F467150

General Info

Members Datasets Scaffolds Average Seq Length
592 257 504 320

Family's Representative Sequence

Representative Sequence 3300041407|Ga0439447_038365|Ga0439447_038365_52_1077
Length 341
Sequence MKMPMIRTGRWGVQFSDRWPGNLIGLMAIFLPCQAYALCEVVSTSPAGFGSMSSITVRTTSQPSSTTNAGLSCTGSLASSLASDDYFYATVTSSTSGLVGPTSDVIGYTLYANNSTSYPITRSVAFDFARNSIIDDLGLLSNPVVAKTVPIYLNTIIGSNVAAGIYSETLSIFWSWDYCYDRDGGGSCLGRDINSGSTSLTVNMSVANDCTITAPNISFGSAPAISAFATVTGQTINLVCTKGSAYTVGLDDGQHAVGVGGRRRMISGSNYLAYDIFKSAGTTRWGSVSTARRASTDAEVNPGNGLGTGSQIFNYNAKIYTDQSTPPPGTYLDSVVLDVGF

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231018 Pseudomonas sp. GM60 Isolate Nodule
5 2511231019 Pseudomonas sp. GM67 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231023 Pseudomonas sp. GM80 Isolate Nodule
8 2511231031 Pseudomonas sp. GM16 Isolate Nodule
9 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
10 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
11 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
12 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
13 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
14 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
15 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
16 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
17 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
18 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
19 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
20 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
21 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
22 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
23 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
24 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
25 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
26 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
27 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
28 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
29 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
30 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
31 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
32 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
33 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
34 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
35 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
36 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
37 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
38 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
39 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
40 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
41 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
42 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
43 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
44 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
45 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
46 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
47 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
48 2773857673 Pseudomonas sp. 443 Isolate Unclassified
49 2784132063 Pseudomonas sp. 424 Isolate Unclassified
50 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
51 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
52 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
53 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
54 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
55 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
56 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
57 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
58 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
59 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
60 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
61 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
62 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
63 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
64 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
65 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
66 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
67 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
68 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
69 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
70 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
71 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
72 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
73 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
74 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
75 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
76 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
77 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
78 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
79 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
80 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
81 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
82 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
83 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
84 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
85 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
86 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
91 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
93 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
120 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
156 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
157 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
160 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
161 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
162 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
163 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
164 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
165 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
170 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
245 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
246 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
247 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
248 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
249 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
250 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
251 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
252 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
253 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
254 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
255 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
256 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
257 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.14
Metatranscriptomes 0
Isolates 14.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 1.35
Rhizoplane 5.41
Rhizosphere 75.51
Stem 0
Stem Tuber 0
Unclassified 11.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000095 3300002737 Bacteria 98329
2 JGI25163J39215_1000303 3300002771 Bacteria 16649
3 JGI25164J39214_1000069 3300002772 Bacteria 103125
4 JGI25165J46597_1000168 3300003214 Bacteria 103125
5 Ga0055539_1000107 3300003752 Bacteria 91545
6 Ga0055533_1000116 3300003756 Bacteria 91545
7 Ga0055532_1000103 3300003758 Bacteria 91541
8 Ga0055525_1000160 3300003759 Bacteria 87810
9 Ga0055536_1000082 3300003781 Bacteria 81873
10 Ga0055530_10000124 3300003791 Bacteria 66816
11 Ga0055530_10000239 3300003791 Bacteria 49412
12 Ga0055540_1000244 3300003792 Bacteria 49750
13 Ga0055540_1000467 3300003792 Bacteria 31316
14 Ga0055531_10000221 3300003794 Bacteria 62838
15 Ga0055541_1000073 3300003841 Bacteria 91545
16 Ga0065714_10006234 3300005288 Bacteria 5537
17 Ga0065714_10064735 3300005288 Bacteria 20692
18 Ga0065714_10065878 3300005288 Bacteria 8211
19 Ga0065714_10066753 3300005288 Bacteria 6370
20 Ga0065714_10119062 3300005288 Bacteria 1371
