga0316574_0067518_1280_2104 | 257 |
| 130 | 3300036647 | Ga0316582_0164775 | Ga0316582_0164775_637_1416 | 257 |
| 131 | 3300036712 | Ga0316584_0022384 | Ga0316584_0022384_2514_3341 | 257 |
| 132 | 3300036712 | Ga0316584_0072962 | Ga0316584_0072962_1176_1955 | 257 |
| 133 | 3300038726 | Ga0400490_29153 | Ga0400490_29153_2904_3680 | 257 |
| 134 | 3300046452 | Ga0495617_015555 | Ga0495617_015555_1545_2330 | 257 |
| 135 | 3300046452 | Ga0495617_069278 | Ga0495617_069278_153_938 | 257 |
| 136 | 3300046457 | Ga0495590_0021775 | Ga0495590_0021775_982_1767 | 257 |
| 137 | 3300046460 | Ga0495638_0008635 | Ga0495638_0008635_1212_1997 | 257 |
| 138 | 3300046474 | Ga0495605_0005132 | Ga0495605_0005132_1161_1946 | 257 |
| 139 | 3300046491 | Ga0495584_0001843 | Ga0495584_0001843_2710_3495 | 257 |
| 140 | 3300046491 | Ga0495584_0009209 | Ga0495584_0009209_393_1211 | 257 |
| 141 | 3300046491 | Ga0495584_0186006 | Ga0495584_0186006_174_959 | 257 |
| 142 | 3300046492 | Ga0495585_0053310 | Ga0495585_0053310_181_966 | 257 |
| 143 | 3300046501 | Ga0495607_0026284 | Ga0495607_0026284_1824_2642 | 257 |
| 144 | 3300046501 | Ga0495607_0068293 | Ga0495607_0068293_1029_1814 | 257 |
| 145 | 3300046501 | Ga0495607_0071780 | Ga0495607_0071780_984_1769 | 257 |
| 146 | 3300046501 | Ga0495607_0093522 | Ga0495607_0093522_180_965 | 257 |
| 147 | 3300046501 | Ga0495607_0162697 | Ga0495607_0162697_192_977 | 257 |
| 148 | 3300046506 | Ga0495583_0000004 | Ga0495583_0000004_552247_553032 | 257 |
| 149 | 3300046506 | Ga0495583_0020469 | Ga0495583_0020469_228_1046 | 257 |
| 150 | 3300046507 | Ga0495606_0042581 | Ga0495606_0042581_1863_2651 | 257 |
| 151 | 3300046507 | Ga0495606_0056855 | Ga0495606_0056855_1468_2253 | 257 |
| 152 | 3300046512 | Ga0495610_0052448 | Ga0495610_0052448_1102_1887 | 257 |
| 153 | 3300046513 | Ga0495616_0023828 | Ga0495616_0023828_210_995 | 257 |
| 154 | 3300046513 | Ga0495616_0029386 | Ga0495616_0029386_1101_1886 | 257 |
| 155 | 3300046523 | Ga0495644_0029527 | Ga0495644_0029527_169_954 | 257 |
| 156 | 3300046523 | Ga0495644_0033556 | Ga0495644_0033556_973_1758 | 257 |
| 157 | 3300046524 | Ga0495648_0003845 | Ga0495648_0003845_10942_11727 | 257 |
| 158 | 3300046528 | Ga0495642_0042628 | Ga0495642_0042628_213_998 | 257 |
| 159 | 3300046530 | Ga0495654_0010971 | Ga0495654_0010971_325_1113 | 257 |
| 160 | 3300046538 | Ga0495609_0002290 | Ga0495609_0002290_2878_3696 | 257 |
| 161 | 3300046538 | Ga0495609_0008339 | Ga0495609_0008339_203_988 | 257 |
| 162 | 3300046538 | Ga0495609_0018425 | Ga0495609_0018425_1505_2290 | 257 |
| 163 | 3300046557 | Ga0495622_0089410 | Ga0495622_0089410_541_1326 | 257 |
| 164 | 3300046558 | Ga0495633_0216760 | Ga0495633_0216760_46_831 | 257 |
| 165 | 3300046616 | Ga0495668_0036226 | Ga0495668_0036226_592_1410 | 257 |
| 166 | 3300046616 | Ga0495668_0255778 | Ga0495668_0255778_138_923 | 257 |
| 167 | 3300046648 | Ga0495611_0012970 | Ga0495611_0012970_181_966 | 257 |
| 168 | 3300046648 | Ga0495611_0071758 | Ga0495611_0071758_630_1415 | 257 |
| 169 | 3300046660 | Ga0495625_0013755 | Ga0495625_0013755_2091_2879 | 257 |
| 170 | 3300046660 | Ga0495625_0020795 | Ga0495625_0020795_1981_2799 | 257 |
| 171 | 3300046664 | Ga0495659_0000128 | Ga0495659_0000128_29531_30319 | 257 |
| 172 | 3300046664 | Ga0495659_0010448 | Ga0495659_0010448_1217_2002 | 257 |
| 173 | 3300046664 | Ga0495659_0036069 | Ga0495659_0036069_656_1474 | 257 |
| 174 | 3300046665 | Ga0495661_0188865 | Ga0495661_0188865_55_840 | 257 |
| 175 | 3300046684 | Ga0495669_0001427 | Ga0495669_0001427_2396_3214 | 257 |
| 176 | 3300046691 | Ga0495670_0008487 | Ga0495670_0008487_172_957 | 257 |
| 177 | 3300046691 | Ga0495670_0011747 | Ga0495670_0011747_2232_3017 | 257 |
| 178 | 3300046692 | Ga0495671_0000234 | Ga0495671_0000234_2734_3522 | 257 |
| 179 | 3300046794 | Ga0495589_0030821 | Ga0495589_0030821_1402_2187 | 257 |
| 180 | 3300046810 | Ga0495660_0002657 | Ga0495660_0002657_2067_2852 | 257 |
| 181 | 3300046810 | Ga0495660_0038578 | Ga0495660_0038578_1450_2238 | 257 |
| 182 | 3300047318 | Ga0495636_0002363 | Ga0495636_0002363_1068_1853 | 257 |
| 183 | 3300047318 | Ga0495636_0005534 | Ga0495636_0005534_20_838 | 257 |
| 184 | 3300047320 | Ga0495672_0000035 | Ga0495672_0000035_30479_31267 | 257 |
| 185 | 3300047320 | Ga0495672_0071295 | Ga0495672_0071295_1134_1919 | 257 |
| 186 | 3300047320 | Ga0495672_0089624 | Ga0495672_0089624_181_966 | 257 |
| 187 | 3300047323 | Ga0495683_0015974 | Ga0495683_0015974_1460_2245 | 257 |
| 188 | 3300047443 | Ga0495687_000487 | Ga0495687_000487_47152_47937 | 257 |