21 Ga0065704_10070484 3300005289 Bacteria 22867
22 Ga0070669_100000957 3300005353 Bacteria 21077
23 Ga0070662_100002793 3300005457 Bacteria 10813
24 Ga0068853_100029609 3300005539 Bacteria 4618
25 Ga0070664_100126743 3300005564 Bacteria 2240
26 Ga0068854_100034790 3300005578 Bacteria 3522
27 Ga0068851_10000103 3300005834 Bacteria 45687
28 Ga0075432_10002626 3300006058 Bacteria 6006
29 Ga0105251_10000003 3300009011 Bacteria 311814
30 Ga0105251_10001158 3300009011 Bacteria 22899
31 Ga0105251_10001335 3300009011 Bacteria 21312
32 Ga0105251_10004183 3300009011 Bacteria 9993
33 Ga0105251_10029703 3300009011 Bacteria 2751
34 Ga0105251_10030569 3300009011 Bacteria 2703
35 Ga0105251_10031558 3300009011 Bacteria 2649
36 Ga0105244_10000692 3300009036 Bacteria 29284
37 Ga0105244_10001397 3300009036 Bacteria 19611
38 Ga0105244_10003294 3300009036 Bacteria 11630
39 Ga0105244_10003734 3300009036 Bacteria 10747
40 Ga0105244_10017111 3300009036 Bacteria 4108
41 Ga0105244_10026667 3300009036 Bacteria 3123
42 Ga0105244_10044131 3300009036 Bacteria 2298
43 Ga0105250_10000160 3300009092 Bacteria 57969
44 Ga0105250_10001022 3300009092 Bacteria 16151
45 Ga0105250_10001304 3300009092 Bacteria 13668
46 Ga0105250_10007663 3300009092 Bacteria 4628
47 Ga0105250_10013434 3300009092 Bacteria 3373
48 Ga0105250_10017065 3300009092 Bacteria 2951
49 Ga0105250_10019939 3300009092 Bacteria 2711
50 Ga0105250_10020195 3300009092 Bacteria 2693
51 Ga0105250_10102798 3300009092 Bacteria 1167
52 Ga0105243_10000258 3300009148 Bacteria 60821
53 Ga0105243_10006203 3300009148 Bacteria 9244
54 Ga0105243_10071415 3300009148 Bacteria 2807
55 Ga0105243_10077453 3300009148 Bacteria 2704
56 Ga0105249_10092704 3300009553 Bacteria 2828
57 Ga0105246_10000161 3300011119 Bacteria 32152
58 Ga0157345_1000020 3300012498 Bacteria 42602
59 Ga0157373_10001782 3300013100 Bacteria 16369
60 Ga0157373_10005057 3300013100 Bacteria 9906
61 Ga0157373_10006322 3300013100 Bacteria 8849
62 Ga0157373_10011964 3300013100 Bacteria 6375
63 Ga0157373_10015266 3300013100 Bacteria 5614
64 Ga0157373_10281495 3300013100 Bacteria 1179
65 Ga0157371_10001096 3300013102 Bacteria 29365
66 Ga0157371_10007617 3300013102 Bacteria 8733
67 Ga0157370_10017143 3300013104 Bacteria 7313
68 Ga0157370_10036975 3300013104 Bacteria 4736
69 Ga0157370_10060768 3300013104 Bacteria 3586
70 Ga0157369_10004566 3300013105 Bacteria 16275
71 Ga0163162_10000322 3300013306 Bacteria 44081
72 Ga0163162_10010691 3300013306 Bacteria 8927
73 Ga0163162_10554195 3300013306 Bacteria 1278
74 Ga0163162_10815957 3300013306 Bacteria 1050
75 Ga0157372_10002618 3300013307 Bacteria 19476
76 Ga0157372_10028727 3300013307 Bacteria 6071
77 Ga0157375_10001075 3300013308 Bacteria 23675
78 Ga0157375_10010741 3300013308 Bacteria 8070
79 Ga0182008_10001418 3300014497 Bacteria 16074
80 Ga0182008_10002330 3300014497 Bacteria 11961
81 Ga0182008_10003123 3300014497 Bacteria 10136
82 Ga0182006_1001031 3300015261 Bacteria 18153
83 Ga0182006_1027333 3300015261 Bacteria 2330
84 Ga0182007_10001888 3300015262 Bacteria 10932
85 Ga0182005_1000856 3300015265 Bacteria 13546
86 Ga0163161_10001094 3300017792 Bacteria 20507
87 Ga0163161_10001706 3300017792 Bacteria 16121
88 Ga0163161_10010704 3300017792 Bacteria 6352
89 Ga0163161_10013666 3300017792 Bacteria 5652
90 Ga0209435_106604 3300025206 Bacteria 1291
91 Ga0209760_100018 3300025207 Bacteria 172833
92 Ga0209784_100110 3300025224 Bacteria 91931
93 Ga0209566_100131 3300025225 Bacteria 91931
94 Ga0209674_100154 3300025226 Bacteria 91931
95 Ga0209147_100158 3300025229 Bacteria 91931
96 Ga0209563_100133 3300025230 Bacteria 91931
97 Ga0209563_102311 3300025230 Bacteria 4380
98 Ga0207427_100015 3300025231 Bacteria 542133
99 Ga0209437_100027 3300025233 Bacteria 542133
100 Ga0209258_100260 3300025242 Bacteria 91919
101 Ga0209646_1000454 3300025246 Bacteria 21498
102 Ga0209677_100100 3300025253 Bacteria 91931
103 Ga0209233_1000039 3300025261 Bacteria 542133
104 Ga0209676_1000002 3300025292 Bacteria 1732948
105 Ga0209676_1000017 3300025292 Bacteria 643409
106 Ga0209050_1000242 3300025298 Bacteria 118006
107 Ga0209050_1000371 3300025298 Bacteria 85791
108 Ga0209051_1000001 3300025303 Bacteria 1732974
109 Ga0209051_1000234 3300025303 Bacteria 92914
110 Ga0209257_1000167 3300025304 Bacteria 171342
111 Ga0207656_10000161 3300025321 Bacteria 24874
112 Ga0207696_1000023 3300025711 Bacteria 422195
113 Ga0207696_1000075 3300025711 Bacteria 210629
114 Ga0207696_1000147 3300025711 Bacteria 120603
115 Ga0207696_1002068 3300025711 Bacteria 10133
116 Ga0207696_1003248 3300025711 Bacteria 7498
117 Ga0207696_1003863 3300025711 Bacteria 6639
118 Ga0207696_1008580 3300025711 Bacteria 3888
119 Ga0207696_1011731 3300025711 Bacteria 3139
120 Ga0207696_1018874 3300025711 Bacteria 2256
121 Ga0207655_1000528 3300025728 Bacteria 48555
122 Ga0207655_1000536 3300025728 Bacteria 48096
123 Ga0207655_1002208 3300025728 Bacteria 16146
124 Ga0207655_1005354 3300025728 Bacteria 8754
125 Ga0207655_1010852 3300025728 Bacteria 5486
126 Ga0207655_1012818 3300025728 Bacteria 4859
127 Ga0207655_1032425 3300025728 Bacteria 2387
128 Ga0207655_1044714 3300025728 Bacteria 1858
129 Ga0207713_1000009 3300025735 Bacteria 551314
130 Ga0207713_1000870 3300025735 Bacteria 27610
131 Ga0207713_1001103 3300025735 Bacteria 23100
132 Ga0207713_1001848 3300025735 Bacteria 16132
133 Ga0207713_1002127 3300025735 Bacteria 14763
134 Ga0207713_1002273 3300025735 Bacteria 14155
135 Ga0207713_1013305 3300025735 Bacteria 4344
136 Ga0207713_1035508 3300025735 Bacteria 2151
137 Ga0207681_10022654 3300025923 Bacteria 4009
138 Ga0207706_10000566 3300025933 Bacteria 39267
139 Ga0207709_10000014 3300025935 Bacteria 526302
140 Ga0207709_10003534 3300025935 Bacteria 9244
141 Ga0207709_10044955 3300025935 Bacteria 2672
142 Ga0207679_10091026 3300025945 Bacteria 2360
143 Ga0207639_10019931 3300026041 Bacteria 4793
144 Ga0209371_1001433 3300027312 Bacteria 16248
145 Ga0268266_10077718 3300028379 Bacteria 2886
146 Ga0268256_1001221 3300030500 Bacteria 16248
147 Ga0307511_10063136 3300030521 Bacteria 2802
148 Ga0307510_10001978 3300033180 Bacteria 23077
149 Ga0439438_000436 3300041405 Bacteria 18989
150 Ga0439447_000052 3300041407 Bacteria 41434
151 Ga0439447_003512 3300041407 Bacteria 5562
152 Ga0439447_005377 3300041407 Bacteria 4266
153 Ga0439447_038365 3300041407 Bacteria 1177
154 Ga0439466_0000139 3300041411 Bacteria 28756
155 Ga0439466_0004872 3300041411 Bacteria 5160
156 Ga0439466_0071442 3300041411 Bacteria 1104
157 Ga0439465_0036332 3300041413 Bacteria 1582
158 Ga0439432_009061 3300042006 Bacteria 3477
159 Ga0439432_035283 3300042006 Bacteria 1602
160 Ga0439451_003465 3300042009 Bacteria 3198
161 Ga0439452_000770 3300042010 Bacteria 15313
162 Ga0439452_003593 3300042010 Bacteria 5404
163 Ga0439452_005035 3300042010 Bacteria 4316
164 Ga0439456_006283 3300042013 Bacteria 2424
165 Ga0439463_000157 3300042016 Bacteria 17433
166 Ga0450911_000287 3300042115 Bacteria 18551
167 Ga0450919_000627 3300042121 Bacteria 4474
168 Ga0450922_001513 3300042124 Bacteria 2278
169 Ga0450890_001366 3300042127 Bacteria 3519
170 Ga0450903_007444 3300042138 Bacteria 1801
171 Ga0450903_020037 3300042138 Bacteria 1035
172 Ga0450906_002525 3300042145 Bacteria 3996
173 Ga0450907_001399 3300042146 Bacteria 5273
174 Ga0450907_016220 3300042146 Bacteria 1243
175 Ga0439446_0006912 3300042156 Bacteria 2971
176 Ga0450909_000079 3300042185 Bacteria 8864
177 Ga0439464_0007176 3300042439 Bacteria 2912
178 Ga0450893_0008695 3300042532 Bacteria 1654
179 Ga0439440_0005021 3300042993 Bacteria 2612
180 Ga0439440_0005718 3300042993 Bacteria 2475
181 Ga0495617_007818 3300046452 Bacteria 3700
182 Ga0495617_020081 3300046452 Bacteria 2257
183 Ga0495617_024544 3300046452 Bacteria 2034
184 Ga0495617_054845 3300046452 Bacteria 1323
185 Ga0495627_000416 3300046453 Bacteria 37635
186 Ga0495627_001073 3300046453 Bacteria 17997
187 Ga0495627_001331 3300046453 Bacteria 15035
188 Ga0495627_001416 3300046453 Bacteria 14126
189 Ga0495627_034666 3300046453 Bacteria 1576
190 Ga0495592_0167031 3300046454 Bacteria 1509
191 Ga0495590_0000889 3300046457 Bacteria 13399
192 Ga0495591_000008 3300046458 Bacteria 353558
193 Ga0495591_000304 3300046458 Bacteria 45011
194 Ga0495591_000386 3300046458 Bacteria 37363
195 Ga0495591_001748 3300046458 Bacteria 12944
196 Ga0495591_002807 3300046458 Bacteria 9387
197 Ga0495591_003912 3300046458 Bacteria 7507
198 Ga0495591_007619 3300046458 Bacteria 4570
199 Ga0495638_0001009 3300046460 Bacteria 28092
200 Ga0495638_0027191 3300046460 Bacteria 3704
201 Ga0495638_0093958 3300046460 Bacteria 1802
202 Ga0495638_0141242 3300046460 Bacteria 1405
203 Ga0495638_0186303 3300046460 Bacteria 1180
204 Ga0495653_0002377 3300046463 Bacteria 14966
205 Ga0495653_0083081 3300046463 Bacteria 2362
206 Ga0495650_0001880 3300046471 Bacteria 18697
207 Ga0495650_0012408 3300046471 Bacteria 4585
208 Ga0495650_0012757 3300046471 Bacteria 4498
209 Ga0495650_0014259 3300046471 Bacteria 4147
210 Ga0495650_0067377 3300046471 Bacteria 1414
211 Ga0495605_0000506 3300046474 Bacteria 33459
212 Ga0495605_0000868 3300046474 Bacteria 20936
213 Ga0495605_0016968 3300046474 Bacteria 3932
214 Ga0495605_0029793 3300046474 Bacteria 2804
215 Ga0495605_0068309 3300046474 Bacteria 1684
216 Ga0495584_0001134 3300046491 Bacteria 16486
217 Ga0495584_0006019 3300046491 Bacteria 6389
218 Ga0495584_0013826 3300046491 Bacteria 4114
219 Ga0495584_0118203 3300046491 Bacteria 1342
220 Ga0495584_0125580 3300046491 Bacteria 1300
221 Ga0495585_0000634 3300046492 Bacteria 32431
222 Ga0495585_0001035 3300046492 Bacteria 23112
223 Ga0495585_0004247 3300046492 Bacteria 9337
224 Ga0495585_0004463 3300046492 Bacteria 9071
225 Ga0495585_0045337 3300046492 Bacteria 2454
226 Ga0495585_0046861 3300046492 Bacteria 2409
227 Ga0495585_0058553 3300046492 Bacteria 2125
228 Ga0495596_0000005 3300046500 Bacteria 163644
229 Ga0495596_0008642 3300046500 Bacteria 4519
230 Ga0495596_0028892 3300046500 Bacteria 2224
231 Ga0495607_0001664 3300046501 Bacteria 19233
232 Ga0495607_0002482 3300046501 Bacteria 14981
233 Ga0495607_0006109 3300046501 Bacteria 8519
234 Ga0495607_0041289 3300046501 Bacteria 2741
235 Ga0495607_0053665 3300046501 Bacteria 2327
236 Ga0495607_0057469 3300046501 Bacteria 2229
237 Ga0495607_0063764 3300046501 Bacteria 2083
238 Ga0495583_0001210 3300046506 Bacteria 27537
239 Ga0495583_0002470 3300046506 Bacteria 15744
240 Ga0495606_0000151 3300046507 Bacteria 119548
241 Ga0495606_0003686 3300046507 Bacteria 16022
242 Ga0495606_0004634 3300046507 Bacteria 13605
243 Ga0495606_0008965 3300046507 Bacteria 8559
244 Ga0495606_0040402 3300046507 Bacteria 3135
245 Ga0495606_0076095 3300046507 Bacteria 2099
246 Ga0495610_0000727 3300046512 Bacteria 31278
247 Ga0495610_0000803 3300046512 Bacteria 29467
248 Ga0495610_0001563 3300046512 Bacteria 20169
249 Ga0495610_0025565 3300046512 Bacteria 3165
250 Ga0495610_0028161 3300046512 Bacteria 2975
251 Ga0495610_0037336 3300046512 Bacteria 2473
252 Ga0495610_0140806 3300046512 Bacteria 1038
253 Ga0495616_0000305 3300046513 Bacteria 39363
254 Ga0495616_0010932 3300046513 Bacteria 5226
255 Ga0495616_0084276 3300046513 Bacteria 1515
256 Ga0495620_0000004 3300046515 Bacteria 344148
257 Ga0495620_0000195 3300046515 Bacteria 46532
258 Ga0495620_0019000 3300046515 Bacteria 3392
259 Ga0495620_0019019 3300046515 Bacteria 3389
260 Ga0495620_0020435 3300046515 Bacteria 3233
261 Ga0495620_0092206 3300046515 Bacteria 1214
262 Ga0495630_0006519 3300046517 Bacteria 8312
263 Ga0495631_0001016 3300046518 Bacteria 17424
264 Ga0495631_0003563 3300046518 Bacteria 8508
265 Ga0495631_0022687 3300046518 Bacteria 2917
266 Ga0495631_0064531 3300046518 Bacteria 1585
267 Ga0495631_0170430 3300046518 Bacteria 933
268 Ga0495632_0000257 3300046519 Bacteria 52817
269 Ga0495632_0001973 3300046519 Bacteria 16301
270 Ga0495632_0004092 3300046519 Bacteria 10058
271 Ga0495632_0004180 3300046519 Bacteria 9883
272 Ga0495632_0005501 3300046519 Bacteria 8359
273 Ga0495632_0014228 3300046519 Bacteria 4509
274 Ga0495632_0024563 3300046519 Bacteria 3198
275 Ga0495632_0084305 3300046519 Bacteria 1512
276 Ga0495632_0092111 3300046519 Bacteria 1436
277 Ga0495637_0000584 3300046520 Bacteria 25967
278 Ga0495637_0000885 3300046520 Bacteria 19343
279 Ga0495637_0004189 3300046520 Bacteria 7488
280 Ga0495637_0005391 3300046520 Bacteria 6533
281 Ga0495637_0006084 3300046520 Bacteria 6086
282 Ga0495637_0008726 3300046520 Bacteria 4968
283 Ga0495637_0015240 3300046520 Bacteria 3607
284 Ga0495637_0046715 3300046520 Bacteria 1830
285 Ga0495637_0082450 3300046520 Bacteria 1280
286 Ga0495637_0096241 3300046520 Bacteria 1161
287 Ga0495643_0000772 3300046522 Bacteria 35775
288 Ga0495643_0000872 3300046522 Bacteria 32201
289 Ga0495643_0003871 3300046522 Bacteria 10765
290 Ga0495643_0008743 3300046522 Bacteria 6384
291 Ga0495643_0054261 3300046522 Bacteria 2146
292 Ga0495643_0103053 3300046522 Bacteria 1460
293 Ga0495644_0001042 3300046523 Bacteria 11548
294 Ga0495644_0004871 3300046523 Bacteria 5270
295 Ga0495644_0016490 3300046523 Bacteria 2827
296 Ga0495648_0000805 3300046524 Bacteria 33238
297 Ga0495648_0001936 3300046524 Bacteria 19720
298 Ga0495648_0005797 3300046524 Bacteria 10185
299 Ga0495648_0007377 3300046524 Bacteria 8807
300 Ga0495648_0008639 3300046524 Bacteria 7987
301 Ga0495648_0016469 3300046524 Bacteria 5331
302 Ga0495648_0016790 3300046524 Bacteria 5263
303 Ga0495648_0018390 3300046524 Bacteria 4947
304 Ga0495648_0033695 3300046524 Bacteria 3342
305 Ga0495648_0039386 3300046524 Bacteria 3008
306 Ga0495648_0063564 3300046524 Bacteria 2178
307 Ga0495648_0080308 3300046524 Bacteria 1858
308 Ga0495654_0000541 3300046530 Bacteria 30486
309 Ga0495654_0000762 3300046530 Bacteria 24922
310 Ga0495654_0002413 3300046530 Bacteria 12050
311 Ga0495654_0003048 3300046530 Bacteria 10433
312 Ga0495654_0004426 3300046530 Bacteria 8337
313 Ga0495654_0019856 3300046530 Bacteria 3508
314 Ga0495654_0062177 3300046530 Bacteria 1790
315 Ga0495654_0065538 3300046530 Bacteria 1733
316 Ga0495654_0100290 3300046530 Bacteria 1333
317 Ga0495609_0001455 3300046538 Bacteria 15706
318 Ga0495609_0001524 3300046538 Bacteria 15257
319 Ga0495609_0008922 3300046538 Bacteria 4877
320 Ga0495609_0041508 3300046538 Bacteria 2067
321 Ga0495609_0088268 3300046538 Bacteria 1350
322 Ga0495597_0002187 3300046542 Bacteria 12846
323 Ga0495597_0002953 3300046542 Bacteria 10312
324 Ga0495597_0003902 3300046542 Bacteria 8424
325 Ga0495597_0006552 3300046542 Bacteria 6007
326 Ga0495597_0010434 3300046542 Bacteria 4542
327 Ga0495597_0017454 3300046542 Bacteria 3378
328 Ga0495597_0034630 3300046542 Bacteria 2282
329 Ga0495597_0059581 3300046542 Bacteria 1666
330 Ga0495597_0075474 3300046542 Bacteria 1447
331 Ga0495645_0091171 3300046543 Bacteria 2177
332 Ga0495622_0064456 3300046557 Bacteria 1694
333 Ga0495622_0079862 3300046557 Bacteria 1505
334 Ga0495633_0005177 3300046558 Bacteria 8062
335 Ga0495633_0011038 3300046558 Bacteria 4901
336 Ga0495633_0097425 3300046558 Bacteria 1366
337 Ga0495656_0014700 3300046615 Bacteria 2940
338 Ga0495668_0001233 3300046616 Bacteria 25707
339 Ga0495668_0001554 3300046616 Bacteria 21767
340 Ga0495634_0031140 3300046642 Bacteria 3676
341 Ga0495611_0000125 3300046648 Bacteria 53878
342 Ga0495611_0035156 3300046648 Bacteria 2218
343 Ga0495611_0047687 3300046648 Bacteria 1923
344 Ga0495611_0087113 3300046648 Bacteria 1441
345 Ga0495625_0001657 3300046660 Bacteria 26120
346 Ga0495625_0002467 3300046660 Bacteria 19993
347 Ga0495625_0012019 3300046660 Bacteria 7026
348 Ga0495625_0017326 3300046660 Bacteria 5642
349 Ga0495625_0039319 3300046660 Bacteria 3455
350 Ga0495625_0059680 3300046660 Bacteria 2705
351 Ga0495625_0154247 3300046660 Bacteria 1542
352 Ga0495661_0002265 3300046665 Bacteria 14884