| 189 | 3300047443 | Ga0495687_065092 | Ga0495687_065092_398_1216 | 257 |
| 190 | 3300047445 | Ga0495677_0002848 | Ga0495677_0002848_2930_3715 | 257 |
| 191 | 3300047447 | Ga0495685_000132 | Ga0495685_000132_13648_14433 | 257 |
| 192 | 3300047447 | Ga0495685_061798 | Ga0495685_061798_296_1114 | 257 |
| 193 | 3300047469 | Ga0495673_0011436 | Ga0495673_0011436_1343_2128 | 257 |
| 194 | 3300047470 | Ga0495681_0015166 | Ga0495681_0015166_1841_2659 | 257 |
| 195 | 3300047472 | Ga0495686_0001783 | Ga0495686_0001783_18766_19554 | 257 |
| 196 | 3300047472 | Ga0495686_0032551 | Ga0495686_0032551_2322_3107 | 257 |
| 197 | 3300047472 | Ga0495686_0046000 | Ga0495686_0046000_1917_2702 | 257 |
| 198 | 3300049459 | Ga0495678_001414 | Ga0495678_001414_16906_17691 | 257 |
| 199 | 3300049460 | Ga0495682_0000763 | Ga0495682_0000763_10182_10967 | 257 |
| 200 | 3300049460 | Ga0495682_0004796 | Ga0495682_0004796_905_1690 | 257 |
| 201 | iso_pu_bacteria | 2643221639 | 2644220825 | 257 |
| 202 | iso_pu_bacteria | 2643221646 | 2644256533 | 257 |
| 203 | iso_pu_bacteria | 2738541280 | 2738740712 | 257 |
| 204 | iso_pu_bacteria | 2738541300 | 2738845030 | 257 |
| 205 | iso_pu_bacteria | 2738541337 | 2739057247 | 257 |
| 206 | iso_pu_bacteria | 2738543018 | 2739274609 | 257 |
| 207 | iso_pu_bacteria | 2738543030 | 2739343653 | 257 |
| 208 | 3300006948 | Ga0099826_10000003 | Ga0099826_10000003941 | 258 |
| 209 | 3300009036 | Ga0105244_10001359 | Ga0105244_1000135918 | 258 |
| 210 | 3300009553 | Ga0105249_10175232 | Ga0105249_101752322 | 258 |
| 211 | 3300025263 | Ga0209565_1006289 | Ga0209565_10062895 | 258 |
| 212 | 3300025299 | Ga0209256_1000013 | Ga0209256_1000013536 | 258 |
| 213 | 3300025941 | Ga0207711_10022536 | Ga0207711_100225365 | 258 |
| 214 | 3300025942 | Ga0207689_10091292 | Ga0207689_100912921 | 258 |
| 215 | 3300027666 | Ga0209282_1000002 | Ga0209282_100000267 | 258 |
| 216 | 3300030745 | Ga0316182_1415013 | Ga0316182_14150132 | 258 |
| 217 | 3300031548 | Ga0307408_100000232 | Ga0307408_10000023251 | 258 |
| 218 | 3300031727 | Ga0316576_10004964 | Ga0316576_100049647 | 258 |
| 219 | 3300035398 | Ga0316574_0000055 | Ga0316574_0000055_16245_17066 | 258 |
| 220 | 3300036647 | Ga0316582_0075867 | Ga0316582_0075867_1146_1967 | 258 |
| 221 | 3300036712 | Ga0316584_0426597 | Ga0316584_0426597_121_915 | 258 |
| 222 | 3300046810 | Ga0495660_0012352 | Ga0495660_0012352_1815_2606 | 258 |
| 223 | 3300047320 | Ga0495672_0000013 | Ga0495672_0000013_76692_77483 | 258 |
| 224 | 3300047472 | Ga0495686_0118940 | Ga0495686_0118940_278_1069 | 258 |
| 225 | 3300048906 | Ga0496103_0019423 | Ga0496103_0019423_1689_2477 | 258 |
| 226 | 3300048917 | Ga0496114_0035890 | Ga0496114_0035890_398_1186 | 258 |
| 227 | 3300049459 | Ga0495678_063019 | Ga0495678_063019_538_1329 | 258 |
| 228 | 3300049667 | Ga0501230_005664 | Ga0501230_005664_913_1704 | 258 |
| 229 | 3300049766 | Ga0501269_000137 | Ga0501269_000137_18493_19281 | 258 |
| 230 | iso_pu_bacteria | 2599185292 | 2599903649 | 258 |
| 231 | iso_pu_bacteria | 2643221569 | 2643860130 | 258 |
| 232 | iso_pu_bacteria | 2643221594 | 2643979244 | 258 |
| 233 | iso_pu_bacteria | 2643221621 | 2644120162 | 258 |
| 234 | iso_pu_bacteria | 2643221645 | 2644249289 | 258 |
| 235 | iso_pu_bacteria | 2643221664 | 2644359387 | 258 |
| 236 | iso_pu_bacteria | 2808606395 | 2809035878 | 258 |
| 237 | iso_pu_bacteria | 2857537821 | 2857538869 | 258 |
| 238 | iso_pu_bacteria | 2941479691 | 2941483428 | 258 |
| 239 | 3300048917 | Ga0496114_0270908 | Ga0496114_0270908_205_1071 | 259 |
| 240 | iso_pu_bacteria | 2643221644 | 2644244185 | 259 |
| 241 | 3300002705 | JGI25156J39149_1000937 | JGI25156J39149_100093715 | 260 |
| 242 | 3300006038 | Ga0075365_10257250 | Ga0075365_102572501 | 260 |
| 243 | 3300006048 | Ga0075363_100042590 | Ga0075363_1000425902 | 260 |
| 244 | 3300006178 | Ga0075367_10015518 | Ga0075367_100155182 | 260 |
| 245 | 3300006195 | Ga0075366_10062019 | Ga0075366_100620191 | 260 |
| 246 | 3300009011 | Ga0105251_10001278 | Ga0105251_100012787 | 260 |
| 247 | 3300009036 | Ga0105244_10003124 | Ga0105244_100031246 | 260 |
| 248 | 3300009036 | Ga0105244_10003155 | Ga0105244_100031559 | 260 |
| 249 | 3300011119 | Ga0105246_10004791 | Ga0105246_100047914 | 260 |
| 250 | 3300013100 | Ga0157373_10000911 | Ga0157373_1000091120 | 260 |
| 251 | 3300013102 | Ga0157371_10000491 | Ga0157371_1000049122 | 260 |
| 252 | 3300013105 | Ga0157369_10081321 | Ga0157369_100813213 | 260 |
| 253 | 3300013105 | Ga0157369_10274606 | Ga0157369_102746062 | 260 |
| 254 | 3300025256 | Ga0209759_1000033 | Ga0209759_1000033107 | 260 |
| 255 | 3300025711 | Ga0207696_1000113 | Ga0207696_1000113111 | 260 |
| 256 | 3300025728 | Ga0207655_1003440 | Ga0207655_100344012 | 260 |
| 257 | 3300025728 | Ga0207655_1010720 | Ga0207655_10107207 | 260 |
| 258 | 3300025735 | Ga0207713_1000347 | Ga0207713_10003478 | 260 |
| 259 | 3300031548 | Ga0307408_100011172 | Ga0307408_1000111726 | 260 |
| 260 | 3300031731 | Ga0307405_10034126 | Ga0307405_100341263 | 260 |
| 261 | 3300031995 | Ga0307409_100016301 | Ga0307409_1000163014 | 260 |
| 262 | 3300032002 | Ga0307416_100012248 | Ga0307416_1000122484 | 260 |
| 263 | 3300032002 | Ga0307416_101046005 | Ga0307416_1010460051 | 260 |
| 264 | 3300032005 | Ga0307411_10025039 | Ga0307411_100250394 | 260 |
| 265 | 3300041408 | Ga0439453_0010252 | Ga0439453_0010252_374_1174 | 260 |
| 266 | 3300042010 | Ga0439452_000002 | Ga0439452_000002_1208376_1209158 | 260 |
| 267 | 3300042138 | Ga0450903_008716 | Ga0450903_008716_648_1448 | 260 |
| 268 | 3300042156 | Ga0439446_0010002 | Ga0439446_0010002_1053_1853 | 260 |
| 269 | 3300042439 | Ga0439464_0012210 | Ga0439464_0012210_306_1106 | 260 |
| 270 | 3300044673 | Ga0453683_0007447 | Ga0453683_0007447_1891_2697 | 260 |
| 271 | 3300045051 | Ga0451576_0075742 | Ga0451576_0075742_1339_2145 | 260 |
| 272 | 3300046452 | Ga0495617_036558 | Ga0495617_036558_473_1255 | 260 |
| 273 | 3300046454 | Ga0495592_0041458 | Ga0495592_0041458_2421_3206 | 260 |
| 274 | 3300046455 | Ga0495603_0024142 | Ga0495603_0024142_2695_3480 | 260 |
| 275 | 3300046457 | Ga0495590_0007818 | Ga0495590_0007818_3291_4076 | 260 |
| 276 | 3300046458 | Ga0495591_000006 | Ga0495591_000006_145654_146436 | 260 |
| 277 | 3300046458 | Ga0495591_000708 | Ga0495591_000708_13583_14368 | 260 |
| 278 | 3300046458 | Ga0495591_004286 | Ga0495591_004286_2331_3116 | 260 |
| 279 | 3300046459 | Ga0495629_0013743 | Ga0495629_0013743_2785_3570 | 260 |
| 280 | 3300046459 | Ga0495629_0020594 | Ga0495629_0020594_517_1302 | 260 |
| 281 | 3300046459 | Ga0495629_0032249 | Ga0495629_0032249_1014_1799 | 260 |
| 282 | 3300046460 | Ga0495638_0005690 | Ga0495638_0005690_6533_7318 | 260 |
| 283 | 3300046461 | Ga0495641_0076187 | Ga0495641_0076187_479_1264 | 260 |
| 284 | 3300046462 | Ga0495651_0002299 | Ga0495651_0002299_1958_2743 | 260 |
| 285 | 3300046462 | Ga0495651_0031041 | Ga0495651_0031041_1668_2453 | 260 |
| 286 | 3300046463 | Ga0495653_0029195 | Ga0495653_0029195_2737_3522 | 260 |
| 287 | 3300046463 | Ga0495653_0182344 | Ga0495653_0182344_69_854 | 260 |
| 288 | 3300046463 | Ga0495653_0304947 | Ga0495653_0304947_228_1013 | 260 |
| 289 | 3300046471 | Ga0495650_0002885 | Ga0495650_0002885_5727_6512 | 260 |
| 290 | 3300046471 | Ga0495650_0003344 | Ga0495650_0003344_3635_4420 | 260 |
| 291 | 3300046471 | Ga0495650_0007225 | Ga0495650_0007225_4193_4978 | 260 |
| 292 | 3300046472 | Ga0495580_0002864 | Ga0495580_0002864_213_998 | 260 |
| 293 | 3300046472 | Ga0495580_0004033 | Ga0495580_0004033_7574_8359 | 260 |
| 294 | 3300046472 | Ga0495580_0048073 | Ga0495580_0048073_311_1096 | 260 |
| 295 | 3300046473 | Ga0495582_0009034 | Ga0495582_0009034_66_851 | 260 |
| 296 | 3300046473 | Ga0495582_0041510 | Ga0495582_0041510_469_1254 | 260 |
| 297 | 3300046474 | Ga0495605_0004455 | Ga0495605_0004455_961_1746 | 260 |
| 298 | 3300046476 | Ga0495662_0006294 | Ga0495662_0006294_3832_4617 | 260 |
| 299 | 3300046476 | Ga0495662_0026476 | Ga0495662_0026476_1465_2250 | 260 |
| 300 | 3300046477 | Ga0495664_0005206 | Ga0495664_0005206_2126_2911 | 260 |
| 301 | 3300046499 | Ga0495594_0074435 | Ga0495594_0074435_971_1756 | 260 |
| 302 | 3300046500 | Ga0495596_0014593 | Ga0495596_0014593_1843_2628 | 260 |
| 303 | 3300046500 | Ga0495596_0128004 | Ga0495596_0128004_125_910 | 260 |
| 304 | 3300046506 | Ga0495583_0000192 | Ga0495583_0000192_12132_12917 | 260 |
| 305 | 3300046506 | Ga0495583_0002676 | Ga0495583_0002676_9021_9806 | 260 |
| 306 | 3300046507 | Ga0495606_0007446 | Ga0495606_0007446_6778_7563 | 260 |
| 307 | 3300046511 | Ga0495608_0008757 | Ga0495608_0008757_55_840 | 260 |
| 308 | 3300046512 | Ga0495610_0006265 | Ga0495610_0006265_2457_3242 | 260 |
| 309 | 3300046514 | Ga0495618_0007359 | Ga0495618_0007359_3788_4573 | 260 |
| 310 | 3300046514 | Ga0495618_0011445 | Ga0495618_0011445_2695_3480 | 260 |
| 311 | 3300046514 | Ga0495618_0031012 | Ga0495618_0031012_2284_3069 | 260 |
| 312 | 3300046515 | Ga0495620_0000377 | Ga0495620_0000377_4399_5184 | 260 |
| 313 | 3300046515 | Ga0495620_0007751 | Ga0495620_0007751_4017_4802 | 260 |