353 Ga0495661_0012701 3300046665 Bacteria 5684
354 Ga0495661_0025509 3300046665 Bacteria 3816
355 Ga0495661_0029007 3300046665 Bacteria 3535
356 Ga0495661_0053769 3300046665 Bacteria 2420
357 Ga0495661_0070721 3300046665 Bacteria 2041
358 Ga0495661_0077655 3300046665 Bacteria 1923
359 Ga0495646_0145358 3300046680 Bacteria 1322
360 Ga0495613_0017991 3300046689 Bacteria 5267
361 Ga0495613_0088387 3300046689 Bacteria 2245
362 Ga0495624_0001502 3300046690 Bacteria 18056
363 Ga0495624_0050551 3300046690 Bacteria 2633
364 Ga0495670_0000483 3300046691 Bacteria 18876
365 Ga0495670_0011857 3300046691 Bacteria 4290
366 Ga0495671_0001423 3300046692 Bacteria 16090
367 Ga0495671_0015937 3300046692 Bacteria 4022
368 Ga0495671_0016797 3300046692 Bacteria 3902
369 Ga0495671_0017261 3300046692 Bacteria 3842
370 Ga0495671_0040208 3300046692 Bacteria 2358
371 Ga0495649_0001843 3300046694 Bacteria 15542
372 Ga0495649_0002199 3300046694 Bacteria 13927
373 Ga0495649_0014965 3300046694 Bacteria 4430
374 Ga0495649_0044422 3300046694 Bacteria 2426
375 Ga0495649_0050372 3300046694 Bacteria 2260
376 Ga0495649_0073946 3300046694 Bacteria 1825
377 Ga0495649_0090703 3300046694 Bacteria 1629
378 Ga0495649_0113443 3300046694 Bacteria 1436
379 Ga0495589_0001834 3300046794 Bacteria 12062
380 Ga0495589_0003110 3300046794 Bacteria 9080
381 Ga0495589_0004094 3300046794 Bacteria 7806
382 Ga0495589_0009111 3300046794 Bacteria 5159
383 Ga0495589_0025512 3300046794 Bacteria 2999
384 Ga0495589_0035860 3300046794 Bacteria 2486
385 Ga0495600_0009737 3300046809 Bacteria 5940
386 Ga0495660_0000704 3300046810 Bacteria 25660
387 Ga0495660_0001292 3300046810 Bacteria 17331
388 Ga0495660_0004668 3300046810 Bacteria 8270
389 Ga0495660_0004973 3300046810 Bacteria 8001
390 Ga0495660_0006842 3300046810 Bacteria 6714
391 Ga0495660_0006966 3300046810 Bacteria 6661
392 Ga0495660_0017899 3300046810 Bacteria 4075
393 Ga0495660_0058642 3300046810 Bacteria 2072
394 Ga0495660_0059120 3300046810 Bacteria 2062
395 Ga0495604_0030910 3300047317 Bacteria 4249
396 Ga0495604_0040267 3300047317 Bacteria 3670
397 Ga0495672_0000261 3300047320 Bacteria 73207
398 Ga0495672_0002321 3300047320 Bacteria 17641
399 Ga0495672_0002829 3300047320 Bacteria 15442
400 Ga0495672_0003744 3300047320 Bacteria 12824
401 Ga0495672_0041509 3300047320 Bacteria 2781
402 Ga0495676_0000534 3300047321 Bacteria 31124
403 Ga0495676_0043025 3300047321 Bacteria 3700
404 Ga0495680_0091817 3300047322 Bacteria 2275
405 Ga0495683_0005492 3300047323 Bacteria 7026
406 Ga0495683_0008190 3300047323 Bacteria 5607
407 Ga0495683_0018744 3300047323 Bacteria 3576
408 Ga0495683_0030673 3300047323 Bacteria 2742
409 Ga0495683_0037568 3300047323 Bacteria 2454
410 Ga0495683_0147642 3300047323 Bacteria 1097
411 Ga0495679_000353 3300047446 Bacteria 35879
412 Ga0495679_001241 3300047446 Bacteria 15133
413 Ga0495679_001477 3300047446 Bacteria 13301
414 Ga0495679_002152 3300047446 Bacteria 10347
415 Ga0495679_004540 3300047446 Bacteria 6363
416 Ga0495679_004732 3300047446 Bacteria 6180
417 Ga0495679_005963 3300047446 Bacteria 5329
418 Ga0495673_0001095 3300047469 Bacteria 23462
419 Ga0495673_0004049 3300047469 Bacteria 9341
420 Ga0495673_0005684 3300047469 Bacteria 7493
421 Ga0495673_0006172 3300047469 Bacteria 7096
422 Ga0495673_0014565 3300047469 Bacteria 4085
423 Ga0495673_0019131 3300047469 Bacteria 3436
424 Ga0495673_0019700 3300047469 Bacteria 3376
425 Ga0495673_0040011 3300047469 Bacteria 2122
426 Ga0495673_0044654 3300047469 Bacteria 1975
427 Ga0495673_0059418 3300047469 Bacteria 1643
428 Ga0495681_0000134 3300047470 Bacteria 63782
429 Ga0495681_0000627 3300047470 Bacteria 26913
430 Ga0495681_0001761 3300047470 Bacteria 15954
431 Ga0495681_0002828 3300047470 Bacteria 12267
432 Ga0495681_0005151 3300047470 Bacteria 8800
433 Ga0495681_0037864 3300047470 Bacteria 2370
434 Ga0495681_0054032 3300047470 Bacteria 1878
435 Ga0495684_0018655 3300047471 Bacteria 5345
436 Ga0495686_0002026 3300047472 Bacteria 19990
437 Ga0495686_0003274 3300047472 Bacteria 14169
438 Ga0495686_0015626 3300047472 Bacteria 5176
439 Ga0495602_0003788 3300048088 Bacteria 15723
440 Ga0495626_0000040 3300048091 Bacteria 172784
441 Ga0495626_0000584 3300048091 Bacteria 36132
442 Ga0495626_0000833 3300048091 Bacteria 27661
443 Ga0495626_0007715 3300048091 Bacteria 5963
444 Ga0495626_0008747 3300048091 Bacteria 5511
445 Ga0495626_0009253 3300048091 Bacteria 5331
446 Ga0495626_0010156 3300048091 Bacteria 5050
447 Ga0495626_0038199 3300048091 Bacteria 2277
448 Ga0495626_0049007 3300048091 Bacteria 1957
449 Ga0495626_0133406 3300048091 Bacteria 1058
450 Ga0496102_0035552 3300048905 Bacteria 4485
451 Ga0496110_0188761 3300048913 Bacteria 1872
452 Ga0496114_0013404 3300048917 Bacteria 6572
453 Ga0496116_0000514 3300048919 Bacteria 52327
454 Ga0496116_0001103 3300048919 Bacteria 32356
455 Ga0496116_0003657 3300048919 Bacteria 15096
456 Ga0496116_0005493 3300048919 Bacteria 11726
457 Ga0496117_0000916 3300048920 Bacteria 45120
458 Ga0496117_0001404 3300048920 Bacteria 34972
459 Ga0496117_0001529 3300048920 Bacteria 33047
460 Ga0496117_0004246 3300048920 Bacteria 15994
461 Ga0496117_0004562 3300048920 Bacteria 15166
462 Ga0496117_0021786 3300048920 Bacteria 5170
463 Ga0496117_0035624 3300048920 Bacteria 3733
464 Ga0496117_0102706 3300048920 Bacteria 1803
465 Ga0496117_0147263 3300048920 Bacteria 1399
466 Ga0496118_0003330 3300048921 Bacteria 20329
467 Ga0496118_0005213 3300048921 Bacteria 14867
468 Ga0496118_0009033 3300048921 Bacteria 10161
469 Ga0496118_0109560 3300048921 Bacteria 1837
470 Ga0496119_0000046 3300048922 Bacteria 190003
471 Ga0496119_0023530 3300048922 Bacteria 4363
472 Ga0496119_0119673 3300048922 Bacteria 1449
473 Ga0496120_0000485 3300048923 Bacteria 62083
474 Ga0496120_0021218 3300048923 Bacteria 4108
475 Ga0496120_0023345 3300048923 Bacteria 3872
476 Ga0496121_0000955 3300048924 Bacteria 52253
477 Ga0496121_0006324 3300048924 Bacteria 14771
478 Ga0496121_0212191 3300048924 Bacteria 1370
479 Ga0496122_0002553 3300048925 Bacteria 25577
480 Ga0496122_0005026 3300048925 Bacteria 15997
481 Ga0496122_0026547 3300048925 Bacteria 4987
482 Ga0496122_0155245 3300048925 Bacteria 1405
483 Ga0496123_0000779 3300048926 Bacteria 51646
484 Ga0496123_0001630 3300048926 Bacteria 30236
485 Ga0496123_0038896 3300048926 Bacteria 3335
486 Ga0496123_0059801 3300048926 Bacteria 2460
487 Ga0496123_0137009 3300048926 Bacteria 1345
488 Ga0496124_0001162 3300048927 Bacteria 41251
489 Ga0496124_0020627 3300048927 Bacteria 6083
490 Ga0496124_0185164 3300048927 Bacteria 1598
491 Ga0496124_0253290 3300048927 Bacteria 1300
492 Ga0496125_0000613 3300048928 Bacteria 60403
493 Ga0496125_0019058 3300048928 Bacteria 6491
494 Ga0496125_0131643 3300048928 Bacteria 1759
495 Ga0496126_0310661 3300048929 Bacteria 1298
496 Ga0495678_002005 3300049459 Bacteria 14612
497 Ga0495678_002092 3300049459 Bacteria 14166
498 Ga0495678_003467 3300049459 Bacteria 9764
499 Ga0495678_013902 3300049459 Bacteria 3762
500 Ga0495678_015621 3300049459 Bacteria 3489
501 Ga0495678_023640 3300049459 Bacteria 2667
502 Ga0495682_0000468 3300049460 Bacteria 27907
503 Ga0500572_000960 3300053111 Bacteria 8730
504 Ga0500634_0000719 3300053161 Bacteria 11396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10001075 Ga0157375_100010756 260
2 3300046512 Ga0495610_0140806 Ga0495610_0140806_40_837 263
3 3300013307 Ga0157372_10028727 Ga0157372_100287277 279
4 3300048922 Ga0496119_0000046 Ga0496119_0000046_109890_110780 279
5 3300048923 Ga0496120_0000485 Ga0496120_0000485_40168_41058 279
6 3300009011 Ga0105251_10000003 Ga0105251_10000003247 280
7 3300046694 Ga0495649_0073946 Ga0495649_0073946_39_893 284
8 3300025735 Ga0207713_1000009 Ga0207713_100000942 285
9 3300009092 Ga0105250_10013434 Ga0105250_100134342 289
10 3300025711 Ga0207696_1018874 Ga0207696_10188742 289
11 3300046518 Ga0495631_0170430 Ga0495631_0170430_40_909 289
12 3300046515 Ga0495620_0019000 Ga0495620_0019000_1002_1988 290
13 3300048091 Ga0495626_0133406 Ga0495626_0133406_13_885 290
14 3300046491 Ga0495584_0125580 Ga0495584_0125580_390_1274 294
15 3300027312 Ga0209371_1001433 Ga0209371_10014335 295
16 3300030500 Ga0268256_1001221 Ga0268256_100122113 295
17 3300046513 Ga0495616_0010932 Ga0495616_0010932_39_941 300
18 iso_pu_bacteria 2842826826 2842828244 301
19 iso_pu_bacteria 2842837860 2842841158 301
20 3300048927 Ga0496124_0020627 Ga0496124_0020627_137_1126 302
21 3300005289 Ga0065704_10070484 Ga0065704_100704846 303
22 3300009092 Ga0105250_10102798 Ga0105250_101027981 303
23 3300009148 Ga0105243_10071415 Ga0105243_100714152 303
24 3300009148 Ga0105243_10077453 Ga0105243_100774532 303
25 3300025711 Ga0207696_1000023 Ga0207696_1000023250 303
26 3300025728 Ga0207655_1032425 Ga0207655_10324252 303
27 3300025735 Ga0207713_1013305 Ga0207713_10133052 303
28 3300025735 Ga0207713_1035508 Ga0207713_10355082 303
29 3300025935 Ga0207709_10044955 Ga0207709_100449552 303
30 3300046515 Ga0495620_0000004 Ga0495620_0000004_121087_122055 303
31 3300046519 Ga0495632_0000257 Ga0495632_0000257_23290_24258 303
32 3300046522 Ga0495643_0000872 Ga0495643_0000872_6216_7184 303
33 3300046524 Ga0495648_0000805 Ga0495648_0000805_1318_2286 303
34 3300048920 Ga0496117_0000916 Ga0496117_0000916_21724_22692 303
35 3300048920 Ga0496117_0001529 Ga0496117_0001529_9031_9999 303
36 3300048921 Ga0496118_0003330 Ga0496118_0003330_9100_10068 303
37 3300048928 Ga0496125_0000613 Ga0496125_0000613_36572_37540 303
38 3300013104 Ga0157370_10036975 Ga0157370_100369755 304
39 3300025711 Ga0207696_1008580 Ga0207696_10085802 304
40 3300025728 Ga0207655_1000528 Ga0207655_100052824 304
41 3300025735 Ga0207713_1001103 Ga0207713_10011039 304
42 3300042138 Ga0450903_020037 Ga0450903_020037_16_936 304
43 3300046522 Ga0495643_0000772 Ga0495643_0000772_6967_7935 304
44 3300009011 Ga0105251_10030569 Ga0105251_100305692 306
45 3300009036 Ga0105244_10000692 Ga0105244_100006928 306
46 3300009092 Ga0105250_10019939 Ga0105250_100199392 306
47 3300009092 Ga0105250_10020195 Ga0105250_100201952 306
48 3300025711 Ga0207696_1003863 Ga0207696_10038635 306
49 3300046507 Ga0495606_0000151 Ga0495606_0000151_57831_58802 306
50 3300046518 Ga0495631_0003563 Ga0495631_0003563_6791_7792 306
51 3300046557 Ga0495622_0064456 Ga0495622_0064456_437_1357 306
52 3300047446 Ga0495679_000353 Ga0495679_000353_30335_31336 306
53 3300048917 Ga0496114_0013404 Ga0496114_0013404_1646_2620 306
54 3300048920 Ga0496117_0004562 Ga0496117_0004562_9949_10923 306
55 3300048925 Ga0496122_0005026 Ga0496122_0005026_24_998 306
56 3300048926 Ga0496123_0000779 Ga0496123_0000779_37787_38761 306
57 3300048927 Ga0496124_0001162 Ga0496124_0001162_20122_21096 306
58 3300046506 Ga0495583_0001210 Ga0495583_0001210_19004_19951 309
59 3300046530 Ga0495654_0000762 Ga0495654_0000762_14244_15191 309
60 iso_pu_bacteria 3007419365 3007421525 309
61 3300046458 Ga0495591_000304 Ga0495591_000304_29129_30061 310
62 3300046474 Ga0495605_0000506 Ga0495605_0000506_3814_4755 310
63 3300046520 Ga0495637_0000885 Ga0495637_0000885_7828_8796 310
64 3300046660 Ga0495625_0001657 Ga0495625_0001657_15895_16827 310
65 3300046665 Ga0495661_0012701 Ga0495661_0012701_723_1664 310
66 3300046694 Ga0495649_0001843 Ga0495649_0001843_4327_5259 310
67 3300046694 Ga0495649_0090703 Ga0495649_0090703_521_1456 310
68 3300047446 Ga0495679_001241 Ga0495679_001241_9272_10204 310
69 3300046518 Ga0495631_0064531 Ga0495631_0064531_130_1065 311
70 3300046519 Ga0495632_0014228 Ga0495632_0014228_486_1421 311
71 3300046660 Ga0495625_0017326 Ga0495625_0017326_3572_4507 311
72 3300048091 Ga0495626_0010156 Ga0495626_0010156_3232_4167 311
73 3300048925 Ga0496122_0155245 Ga0496122_0155245_105_1046 311
74 3300048926 Ga0496123_0137009 Ga0496123_0137009_378_1319 311
75 3300049459 Ga0495678_023640 Ga0495678_023640_814_1749 311
76 3300009092 Ga0105250_10000160 Ga0105250_1000016050 312
77 3300013306 Ga0163162_10815957 Ga0163162_108159571 312
78 3300025711 Ga0207696_1000075 Ga0207696_100007551 312
79 3300048926 Ga0496123_0059801 Ga0496123_0059801_1500_2438 312
80 3300003781 Ga0055536_1000082 Ga0055536_100008244 313
81 3300003791 Ga0055530_10000124 Ga0055530_1000012432 313
82 3300003792 Ga0055540_1000467 Ga0055540_10004673 313
83 3300025292 Ga0209676_1000017 Ga0209676_1000017259 313
84 3300025298 Ga0209050_1000371 Ga0209050_100037129 313
85 3300025303 Ga0209051_1000234 Ga0209051_100023430 313
86 3300042993 Ga0439440_0005718 Ga0439440_0005718_626_1615 313
87 3300046558 Ga0495633_0011038 Ga0495633_0011038_1382_2323 313
88 3300047320 Ga0495672_0002829 Ga0495672_0002829_9139_10080 313
89 iso_pu_bacteria 3007872151 3007875072 313
90 iso_pu_bacteria 3007803356 3007807884 314
91 3300041405 Ga0439438_000436 Ga0439438_000436_2469_3416 315
92 3300041407 Ga0439447_003512 Ga0439447_003512_544_1491 315
93 3300041413 Ga0439465_0036332 Ga0439465_0036332_600_1547 315
94 3300042006 Ga0439432_035283 Ga0439432_035283_204_1151 315
95 3300042009 Ga0439451_003465 Ga0439451_003465_2015_2962 315
96 3300042115 Ga0450911_000287 Ga0450911_000287_9313_10260 315
97 3300042121 Ga0450919_000627 Ga0450919_000627_617_1564 315
98 3300042124 Ga0450922_001513 Ga0450922_001513_109_1056 315
99 3300042138 Ga0450903_007444 Ga0450903_007444_203_1150 315
100 3300042145 Ga0450906_002525 Ga0450906_002525_352_1299 315
101 3300042146 Ga0450907_001399 Ga0450907_001399_602_1549 315
102 3300042156 Ga0439446_0006912 Ga0439446_0006912_1498_2445 315
103 3300042185 Ga0450909_000079 Ga0450909_000079_132_1079 315
104 3300042439 Ga0439464_0007176 Ga0439464_0007176_22_969 315
105 3300042993 Ga0439440_0005021 Ga0439440_0005021_82_1029 315
106 3300046524 Ga0495648_0005797 Ga0495648_0005797_8857_9822 315
107 3300046558 Ga0495633_0097425 Ga0495633_0097425_144_1109 315
108 3300046665 Ga0495661_0002265 Ga0495661_0002265_4696_5661 315
109 3300048905 Ga0496102_0035552 Ga0496102_0035552_3433_4404 315
110 3300053161 Ga0500634_0000719 Ga0500634_0000719_833_1798 315
111 iso_pu_bacteria 2675903420 2677900670 315
112 iso_pu_bacteria 8055878733 8055881104 315
113 3300046512 Ga0495610_0000803 Ga0495610_0000803_8287_9240 316
114 3300046530 Ga0495654_0003048 Ga0495654_0003048_860_1813 316
115 iso_pu_bacteria 2511231021 2511356824 316
116 iso_pu_bacteria 2919155634 2919156927 316
117 3300046518 Ga0495631_0001016 Ga0495631_0001016_9611_10582 317
118 3300046538 Ga0495609_0008922 Ga0495609_0008922_2964_3935 317
119 3300047469 Ga0495673_0005684 Ga0495673_0005684_5273_6244 317
120 3300048091 Ga0495626_0049007 Ga0495626_0049007_278_1249 317
121 iso_pu_bacteria 3007614139 3007618682 317
122 3300009036 Ga0105244_10003734 Ga0105244_100037344 318
123 3300025711 Ga0207696_1011731 Ga0207696_10117312 318
124 3300046452 Ga0495617_054845 Ga0495617_054845_332_1288 318
125 3300046474 Ga0495605_0029793 Ga0495605_0029793_121_1077 318
126 3300046524 Ga0495648_0016469 Ga0495648_0016469_86_1042 318
127 3300046648 Ga0495611_0087113 Ga0495611_0087113_51_1007 318
128 3300046794 Ga0495589_0035860 Ga0495589_0035860_1456_2412 318
129 3300046810 Ga0495660_0004973 Ga0495660_0004973_1566_2522 318
130 3300047469 Ga0495673_0044654 Ga0495673_0044654_95_1051 318
131 3300048929 Ga0496126_0310661 Ga0496126_0310661_27_995 318
132 iso_pu_bacteria 2599185167 2599397796 318
133 iso_pu_bacteria 2599185179 2599452242 318
134 iso_pu_bacteria 2599185190 2599513379 318
135 iso_pu_bacteria 2599185191 2599518122 318
136 iso_pu_bacteria 2599185290 2599892056 318
137 iso_pu_bacteria 2808606445 2809214265 318
138 iso_pu_bacteria 2834028612 2834032786 318
139 iso_pu_bacteria 2931390751 2931393252 318
140 iso_pu_bacteria 8054503363 8054506979 318
141 3300009036 Ga0105244_10017111 Ga0105244_100171112 319
142 3300013102 Ga0157371_10007617 Ga0157371_100076172 319
143 3300013306 Ga0163162_10010691 Ga0163162_100106919 319
144 3300013308 Ga0157375_10010741 Ga0157375_100107418 319