| 314 | 3300046516 | Ga0495628_0033520 | Ga0495628_0033520_1144_1929 | 260 |
| 315 | 3300046516 | Ga0495628_0084762 | Ga0495628_0084762_69_854 | 260 |
| 316 | 3300046517 | Ga0495630_0011098 | Ga0495630_0011098_2199_2984 | 260 |
| 317 | 3300046517 | Ga0495630_0021605 | Ga0495630_0021605_3768_4553 | 260 |
| 318 | 3300046517 | Ga0495630_0060130 | Ga0495630_0060130_21_806 | 260 |
| 319 | 3300046519 | Ga0495632_0000255 | Ga0495632_0000255_10814_11599 | 260 |
| 320 | 3300046520 | Ga0495637_0007847 | Ga0495637_0007847_3521_4306 | 260 |
| 321 | 3300046524 | Ga0495648_0003924 | Ga0495648_0003924_11141_11926 | 260 |
| 322 | 3300046526 | Ga0495666_0003786 | Ga0495666_0003786_6665_7450 | 260 |
| 323 | 3300046526 | Ga0495666_0021013 | Ga0495666_0021013_1289_2074 | 260 |
| 324 | 3300046528 | Ga0495642_0025379 | Ga0495642_0025379_1484_2269 | 260 |
| 325 | 3300046529 | Ga0495652_0123897 | Ga0495652_0123897_827_1612 | 260 |
| 326 | 3300046530 | Ga0495654_0000013 | Ga0495654_0000013_192288_193070 | 260 |
| 327 | 3300046531 | Ga0495665_0035142 | Ga0495665_0035142_1213_1998 | 260 |
| 328 | 3300046531 | Ga0495665_0161269 | Ga0495665_0161269_69_854 | 260 |
| 329 | 3300046533 | Ga0495640_0002432 | Ga0495640_0002432_832_1617 | 260 |
| 330 | 3300046533 | Ga0495640_0031853 | Ga0495640_0031853_1005_1790 | 260 |
| 331 | 3300046533 | Ga0495640_0311473 | Ga0495640_0311473_56_841 | 260 |
| 332 | 3300046536 | Ga0495587_0001857 | Ga0495587_0001857_3737_4522 | 260 |
| 333 | 3300046538 | Ga0495609_0028433 | Ga0495609_0028433_410_1195 | 260 |
| 334 | 3300046543 | Ga0495645_0002449 | Ga0495645_0002449_6953_7738 | 260 |
| 335 | 3300046557 | Ga0495622_0000302 | Ga0495622_0000302_14241_15026 | 260 |
| 336 | 3300046642 | Ga0495634_0010873 | Ga0495634_0010873_2079_2864 | 260 |
| 337 | 3300046648 | Ga0495611_0012025 | Ga0495611_0012025_1730_2515 | 260 |
| 338 | 3300046660 | Ga0495625_0041123 | Ga0495625_0041123_2148_2933 | 260 |
| 339 | 3300046663 | Ga0495635_0039437 | Ga0495635_0039437_1035_1820 | 260 |
| 340 | 3300046665 | Ga0495661_0000312 | Ga0495661_0000312_39919_40704 | 260 |
| 341 | 3300046665 | Ga0495661_0007287 | Ga0495661_0007287_6142_6927 | 260 |
| 342 | 3300046665 | Ga0495661_0038454 | Ga0495661_0038454_2017_2802 | 260 |
| 343 | 3300046675 | Ga0495657_0068564 | Ga0495657_0068564_1133_1918 | 260 |
| 344 | 3300046678 | Ga0495599_0013702 | Ga0495599_0013702_2659_3444 | 260 |
| 345 | 3300046678 | Ga0495599_0043749 | Ga0495599_0043749_1488_2273 | 260 |
| 346 | 3300046678 | Ga0495599_0149419 | Ga0495599_0149419_650_1435 | 260 |
| 347 | 3300046679 | Ga0495623_0001488 | Ga0495623_0001488_10541_11326 | 260 |
| 348 | 3300046679 | Ga0495623_0001635 | Ga0495623_0001635_3741_4526 | 260 |
| 349 | 3300046679 | Ga0495623_0022723 | Ga0495623_0022723_2229_3014 | 260 |
| 350 | 3300046680 | Ga0495646_0013273 | Ga0495646_0013273_2417_3202 | 260 |
| 351 | 3300046684 | Ga0495669_0023483 | Ga0495669_0023483_1276_2061 | 260 |
| 352 | 3300046689 | Ga0495613_0068202 | Ga0495613_0068202_315_1100 | 260 |
| 353 | 3300046689 | Ga0495613_0102670 | Ga0495613_0102670_843_1628 | 260 |
| 354 | 3300046690 | Ga0495624_0000787 | Ga0495624_0000787_22168_22953 | 260 |
| 355 | 3300046690 | Ga0495624_0035968 | Ga0495624_0035968_1472_2257 | 260 |
| 356 | 3300046690 | Ga0495624_0050233 | Ga0495624_0050233_1841_2626 | 260 |
| 357 | 3300046691 | Ga0495670_0036263 | Ga0495670_0036263_761_1546 | 260 |
| 358 | 3300046692 | Ga0495671_0023179 | Ga0495671_0023179_1180_1965 | 260 |
| 359 | 3300046694 | Ga0495649_0003953 | Ga0495649_0003953_7352_8137 | 260 |
| 360 | 3300046794 | Ga0495589_0015413 | Ga0495589_0015413_1539_2324 | 260 |
| 361 | 3300046794 | Ga0495589_0047783 | Ga0495589_0047783_41_826 | 260 |
| 362 | 3300047315 | Ga0495581_0019631 | Ga0495581_0019631_1202_1987 | 260 |
| 363 | 3300047315 | Ga0495581_0020585 | Ga0495581_0020585_1921_2706 | 260 |
| 364 | 3300047317 | Ga0495604_0003221 | Ga0495604_0003221_6494_7279 | 260 |
| 365 | 3300047317 | Ga0495604_0071240 | Ga0495604_0071240_215_1000 | 260 |
| 366 | 3300047317 | Ga0495604_0232902 | Ga0495604_0232902_224_1009 | 260 |
| 367 | 3300047319 | Ga0495674_0038277 | Ga0495674_0038277_2223_3008 | 260 |
| 368 | 3300047319 | Ga0495674_0119294 | Ga0495674_0119294_1402_2187 | 260 |
| 369 | 3300047319 | Ga0495674_0140481 | Ga0495674_0140481_957_1742 | 260 |
| 370 | 3300047320 | Ga0495672_0040219 | Ga0495672_0040219_1961_2746 | 260 |
| 371 | 3300047321 | Ga0495676_0047420 | Ga0495676_0047420_2046_2831 | 260 |