145 3300042127 Ga0450890_001366 Ga0450890_001366_190_1149 319
146 3300047446 Ga0495679_001477 Ga0495679_001477_3443_4420 319
147 3300048924 Ga0496121_0212191 Ga0496121_0212191_340_1305 319
148 iso_pu_bacteria 2511231010 2511288258 319
149 iso_pu_bacteria 2511231011 2511293511 319
150 iso_pu_bacteria 2511231018 2511338659 319
151 iso_pu_bacteria 2511231019 2511344630 319
152 iso_pu_bacteria 2511231023 2511369381 319
153 iso_pu_bacteria 2511231031 2511415055 319
154 iso_pu_bacteria 2597489889 2597870431 319
155 iso_pu_bacteria 2599185189 2599506825 319
156 iso_pu_bacteria 2600255296 2601690085 319
157 iso_pu_bacteria 2600255318 2601797290 319
158 iso_pu_bacteria 2603880185 2606075979 319
159 iso_pu_bacteria 2603880199 2606130732 319
160 iso_pu_bacteria 2623620443 2624481552 319
161 iso_pu_bacteria 2713897149 2715756084 319
162 iso_pu_bacteria 2721755607 2723249404 319
163 iso_pu_bacteria 2738543025 2739313640 319
164 iso_pu_bacteria 2773857673 2774135143 319
165 iso_pu_bacteria 2784132063 2784265216 319
166 iso_pu_bacteria 2818991456 2819657660 319
167 iso_pu_bacteria 2878029506 2878033541 319
168 iso_pu_bacteria 2880230671 2880232747 319
169 iso_pu_bacteria 2919063839 2919069237 319
170 iso_pu_bacteria 2969304461 2969308305 319
171 iso_pu_bacteria 3007619802 3007621012 319
172 iso_pu_bacteria 3007718800 3007724292 319
173 iso_pu_bacteria 8054347763 8054348965 319
174 iso_pu_bacteria 8056148874 8056154399 319
175 iso_pu_bacteria 8056172158 8056173602 319
176 iso_pu_bacteria 8056177738 8056183808 319
177 3300006058 Ga0075432_10002626 Ga0075432_100026262 320
178 3300013104 Ga0157370_10017143 Ga0157370_100171432 320
179 3300042532 Ga0450893_0008695 Ga0450893_0008695_139_1101 320
180 3300046453 Ga0495627_001331 Ga0495627_001331_13291_14253 320
181 3300046457 Ga0495590_0000889 Ga0495590_0000889_410_1372 320
182 3300046458 Ga0495591_000008 Ga0495591_000008_172833_173795 320
183 3300046471 Ga0495650_0001880 Ga0495650_0001880_3004_3966 320
184 3300046474 Ga0495605_0016968 Ga0495605_0016968_410_1372 320
185 3300046492 Ga0495585_0045337 Ga0495585_0045337_201_1163 320
186 3300046500 Ga0495596_0000005 Ga0495596_0000005_83492_84454 320
187 3300046501 Ga0495607_0006109 Ga0495607_0006109_4747_5709 320
188 3300046518 Ga0495631_0022687 Ga0495631_0022687_1502_2464 320
189 3300046520 Ga0495637_0015240 Ga0495637_0015240_1909_2871 320
190 3300046522 Ga0495643_0054261 Ga0495643_0054261_213_1175 320
191 3300046523 Ga0495644_0004871 Ga0495644_0004871_223_1185 320
192 3300046523 Ga0495644_0016490 Ga0495644_0016490_1698_2660 320
193 3300046524 Ga0495648_0016790 Ga0495648_0016790_1100_2062 320
194 3300046524 Ga0495648_0063564 Ga0495648_0063564_403_1365 320
195 3300046530 Ga0495654_0002413 Ga0495654_0002413_2306_3268 320
196 3300046530 Ga0495654_0019856 Ga0495654_0019856_1632_2594 320
197 3300046542 Ga0495597_0003902 Ga0495597_0003902_1313_2275 320
198 3300046542 Ga0495597_0010434 Ga0495597_0010434_108_1070 320
199 3300046542 Ga0495597_0034630 Ga0495597_0034630_653_1615 320
200 3300046615 Ga0495656_0014700 Ga0495656_0014700_1358_2320 320
201 3300046616 Ga0495668_0001233 Ga0495668_0001233_3202_4164 320
202 3300046660 Ga0495625_0012019 Ga0495625_0012019_1897_2859 320
203 3300046660 Ga0495625_0039319 Ga0495625_0039319_1438_2400 320
204 3300046665 Ga0495661_0025509 Ga0495661_0025509_2069_3031 320
205 3300046691 Ga0495670_0011857 Ga0495670_0011857_267_1229 320
206 3300046692 Ga0495671_0017261 Ga0495671_0017261_1909_2871 320
207 3300046794 Ga0495589_0004094 Ga0495589_0004094_4105_5067 320
208 3300046794 Ga0495589_0025512 Ga0495589_0025512_334_1296 320
209 3300046810 Ga0495660_0006966 Ga0495660_0006966_4969_5931 320
210 3300047320 Ga0495672_0000261 Ga0495672_0000261_29121_30083 320
211 3300047320 Ga0495672_0003744 Ga0495672_0003744_6908_7870 320
212 3300047323 Ga0495683_0008190 Ga0495683_0008190_4105_5067 320
213 3300047323 Ga0495683_0037568 Ga0495683_0037568_563_1525 320
214 3300047469 Ga0495673_0019700 Ga0495673_0019700_2114_3076 320
215 3300047469 Ga0495673_0059418 Ga0495673_0059418_294_1256 320
216 3300047470 Ga0495681_0001761 Ga0495681_0001761_9889_10851 320
217 3300048091 Ga0495626_0000040 Ga0495626_0000040_110447_111409 320
218 iso_pu_bacteria 2929189879 2929193193 320
219 3300046522 Ga0495643_0103053 Ga0495643_0103053_121_1086 321
220 3300046524 Ga0495648_0039386 Ga0495648_0039386_1172_2137 321
221 3300046810 Ga0495660_0000704 Ga0495660_0000704_3998_4963 321
222 iso_pu_bacteria 2852657418 2852659348 321
223 iso_pu_bacteria 2904518522 2904520517 321
224 3300005288 Ga0065714_10064735 Ga0065714_1006473517 322
225 3300005288 Ga0065714_10066753 Ga0065714_100667533 322
226 3300005353 Ga0070669_100000957 Ga0070669_10000095717 322
227 3300005457 Ga0070662_100002793 Ga0070662_1000027933 322
228 3300005539 Ga0068853_100029609 Ga0068853_1000296094 322
229 3300005564 Ga0070664_100126743 Ga0070664_1001267432 322
230 3300005578 Ga0068854_100034790 Ga0068854_1000347902 322
231 3300005834 Ga0068851_10000103 Ga0068851_1000010310 322
232 3300009011 Ga0105251_10001158 Ga0105251_100011586 322
233 3300013100 Ga0157373_10005057 Ga0157373_100050576 322
234 3300013100 Ga0157373_10006322 Ga0157373_100063223 322
235 3300013100 Ga0157373_10015266 Ga0157373_100152663 322
236 3300013104 Ga0157370_10060768 Ga0157370_100607684 322
237 3300013306 Ga0163162_10554195 Ga0163162_105541951 322
238 3300014497 Ga0182008_10003123 Ga0182008_100031236 322
239 3300015262 Ga0182007_10001888 Ga0182007_1000188810 322
240 3300025321 Ga0207656_10000161 Ga0207656_1000016124 322
241 3300025735 Ga0207713_1001848 Ga0207713_100184812 322
242 3300025923 Ga0207681_10022654 Ga0207681_100226545 322
243 3300025933 Ga0207706_10000566 Ga0207706_1000056613 322
244 3300025945 Ga0207679_10091026 Ga0207679_100910262 322
245 3300026041 Ga0207639_10019931 Ga0207639_100199314 322
246 3300046512 Ga0495610_0028161 Ga0495610_0028161_998_1969 322
247 3300046530 Ga0495654_0100290 Ga0495654_0100290_75_1052 322
248 3300046810 Ga0495660_0058642 Ga0495660_0058642_34_1020 322
249 3300048920 Ga0496117_0102706 Ga0496117_0102706_281_1255 322
250 3300048920 Ga0496117_0147263 Ga0496117_0147263_256_1230 322
251 3300048921 Ga0496118_0109560 Ga0496118_0109560_372_1346 322
252 3300048922 Ga0496119_0119673 Ga0496119_0119673_327_1301 322
253 3300048923 Ga0496120_0021218 Ga0496120_0021218_306_1280 322
254 3300048927 Ga0496124_0185164 Ga0496124_0185164_600_1574 322
255 3300048928 Ga0496125_0131643 Ga0496125_0131643_305_1279 322
256 3300003752 Ga0055539_1000107 Ga0055539_100010732 323
257 3300003756 Ga0055533_1000116 Ga0055533_100011632 323
258 3300003758 Ga0055532_1000103 Ga0055532_100010349 323
259 3300003759 Ga0055525_1000160 Ga0055525_100016029 323
260 3300003791 Ga0055530_10000239 Ga0055530_1000023926 323
261 3300003792 Ga0055540_1000244 Ga0055540_100024428 323
262 3300003794 Ga0055531_10000221 Ga0055531_1000022145 323
263 3300003841 Ga0055541_1000073 Ga0055541_100007332 323
264 3300005288 Ga0065714_10006234 Ga0065714_100062342 323
265 3300009011 Ga0105251_10004183 Ga0105251_1000418311 323
266 3300009011 Ga0105251_10029703 Ga0105251_100297032 323
267 3300009011 Ga0105251_10031558 Ga0105251_100315583 323
268 3300009036 Ga0105244_10001397 Ga0105244_1000139710 323
269 3300009036 Ga0105244_10003294 Ga0105244_100032947 323
270 3300009036 Ga0105244_10026667 Ga0105244_100266672 323
271 3300009036 Ga0105244_10044131 Ga0105244_100441312 323
272 3300009092 Ga0105250_10001022 Ga0105250_1000102210 323
273 3300009092 Ga0105250_10007663 Ga0105250_100076632 323
274 3300009092 Ga0105250_10017065 Ga0105250_100170652 323
275 3300009148 Ga0105243_10000258 Ga0105243_1000025821 323
276 3300011119 Ga0105246_10000161 Ga0105246_1000016115 323
277 3300012498 Ga0157345_1000020 Ga0157345_100002010 323
278 3300013100 Ga0157373_10001782 Ga0157373_1000178210 323
279 3300013100 Ga0157373_10011964 Ga0157373_100119643 323
280 3300013100 Ga0157373_10281495 Ga0157373_102814952 323