| 372 | 3300047321 | Ga0495676_0057759 | Ga0495676_0057759_271_1056 | 260 |
| 373 | 3300047321 | Ga0495676_0069664 | Ga0495676_0069664_69_854 | 260 |
| 374 | 3300047322 | Ga0495680_0023350 | Ga0495680_0023350_2755_3540 | 260 |
| 375 | 3300047322 | Ga0495680_0031357 | Ga0495680_0031357_2567_3352 | 260 |
| 376 | 3300047322 | Ga0495680_0237906 | Ga0495680_0237906_194_979 | 260 |
| 377 | 3300047323 | Ga0495683_0009105 | Ga0495683_0009105_814_1599 | 260 |
| 378 | 3300047323 | Ga0495683_0017943 | Ga0495683_0017943_1287_2072 | 260 |
| 379 | 3300047444 | Ga0495675_0020309 | Ga0495675_0020309_2430_3215 | 260 |
| 380 | 3300047444 | Ga0495675_0021583 | Ga0495675_0021583_2239_3024 | 260 |
| 381 | 3300047444 | Ga0495675_0041955 | Ga0495675_0041955_1885_2670 | 260 |
| 382 | 3300047446 | Ga0495679_000050 | Ga0495679_000050_25532_26317 | 260 |
| 383 | 3300047446 | Ga0495679_000683 | Ga0495679_000683_14590_15375 | 260 |
| 384 | 3300047469 | Ga0495673_0000211 | Ga0495673_0000211_5514_6299 | 260 |
| 385 | 3300047469 | Ga0495673_0003072 | Ga0495673_0003072_6433_7218 | 260 |
| 386 | 3300047471 | Ga0495684_0025416 | Ga0495684_0025416_1985_2770 | 260 |
| 387 | 3300047673 | Ga0495593_0002313 | Ga0495593_0002313_5459_6244 | 260 |
| 388 | 3300047673 | Ga0495593_0016566 | Ga0495593_0016566_2458_3243 | 260 |
| 389 | 3300048088 | Ga0495602_0014931 | Ga0495602_0014931_4814_5599 | 260 |
| 390 | 3300048088 | Ga0495602_0018887 | Ga0495602_0018887_21_806 | 260 |
| 391 | 3300048088 | Ga0495602_0022575 | Ga0495602_0022575_4833_5618 | 260 |
| 392 | 3300048088 | Ga0495602_0028092 | Ga0495602_0028092_2770_3555 | 260 |
| 393 | 3300048088 | Ga0495602_0380303 | Ga0495602_0380303_21_806 | 260 |
| 394 | 3300048089 | Ga0495614_0014052 | Ga0495614_0014052_1014_1799 | 260 |
| 395 | 3300048904 | Ga0496101_0000006 | Ga0496101_0000006_197647_198429 | 260 |
| 396 | 3300048905 | Ga0496102_0012321 | Ga0496102_0012321_5067_5852 | 260 |
| 397 | 3300048906 | Ga0496103_0024129 | Ga0496103_0024129_2747_3532 | 260 |
| 398 | 3300048920 | Ga0496117_0019985 | Ga0496117_0019985_4613_5398 | 260 |
| 399 | 3300048920 | Ga0496117_0056939 | Ga0496117_0056939_305_1090 | 260 |
| 400 | 3300048921 | Ga0496118_0009040 | Ga0496118_0009040_2215_3000 | 260 |
| 401 | 3300048921 | Ga0496118_0011515 | Ga0496118_0011515_4028_4813 | 260 |
| 402 | 3300048921 | Ga0496118_0016628 | Ga0496118_0016628_4253_5038 | 260 |
| 403 | 3300048921 | Ga0496118_0041057 | Ga0496118_0041057_2628_3413 | 260 |
| 404 | 3300048923 | Ga0496120_0000069 | Ga0496120_0000069_48830_49612 | 260 |
| 405 | 3300048924 | Ga0496121_0001759 | Ga0496121_0001759_20889_21674 | 260 |
| 406 | 3300048924 | Ga0496121_0030602 | Ga0496121_0030602_4124_4909 | 260 |
| 407 | 3300048925 | Ga0496122_0001533 | Ga0496122_0001533_14628_15413 | 260 |
| 408 | 3300048925 | Ga0496122_0010192 | Ga0496122_0010192_299_1081 | 260 |
| 409 | 3300048926 | Ga0496123_0000513 | Ga0496123_0000513_49339_50124 | 260 |
| 410 | 3300048926 | Ga0496123_0010357 | Ga0496123_0010357_3370_4152 | 260 |
| 411 | 3300048927 | Ga0496124_0000229 | Ga0496124_0000229_20149_20934 | 260 |
| 412 | 3300048927 | Ga0496124_0008815 | Ga0496124_0008815_529_1311 | 260 |
| 413 | 3300048927 | Ga0496124_0011429 | Ga0496124_0011429_6720_7502 | 260 |
| 414 | 3300048929 | Ga0496126_0001236 | Ga0496126_0001236_32365_33150 | 260 |
| 415 | 3300048929 | Ga0496126_0001826 | Ga0496126_0001826_8266_9051 | 260 |
| 416 | 3300048929 | Ga0496126_0043883 | Ga0496126_0043883_1943_2725 | 260 |
| 417 | 3300049459 | Ga0495678_061214 | Ga0495678_061214_595_1380 | 260 |
| 418 | 3300049460 | Ga0495682_0006175 | Ga0495682_0006175_961_1746 | 260 |
| 419 | 3300049460 | Ga0495682_0018388 | Ga0495682_0018388_644_1429 | 260 |
| 420 | 3300050493 | nmdc:mga0k408_132288_c1 | nmdc:mga0k408_132288_c1_637_1440 | 260 |
| 421 | 3300050509 | nmdc:mga0qj67_208827_c1 | nmdc:mga0qj67_208827_c1_382_1185 | 260 |
| 422 | 3300053083 | Ga0495655_0018550 | Ga0495655_0018550_50_835 | 260 |
| 423 | 3300002738 | JGI25154J39366_1004078 | JGI25154J39366_10040783 | 261 |
| 424 | 3300002774 | JGI25150J39212_1010273 | JGI25150J39212_10102732 | 261 |
| 425 | 3300003763 | Ga0055529_1000133 | Ga0055529_100013382 | 261 |
| 426 | 3300003771 | Ga0055526_1000230 | Ga0055526_10002304 | 261 |
| 427 | 3300003771 | Ga0055526_1000258 | Ga0055526_10002585 | 261 |
| 428 | 3300003794 | Ga0055531_10001392 | Ga0055531_1000139215 | 261 |
| 429 | 3300005335 | Ga0070666_10411118 | Ga0070666_104111181 | 261 |
| 430 | 3300005337 | Ga0070682_100027515 | Ga0070682_1000275152 | 261 |
| 431 | 3300006177 | Ga0075362_10003441 | Ga0075362_100034411 | 261 |
| 432 | 3300006195 | Ga0075366_10061573 | Ga0075366_100615732 | 261 |
| 433 | 3300006946 | Ga0079104_1006106 | Ga0079104_10061063 | 261 |
| 434 | 3300009148 | Ga0105243_10057549 | Ga0105243_100575492 | 261 |
| 435 | 3300015261 | Ga0182006_1000070 | Ga0182006_1000070113 | 261 |
| 436 | 3300015265 | Ga0182005_1000003 | Ga0182005_1000003115 | 261 |
| 437 | 3300025233 | Ga0209437_108069 | Ga0209437_1080692 | 261 |
| 438 | 3300025245 | Ga0207425_1000360 | Ga0207425_10003608 | 261 |
| 439 | 3300025246 | Ga0209646_1000114 | Ga0209646_1000114120 | 261 |
| 440 | 3300025253 | Ga0209677_100535 | Ga0209677_10053515 | 261 |
| 441 | 3300025272 | Ga0209455_1000063 | Ga0209455_1000063211 | 261 |
| 442 | 3300025294 | Ga0209025_1003724 | Ga0209025_100372412 | 261 |
| 443 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006894 | 261 |
| 444 | 3300025295 | Ga0209564_1000026 | Ga0209564_1000026369 | 261 |
| 445 | 3300025297 | Ga0209758_1000372 | Ga0209758_100037233 | 261 |
| 446 | 3300025728 | Ga0207655_1001536 | Ga0207655_100153618 | 261 |
| 447 | 3300025728 | Ga0207655_1004984 | Ga0207655_10049845 | 261 |
| 448 | 3300025927 | Ga0207687_10389183 | Ga0207687_103891832 | 261 |
| 449 | 3300027111 | Ga0209281_1009657 | Ga0209281_10096572 | 261 |
| 450 | 3300028794 | Ga0307515_10045652 | Ga0307515_100456525 | 261 |
| 451 | 3300030744 | Ga0316181_1104601 | Ga0316181_11046012 | 261 |
| 452 | 3300031548 | Ga0307408_100000046 | Ga0307408_10000004672 | 261 |
| 453 | 3300032005 | Ga0307411_10005120 | Ga0307411_100051205 | 261 |
| 454 | 3300035114 | Ga0373939_0123703 | Ga0373939_0123703_53_898 | 261 |
| 455 | 3300042000 | Ga0439437_003746 | Ga0439437_003746_540_1361 | 261 |
| 456 | 3300042117 | Ga0450913_001531 | Ga0450913_001531_298_1101 | 261 |
| 457 | 3300042126 | Ga0450888_000330 | Ga0450888_000330_3138_3959 | 261 |
| 458 | 3300042127 | Ga0450890_001017 | Ga0450890_001017_2488_3309 | 261 |
| 459 | 3300042129 | Ga0450891_000290 | Ga0450891_000290_702_1523 | 261 |
| 460 | 3300042130 | Ga0450892_002966 | Ga0450892_002966_65_886 | 261 |
| 461 | 3300042144 | Ga0450889_000647 | Ga0450889_000647_1407_2228 | 261 |
| 462 | 3300042530 | Ga0450916_001625 | Ga0450916_001625_1049_1870 | 261 |
| 463 | 3300044842 | Ga0466957_0013506 | Ga0466957_0013506_3378_4205 | 261 |
| 464 | 3300045051 | Ga0451576_0098633 | Ga0451576_0098633_1203_2024 | 261 |
| 465 | 3300046452 | Ga0495617_000048 | Ga0495617_000048_111226_112071 | 261 |
| 466 | 3300046452 | Ga0495617_003612 | Ga0495617_003612_3573_4415 | 261 |
| 467 | 3300046453 | Ga0495627_000046 | Ga0495627_000046_124160_124969 | 261 |
| 468 | 3300046457 | Ga0495590_0000030 | Ga0495590_0000030_27967_28776 | 261 |
| 469 | 3300046460 | Ga0495638_0000105 | Ga0495638_0000105_43436_44245 | 261 |
| 470 | 3300046460 | Ga0495638_0056593 | Ga0495638_0056593_529_1374 | 261 |
| 471 | 3300046460 | Ga0495638_0120078 | Ga0495638_0120078_52_903 | 261 |
| 472 | 3300046463 | Ga0495653_0000018 | Ga0495653_0000018_43597_44436 | 261 |
| 473 | 3300046471 | Ga0495650_0000212 | Ga0495650_0000212_3449_4294 | 261 |
| 474 | 3300046471 | Ga0495650_0000227 | Ga0495650_0000227_112332_113177 | 261 |
| 475 | 3300046471 | Ga0495650_0002015 | Ga0495650_0002015_15428_16237 | 261 |
| 476 | 3300046471 | Ga0495650_0007378 | Ga0495650_0007378_3900_4745 | 261 |
| 477 | 3300046474 | Ga0495605_0000005 | Ga0495605_0000005_114473_115327 | 261 |
| 478 | 3300046474 | Ga0495605_0000105 | Ga0495605_0000105_90286_91095 | 261 |
| 479 | 3300046474 | Ga0495605_0093870 | Ga0495605_0093870_144_953 | 261 |
| 480 | 3300046475 | Ga0495639_0138339 | Ga0495639_0138339_250_1059 | 261 |
| 481 | 3300046492 | Ga0495585_0001802 | Ga0495585_0001802_6908_7750 | 261 |
| 482 | 3300046501 | Ga0495607_0005215 | Ga0495607_0005215_5833_6642 | 261 |
| 483 | 3300046501 | Ga0495607_0008312 | Ga0495607_0008312_3673_4482 | 261 |
| 484 | 3300046506 | Ga0495583_0000645 | Ga0495583_0000645_33254_34063 | 261 |
| 485 | 3300046506 | Ga0495583_0008863 | Ga0495583_0008863_3537_4346 | 261 |
| 486 | 3300046507 | Ga0495606_0000158 | Ga0495606_0000158_4699_5541 | 261 |
| 487 | 3300046507 | Ga0495606_0000547 | Ga0495606_0000547_14020_14865 | 261 |
| 488 | 3300046507 | Ga0495606_0001026 | Ga0495606_0001026_15352_16191 | 261 |
| 489 | 3300046507 | Ga0495606_0008840 | Ga0495606_0008840_2035_2901 | 261 |
| 490 | 3300046507 | Ga0495606_0009625 | Ga0495606_0009625_3879_4763 | 261 |
| 491 | 3300046507 | Ga0495606_0026012 | Ga0495606_0026012_728_1537 | 261 |