281 3300013105 Ga0157369_10004566 Ga0157369_1000456610 323
282 3300013306 Ga0163162_10000322 Ga0163162_1000032220 323
283 3300013307 Ga0157372_10002618 Ga0157372_1000261810 323
284 3300014497 Ga0182008_10002330 Ga0182008_100023307 323
285 3300015261 Ga0182006_1027333 Ga0182006_10273332 323
286 3300017792 Ga0163161_10001706 Ga0163161_1000170610 323
287 3300017792 Ga0163161_10010704 Ga0163161_100107042 323
288 3300025206 Ga0209435_106604 Ga0209435_1066042 323
289 3300025224 Ga0209784_100110 Ga0209784_10011049 323
290 3300025225 Ga0209566_100131 Ga0209566_10013149 323
291 3300025226 Ga0209674_100154 Ga0209674_10015449 323
292 3300025229 Ga0209147_100158 Ga0209147_10015849 323
293 3300025230 Ga0209563_100133 Ga0209563_10013349 323
294 3300025230 Ga0209563_102311 Ga0209563_1023112 323
295 3300025242 Ga0209258_100260 Ga0209258_10026033 323
296 3300025246 Ga0209646_1000454 Ga0209646_100045418 323
297 3300025253 Ga0209677_100100 Ga0209677_10010049 323
298 3300025292 Ga0209676_1000002 Ga0209676_1000002262 323
299 3300025298 Ga0209050_1000242 Ga0209050_100024232 323
300 3300025303 Ga0209051_1000001 Ga0209051_1000001262 323
301 3300025304 Ga0209257_1000167 Ga0209257_100016790 323
302 3300025711 Ga0207696_1000147 Ga0207696_100014745 323
303 3300025711 Ga0207696_1003248 Ga0207696_10032487 323
304 3300025728 Ga0207655_1000536 Ga0207655_100053627 323
305 3300025728 Ga0207655_1002208 Ga0207655_10022088 323
306 3300025728 Ga0207655_1005354 Ga0207655_10053545 323
307 3300025728 Ga0207655_1012818 Ga0207655_10128183 323
308 3300025728 Ga0207655_1044714 Ga0207655_10447142 323
309 3300025735 Ga0207713_1000870 Ga0207713_10008704 323
310 3300025735 Ga0207713_1002127 Ga0207713_100212712 323
311 3300025935 Ga0207709_10000014 Ga0207709_10000014446 323
312 3300028379 Ga0268266_10077718 Ga0268266_100777182 323
313 3300030521 Ga0307511_10063136 Ga0307511_100631362 323
314 3300033180 Ga0307510_10001978 Ga0307510_1000197810 323
315 3300046452 Ga0495617_007818 Ga0495617_007818_1785_2756 323
316 3300046452 Ga0495617_020081 Ga0495617_020081_318_1289 323
317 3300046452 Ga0495617_024544 Ga0495617_024544_266_1237 323
318 3300046453 Ga0495627_000416 Ga0495627_000416_28675_29646 323
319 3300046453 Ga0495627_001073 Ga0495627_001073_12108_13079 323
320 3300046453 Ga0495627_001416 Ga0495627_001416_4279_5250 323
321 3300046453 Ga0495627_034666 Ga0495627_034666_49_1020 323
322 3300046454 Ga0495592_0167031 Ga0495592_0167031_142_1113 323
323 3300046458 Ga0495591_000386 Ga0495591_000386_30349_31320 323
324 3300046458 Ga0495591_001748 Ga0495591_001748_439_1410 323
325 3300046458 Ga0495591_002807 Ga0495591_002807_6042_7013 323
326 3300046458 Ga0495591_003912 Ga0495591_003912_1707_2678 323
327 3300046458 Ga0495591_007619 Ga0495591_007619_815_1786 323
328 3300046460 Ga0495638_0001009 Ga0495638_0001009_4918_5889 323
329 3300046460 Ga0495638_0027191 Ga0495638_0027191_208_1179 323
330 3300046460 Ga0495638_0093958 Ga0495638_0093958_204_1175 323
331 3300046460 Ga0495638_0141242 Ga0495638_0141242_128_1099 323
332 3300046460 Ga0495638_0186303 Ga0495638_0186303_33_1004 323
333 3300046463 Ga0495653_0002377 Ga0495653_0002377_4620_5591 323
334 3300046463 Ga0495653_0083081 Ga0495653_0083081_27_998 323
335 3300046471 Ga0495650_0012408 Ga0495650_0012408_3559_4530 323
336 3300046471 Ga0495650_0012757 Ga0495650_0012757_400_1371 323
337 3300046471 Ga0495650_0014259 Ga0495650_0014259_2272_3243 323
338 3300046471 Ga0495650_0067377 Ga0495650_0067377_346_1317 323
339 3300046474 Ga0495605_0000868 Ga0495605_0000868_8881_9852 323
340 3300046474 Ga0495605_0068309 Ga0495605_0068309_289_1260 323
341 3300046491 Ga0495584_0001134 Ga0495584_0001134_4964_5935 323
342 3300046491 Ga0495584_0006019 Ga0495584_0006019_4908_5879 323
343 3300046491 Ga0495584_0013826 Ga0495584_0013826_2970_3941 323
344 3300046491 Ga0495584_0118203 Ga0495584_0118203_244_1215 323
345 3300046492 Ga0495585_0000634 Ga0495585_0000634_9247_10218 323
346 3300046492 Ga0495585_0001035 Ga0495585_0001035_17309_18280 323
347 3300046492 Ga0495585_0004247 Ga0495585_0004247_3428_4399 323
348 3300046492 Ga0495585_0004463 Ga0495585_0004463_3679_4650 323
349 3300046492 Ga0495585_0046861 Ga0495585_0046861_485_1456 323
350 3300046492 Ga0495585_0058553 Ga0495585_0058553_967_1938 323
351 3300046500 Ga0495596_0008642 Ga0495596_0008642_3538_4509 323
352 3300046500 Ga0495596_0028892 Ga0495596_0028892_311_1282 323
353 3300046501 Ga0495607_0001664 Ga0495607_0001664_9222_10193 323
354 3300046501 Ga0495607_0002482 Ga0495607_0002482_6339_7310 323
355 3300046501 Ga0495607_0041289 Ga0495607_0041289_1399_2370 323
356 3300046501 Ga0495607_0053665 Ga0495607_0053665_923_1894 323
357 3300046501 Ga0495607_0057469 Ga0495607_0057469_845_1816 323
358 3300046501 Ga0495607_0063764 Ga0495607_0063764_217_1188 323
359 3300046506 Ga0495583_0002470 Ga0495583_0002470_3575_4546 323
360 3300046507 Ga0495606_0003686 Ga0495606_0003686_5707_6678 323
361 3300046507 Ga0495606_0004634 Ga0495606_0004634_8710_9681 323
362 3300046507 Ga0495606_0008965 Ga0495606_0008965_4850_5821 323
363 3300046507 Ga0495606_0040402 Ga0495606_0040402_911_1882 323
364 3300046507 Ga0495606_0076095 Ga0495606_0076095_847_1818 323
365 3300046512 Ga0495610_0000727 Ga0495610_0000727_21061_22032 323
366 3300046512 Ga0495610_0001563 Ga0495610_0001563_9775_10746 323
367 3300046512 Ga0495610_0025565 Ga0495610_0025565_978_1949 323
368 3300046512 Ga0495610_0037336 Ga0495610_0037336_466_1437 323
369 3300046513 Ga0495616_0000305 Ga0495616_0000305_15325_16296 323
370 3300046513 Ga0495616_0084276 Ga0495616_0084276_89_1060 323
371 3300046515 Ga0495620_0000195 Ga0495620_0000195_30181_31152 323
372 3300046515 Ga0495620_0019019 Ga0495620_0019019_1464_2435 323
373 3300046515 Ga0495620_0020435 Ga0495620_0020435_1353_2324 323
374 3300046515 Ga0495620_0092206 Ga0495620_0092206_86_1057 323
375 3300046517 Ga0495630_0006519 Ga0495630_0006519_5834_6805 323
376 3300046519 Ga0495632_0001973 Ga0495632_0001973_9347_10318 323
377 3300046519 Ga0495632_0004092 Ga0495632_0004092_5223_6194 323
378 3300046519 Ga0495632_0004180 Ga0495632_0004180_102_1073 323
379 3300046519 Ga0495632_0005501 Ga0495632_0005501_4129_5100 323
380 3300046519 Ga0495632_0024563 Ga0495632_0024563_1250_2221 323
381 3300046519 Ga0495632_0084305 Ga0495632_0084305_249_1220 323
382 3300046520 Ga0495637_0000584 Ga0495637_0000584_10916_11887 323
383 3300046520 Ga0495637_0004189 Ga0495637_0004189_608_1579 323
384 3300046520 Ga0495637_0005391 Ga0495637_0005391_3150_4121 323
385 3300046520 Ga0495637_0006084 Ga0495637_0006084_4802_5773 323
386 3300046520 Ga0495637_0008726 Ga0495637_0008726_2977_3948 323
387 3300046520 Ga0495637_0046715 Ga0495637_0046715_375_1346 323
388 3300046520 Ga0495637_0082450 Ga0495637_0082450_59_1030 323
389 3300046520 Ga0495637_0096241 Ga0495637_0096241_21_992 323
390 3300046522 Ga0495643_0003871 Ga0495643_0003871_8817_9788 323
391 3300046522 Ga0495643_0008743 Ga0495643_0008743_563_1534 323
392 3300046523 Ga0495644_0001042 Ga0495644_0001042_4810_5781 323
393 3300046524 Ga0495648_0001936 Ga0495648_0001936_8448_9419 323
394 3300046524 Ga0495648_0007377 Ga0495648_0007377_6907_7878 323
395 3300046524 Ga0495648_0008639 Ga0495648_0008639_3998_4969 323
396 3300046524 Ga0495648_0018390 Ga0495648_0018390_938_1909 323
397 3300046524 Ga0495648_0033695 Ga0495648_0033695_528_1499 323
398 3300046524 Ga0495648_0080308 Ga0495648_0080308_123_1094 323
399 3300046530 Ga0495654_0000541 Ga0495654_0000541_3391_4362 323
400 3300046530 Ga0495654_0004426 Ga0495654_0004426_7039_8010 323
401 3300046530 Ga0495654_0062177 Ga0495654_0062177_523_1494 323
402 3300046530 Ga0495654_0065538 Ga0495654_0065538_394_1365 323
403 3300046538 Ga0495609_0001455 Ga0495609_0001455_10242_11213 323
404 3300046538 Ga0495609_0001524 Ga0495609_0001524_8576_9547 323
405 3300046538 Ga0495609_0041508 Ga0495609_0041508_785_1756 323
406 3300046538 Ga0495609_0088268 Ga0495609_0088268_264_1235 323
407 3300046542 Ga0495597_0002187 Ga0495597_0002187_664_1638 323
408 3300046542 Ga0495597_0002953 Ga0495597_0002953_138_1109 323
409 3300046542 Ga0495597_0006552 Ga0495597_0006552_402_1373 323
410 3300046542 Ga0495597_0017454 Ga0495597_0017454_501_1472 323
411 3300046542 Ga0495597_0059581 Ga0495597_0059581_530_1501 323
412 3300046542 Ga0495597_0075474 Ga0495597_0075474_91_1062 323
413 3300046543 Ga0495645_0091171 Ga0495645_0091171_425_1402 323
414 3300046557 Ga0495622_0079862 Ga0495622_0079862_437_1408 323
415 3300046558 Ga0495633_0005177 Ga0495633_0005177_1935_2906 323
416 3300046616 Ga0495668_0001554 Ga0495668_0001554_9161_10132 323
417 3300046642 Ga0495634_0031140 Ga0495634_0031140_337_1308 323
418 3300046648 Ga0495611_0000125 Ga0495611_0000125_21071_22042 323
419 3300046648 Ga0495611_0035156 Ga0495611_0035156_1022_1993 323
420 3300046648 Ga0495611_0047687 Ga0495611_0047687_823_1794 323
421 3300046660 Ga0495625_0002467 Ga0495625_0002467_9328_10299 323
422 3300046660 Ga0495625_0154247 Ga0495625_0154247_559_1530 323
423 3300046665 Ga0495661_0029007 Ga0495661_0029007_1423_2394 323
424 3300046665 Ga0495661_0053769 Ga0495661_0053769_983_1954 323
425 3300046665 Ga0495661_0070721 Ga0495661_0070721_544_1515 323
426 3300046665 Ga0495661_0077655 Ga0495661_0077655_419_1390 323
427 3300046680 Ga0495646_0145358 Ga0495646_0145358_96_1067 323
428 3300046689 Ga0495613_0017991 Ga0495613_0017991_4231_5202 323
429 3300046689 Ga0495613_0088387 Ga0495613_0088387_437_1408 323
430 3300046690 Ga0495624_0001502 Ga0495624_0001502_5632_6603 323
431 3300046690 Ga0495624_0050551 Ga0495624_0050551_1625_2596 323
432 3300046691 Ga0495670_0000483 Ga0495670_0000483_8576_9547 323
433 3300046692 Ga0495671_0001423 Ga0495671_0001423_3704_4675 323
434 3300046692 Ga0495671_0015937 Ga0495671_0015937_1640_2611 323
435 3300046692 Ga0495671_0016797 Ga0495671_0016797_2832_3803 323
436 3300046692 Ga0495671_0040208 Ga0495671_0040208_914_1885 323
437 3300046694 Ga0495649_0002199 Ga0495649_0002199_3899_4870 323
438 3300046694 Ga0495649_0014965 Ga0495649_0014965_1586_2557 323
439 3300046694 Ga0495649_0044422 Ga0495649_0044422_303_1274 323
440 3300046694 Ga0495649_0050372 Ga0495649_0050372_256_1227 323
441 3300046694 Ga0495649_0113443 Ga0495649_0113443_358_1329 323
442 3300046794 Ga0495589_0001834 Ga0495589_0001834_3344_4315 323
443 3300046794 Ga0495589_0003110 Ga0495589_0003110_6249_7220 323
444 3300046794 Ga0495589_0009111 Ga0495589_0009111_3344_4315 323
445 3300046809 Ga0495600_0009737 Ga0495600_0009737_4535_5506 323
446 3300046810 Ga0495660_0001292 Ga0495660_0001292_10766_11737 323
447 3300046810 Ga0495660_0004668 Ga0495660_0004668_2375_3346 323
448 3300046810 Ga0495660_0006842 Ga0495660_0006842_149_1120 323
449 3300046810 Ga0495660_0017899 Ga0495660_0017899_275_1246 323
450 3300046810 Ga0495660_0059120 Ga0495660_0059120_183_1154 323
451 3300047317 Ga0495604_0030910 Ga0495604_0030910_256_1227 323
452 3300047317 Ga0495604_0040267 Ga0495604_0040267_593_1564 323
453 3300047320 Ga0495672_0002321 Ga0495672_0002321_5616_6587 323
454 3300047320 Ga0495672_0041509 Ga0495672_0041509_814_1785 323
455 3300047321 Ga0495676_0000534 Ga0495676_0000534_21125_22096 323
456 3300047321 Ga0495676_0043025 Ga0495676_0043025_430_1401 323
457 3300047322 Ga0495680_0091817 Ga0495680_0091817_891_1862 323
458 3300047323 Ga0495683_0005492 Ga0495683_0005492_148_1119 323
459 3300047323 Ga0495683_0018744 Ga0495683_0018744_696_1667 323
460 3300047323 Ga0495683_0030673 Ga0495683_0030673_924_1895 323
461 3300047323 Ga0495683_0147642 Ga0495683_0147642_95_1066 323
462 3300047446 Ga0495679_002152 Ga0495679_002152_484_1455 323
463 3300047446 Ga0495679_004540 Ga0495679_004540_5254_6225 323
464 3300047446 Ga0495679_004732 Ga0495679_004732_4265_5236 323
465 3300047446 Ga0495679_005963 Ga0495679_005963_475_1446 323
466 3300047469 Ga0495673_0001095 Ga0495673_0001095_13237_14208 323
467 3300047469 Ga0495673_0006172 Ga0495673_0006172_943_1914 323
468 3300047469 Ga0495673_0014565 Ga0495673_0014565_2721_3692 323
469 3300047469 Ga0495673_0019131 Ga0495673_0019131_2072_3043 323
470 3300047469 Ga0495673_0040011 Ga0495673_0040011_770_1741 323
471 3300047470 Ga0495681_0000134 Ga0495681_0000134_18744_19718 323
472 3300047470 Ga0495681_0000627 Ga0495681_0000627_20247_21218 323
473 3300047470 Ga0495681_0002828 Ga0495681_0002828_5696_6667 323
474 3300047470 Ga0495681_0005151 Ga0495681_0005151_278_1249 323
475 3300047470 Ga0495681_0037864 Ga0495681_0037864_977_1948 323
476 3300047470 Ga0495681_0054032 Ga0495681_0054032_567_1538 323
477 3300047471 Ga0495684_0018655 Ga0495684_0018655_2138_3109 323
478 3300047472 Ga0495686_0002026 Ga0495686_0002026_5080_6051 323
479 3300047472 Ga0495686_0003274 Ga0495686_0003274_4525_5496 323
480 3300047472 Ga0495686_0015626 Ga0495686_0015626_3344_4315 323
481 3300048088 Ga0495602_0003788 Ga0495602_0003788_5666_6637 323
482 3300048091 Ga0495626_0000584 Ga0495626_0000584_22715_23686 323
483 3300048091 Ga0495626_0000833 Ga0495626_0000833_5491_6462 323
484 3300048091 Ga0495626_0007715 Ga0495626_0007715_4715_5686 323
485 3300048091 Ga0495626_0008747 Ga0495626_0008747_1373_2344 323
486 3300048091 Ga0495626_0009253 Ga0495626_0009253_171_1142 323
487 3300048091 Ga0495626_0038199 Ga0495626_0038199_934_1905 323
488 3300048919 Ga0496116_0001103 Ga0496116_0001103_21166_22137 323
489 3300048919 Ga0496116_0003657 Ga0496116_0003657_4981_5952 323
490 3300048919 Ga0496116_0005493 Ga0496116_0005493_8950_9921 323
491 3300048920 Ga0496117_0004246 Ga0496117_0004246_13446_14417 323
492 3300048920 Ga0496117_0021786 Ga0496117_0021786_2852_3823 323
493 3300048920 Ga0496117_0035624 Ga0496117_0035624_1348_2319 323
494 3300048921 Ga0496118_0005213 Ga0496118_0005213_9012_9983 323
495 3300048922 Ga0496119_0023530 Ga0496119_0023530_190_1161 323
496 3300048923 Ga0496120_0023345 Ga0496120_0023345_1321_2292 323
497 3300048924 Ga0496121_0006324 Ga0496121_0006324_8971_9942 323
498 3300048925 Ga0496122_0026547 Ga0496122_0026547_2612_3583 323
499 3300048926 Ga0496123_0038896 Ga0496123_0038896_1546_2517 323
500 3300048927 Ga0496124_0253290 Ga0496124_0253290_285_1256 323
501 3300048928 Ga0496125_0019058 Ga0496125_0019058_4587_5558 323
502 3300049459 Ga0495678_002005 Ga0495678_002005_3339_4310 323
503 3300049459 Ga0495678_002092 Ga0495678_002092_3339_4310 323
504 3300049459 Ga0495678_003467 Ga0495678_003467_4936_5907 323
505 3300049459 Ga0495678_013902 Ga0495678_013902_520_1491 323
506 3300049459 Ga0495678_015621 Ga0495678_015621_1504_2475 323
507 3300049460 Ga0495682_0000468 Ga0495682_0000468_4938_5909 323
508 3300053111 Ga0500572_000960 Ga0500572_000960_2821_3792 323
509 3300017792 Ga0163161_10013666 Ga0163161_100136664 324
510 3300046519 Ga0495632_0092111 Ga0495632_0092111_84_1061 324
511 3300046660 Ga0495625_0059680 Ga0495625_0059680_1648_2625 324
512 3300047469 Ga0495673_0004049 Ga0495673_0004049_2352_3341 324
513 iso_pu_bacteria 3007395558 3007396870 324
514 3300005288 Ga0065714_10119062 Ga0065714_101190622 325
515 iso_pu_bacteria 2511231006 2511264352 325
516 iso_pu_bacteria 2512047018 2512325568 325
517 iso_pu_bacteria 2554235341 2555670951 325
518 iso_pu_bacteria 2582580891 2583793084 325
519 iso_pu_bacteria 2597489887 2597858968 325
520 iso_pu_bacteria 2599185160 2599357486 325
521 iso_pu_bacteria 2599185161 2599364276 325
522 iso_pu_bacteria 2599185162 2599370597 325
523 iso_pu_bacteria 2599185163 2599377210 325
524 iso_pu_bacteria 2599185164 2599382797 325
525 iso_pu_bacteria 2599185165 2599389245 325
526 iso_pu_bacteria 2599185166 2599395822 325
527 iso_pu_bacteria 2599185168 2599408212 325
528 iso_pu_bacteria 2599185181 2599464025 325
529 iso_pu_bacteria 2599185182 2599471052 325
530 iso_pu_bacteria 2599185185 2599487594 325
531 iso_pu_bacteria 2599185186 2599493044 325
532 iso_pu_bacteria 2599185257 2599806081 325
533 iso_pu_bacteria 2599185356 2600217167 325
534 iso_pu_bacteria 2600254931 2600366788 325
535 iso_pu_bacteria 2600255313 2601777