| 492 | 3300046512 | Ga0495610_0000021 | Ga0495610_0000021_118535_119374 | 261 |
| 493 | 3300046512 | Ga0495610_0005098 | Ga0495610_0005098_5748_6614 | 261 |
| 494 | 3300046512 | Ga0495610_0012580 | Ga0495610_0012580_711_1550 | 261 |
| 495 | 3300046520 | Ga0495637_0000057 | Ga0495637_0000057_88647_89486 | 261 |
| 496 | 3300046520 | Ga0495637_0006210 | Ga0495637_0006210_3435_4277 | 261 |
| 497 | 3300046522 | Ga0495643_0000181 | Ga0495643_0000181_95821_96660 | 261 |
| 498 | 3300046522 | Ga0495643_0005852 | Ga0495643_0005852_3632_4441 | 261 |
| 499 | 3300046524 | Ga0495648_0000008 | Ga0495648_0000008_275916_276725 | 261 |
| 500 | 3300046524 | Ga0495648_0003617 | Ga0495648_0003617_7333_8172 | 261 |
| 501 | 3300046524 | Ga0495648_0010048 | Ga0495648_0010048_3612_4451 | 261 |
| 502 | 3300046524 | Ga0495648_0034770 | Ga0495648_0034770_1658_2503 | 261 |
| 503 | 3300046528 | Ga0495642_0004701 | Ga0495642_0004701_796_1605 | 261 |
| 504 | 3300046528 | Ga0495642_0030572 | Ga0495642_0030572_290_1099 | 261 |
| 505 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_104044_104883 | 261 |
| 506 | 3300046530 | Ga0495654_0012289 | Ga0495654_0012289_2052_2894 | 261 |
| 507 | 3300046538 | Ga0495609_0000049 | Ga0495609_0000049_138891_139700 | 261 |
| 508 | 3300046538 | Ga0495609_0009996 | Ga0495609_0009996_2465_3274 | 261 |
| 509 | 3300046538 | Ga0495609_0028803 | Ga0495609_0028803_73_882 | 261 |
| 510 | 3300046538 | Ga0495609_0100652 | Ga0495609_0100652_323_1162 | 261 |
| 511 | 3300046542 | Ga0495597_0003757 | Ga0495597_0003757_3707_4516 | 261 |
| 512 | 3300046542 | Ga0495597_0005506 | Ga0495597_0005506_2074_2922 | 261 |
| 513 | 3300046557 | Ga0495622_0000415 | Ga0495622_0000415_3181_3990 | 261 |
| 514 | 3300046557 | Ga0495622_0000534 | Ga0495622_0000534_20990_21790 | 261 |
| 515 | 3300046558 | Ga0495633_0000238 | Ga0495633_0000238_45581_46390 | 261 |
| 516 | 3300046558 | Ga0495633_0000409 | Ga0495633_0000409_42791_43627 | 261 |
| 517 | 3300046558 | Ga0495633_0005568 | Ga0495633_0005568_3670_4500 | 261 |
| 518 | 3300046558 | Ga0495633_0045752 | Ga0495633_0045752_354_1199 | 261 |
| 519 | 3300046616 | Ga0495668_0000482 | Ga0495668_0000482_30625_31470 | 261 |
| 520 | 3300046616 | Ga0495668_0001995 | Ga0495668_0001995_8757_9566 | 261 |
| 521 | 3300046616 | Ga0495668_0005088 | Ga0495668_0005088_1282_2124 | 261 |
| 522 | 3300046660 | Ga0495625_0001573 | Ga0495625_0001573_1832_2641 | 261 |
| 523 | 3300046660 | Ga0495625_0009520 | Ga0495625_0009520_3631_4482 | 261 |
| 524 | 3300046660 | Ga0495625_0012167 | Ga0495625_0012167_3553_4398 | 261 |
| 525 | 3300046665 | Ga0495661_0005648 | Ga0495661_0005648_1685_2527 | 261 |
| 526 | 3300046691 | Ga0495670_0059608 | Ga0495670_0059608_1061_1870 | 261 |
| 527 | 3300046692 | Ga0495671_0000343 | Ga0495671_0000343_28595_29431 | 261 |
| 528 | 3300046694 | Ga0495649_0005578 | Ga0495649_0005578_3511_4350 | 261 |
| 529 | 3300046810 | Ga0495660_0001130 | Ga0495660_0001130_3924_4733 | 261 |
| 530 | 3300046810 | Ga0495660_0003276 | Ga0495660_0003276_1231_2073 | 261 |
| 531 | 3300046810 | Ga0495660_0016129 | Ga0495660_0016129_1954_2763 | 261 |
| 532 | 3300046810 | Ga0495660_0024315 | Ga0495660_0024315_1725_2534 | 261 |
| 533 | 3300047320 | Ga0495672_0000410 | Ga0495672_0000410_3794_4633 | 261 |
| 534 | 3300047323 | Ga0495683_0004583 | Ga0495683_0004583_1289_2128 | 261 |
| 535 | 3300047443 | Ga0495687_002805 | Ga0495687_002805_10299_11108 | 261 |
| 536 | 3300047443 | Ga0495687_003597 | Ga0495687_003597_171_980 | 261 |
| 537 | 3300047445 | Ga0495677_0023871 | Ga0495677_0023871_1176_2015 | 261 |
| 538 | 3300047469 | Ga0495673_0000033 | Ga0495673_0000033_107157_107996 | 261 |
| 539 | 3300047469 | Ga0495673_0000034 | Ga0495673_0000034_206397_207254 | 261 |
| 540 | 3300047469 | Ga0495673_0000150 | Ga0495673_0000150_2993_3838 | 261 |
| 541 | 3300047469 | Ga0495673_0006037 | Ga0495673_0006037_889_1698 | 261 |
| 542 | 3300047469 | Ga0495673_0043807 | Ga0495673_0043807_944_1801 | 261 |
| 543 | 3300047470 | Ga0495681_0003316 | Ga0495681_0003316_1958_2767 | 261 |
| 544 | 3300047472 | Ga0495686_0012032 | Ga0495686_0012032_1736_2581 | 261 |
| 545 | 3300047472 | Ga0495686_0049029 | Ga0495686_0049029_1112_1954 | 261 |
| 546 | 3300048914 | Ga0496111_0226201 | Ga0496111_0226201_435_1292 | 261 |
| 547 | 3300048919 | Ga0496116_0088362 | Ga0496116_0088362_792_1601 | 261 |
| 548 | 3300048923 | Ga0496120_0022028 | Ga0496120_0022028_1777_2616 | 261 |
| 549 | 3300048924 | Ga0496121_0027503 | Ga0496121_0027503_3315_4154 | 261 |
| 550 | 3300048925 | Ga0496122_0034998 | Ga0496122_0034998_1675_2514 | 261 |
| 551 | 3300048925 | Ga0496122_0079452 | Ga0496122_0079452_821_1666 | 261 |
| 552 | 3300048926 | Ga0496123_0006224 | Ga0496123_0006224_7174_8013 | 261 |
| 553 | 3300048927 | Ga0496124_0067457 | Ga0496124_0067457_1854_2663 | 261 |
| 554 | 3300048927 | Ga0496124_0110106 | Ga0496124_0110106_1037_1876 | 261 |
| 555 | 3300048927 | Ga0496124_0269004 | Ga0496124_0269004_79_924 | 261 |
| 556 | 3300048928 | Ga0496125_0301484 | Ga0496125_0301484_98_937 | 261 |
| 557 | 3300048929 | Ga0496126_0009279 | Ga0496126_0009279_1771_2610 | 261 |
| 558 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_1055848_1056687 | 261 |
| 559 | 3300049459 | Ga0495678_000076 | Ga0495678_000076_2411_3220 | 261 |
| 560 | 3300049684 | Ga0501255_000368 | Ga0501255_000368_2120_2941 | 261 |
| 561 | 3300050489 | nmdc:mga03683_10149_c1 | nmdc:mga03683_10149_c1_2309_3118 | 261 |
| 562 | 3300050496 | nmdc:mga07m45_213_c2 | nmdc:mga07m45_213_c2_3422_4243 | 261 |
| 563 | 3300053125 | Ga0500618_002777 | Ga0500618_002777_1913_2752 | 261 |
| 564 | 3300053145 | Ga0500586_000469 | Ga0500586_000469_3580_4410 | 261 |
| 565 | 3300053145 | Ga0500586_002702 | Ga0500586_002702_1971_2813 | 261 |
| 566 | iso_pu_bacteria | 2574179768 | 2574431484 | 261 |
| 567 | iso_pu_bacteria | 2738541297 | 2738825905 | 261 |
| 568 | iso_pu_bacteria | 2738541357 | 2739149702 | 261 |
| 569 | iso_pu_bacteria | 2738543003 | 2739191621 | 261 |
| 570 | iso_pu_bacteria | 2738543026 | 2739318098 | 261 |
| 571 | iso_pu_bacteria | 2738543029 | 2739336339 | 261 |
| 572 | iso_pu_bacteria | 2821131069 | 2821135547 | 261 |
| 573 | iso_pu_bacteria | 2842711865 | 2842713974 | 261 |
| 574 | iso_pu_bacteria | 2857553236 | 2857555024 | 261 |
| 575 | iso_pu_bacteria | 2857558681 | 2857562462 | 261 |
| 576 | iso_pu_bacteria | 2857564685 | 2857566308 | 261 |
| 577 | iso_pu_bacteria | 2904424332 | 2904429968 | 261 |
| 578 | iso_pu_bacteria | 2919476304 | 2919478875 | 261 |
| 579 | 3300009036 | Ga0105244_10094326 | Ga0105244_100943261 | 262 |
| 580 | 3300031711 | Ga0265314_10041423 | Ga0265314_100414233 | 262 |
| 581 | 3300046471 | Ga0495650_0000099 | Ga0495650_0000099_132034_132882 | 262 |
| 582 | 3300046528 | Ga0495642_0016872 | Ga0495642_0016872_1378_2184 | 262 |
| 583 | 3300046472 | Ga0495580_0012883 | Ga0495580_0012883_1937_2761 | 263 |
| 584 | 3300048909 | Ga0496106_0000069 | Ga0496106_0000069_36702_37535 | 263 |
| 585 | 3300048924 | Ga0496121_0000102 | Ga0496121_0000102_149157_149990 | 263 |
| 586 | 3300050491 | nmdc:mga00v17_68457_c1 | nmdc:mga00v17_68457_c1_336_1127 | 263 |
| 587 | iso_pu_bacteria | 2842454564 | 2842457771 | 263 |
| 588 | 3300002705 | JGI25156J39149_1000296 | JGI25156J39149_100029628 | 264 |
| 589 | 3300003771 | Ga0055526_1003989 | Ga0055526_10039898 | 264 |
| 590 | 3300005327 | Ga0070658_10027838 | Ga0070658_100278383 | 264 |
| 591 | 3300031238 | Ga0265332_10000030 | Ga0265332_1000003096 | 264 |
| 592 | 3300045051 | Ga0451576_0775869 | Ga0451576_0775869_101_940 | 264 |
| 593 | 3300047472 | Ga0495686_0103663 | Ga0495686_0103663_741_1535 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9966 | 8 | 253 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9893 | 8 | 252 |
| 2b3k-assembly1.cif.gz_A | crystal structure of human methionine aminopeptidase type i in the holo form | 0.981 | 8 | 256 |
| 5yoh-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine | 0.9805 | 7 | 252 |
| 5yxf-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105l mutant) in complex with methionine | 0.9804 | 7 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.996 | 8 | 255 | 3.90.230.10 |
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9877 | 18 | 128 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9844 | 8 | 252 | 3.90.230.10 |
| af_A0A1D6PU20_39_318_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9833 | 7 | 253 | 3.90.230.10 |
| af_I1J6Q1_1_201_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9832 | 52 | 252 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6F1R4-F1-model_v4 | deleted | 1.001 | 40 | 252 |
|
| AF-A0A3C0LYD4-F1-model_v4 | deleted | 1 | 107 | 207 |
|
| AF-A0A3M3I911-F1-model_v4 | Methionine aminopeptidase (EC 3.4.11.18) | 0.9995 | 43 | 207 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-V6F6N4-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9983 | 8 | 253 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A6B0TU55-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9983 | 18 | 251 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar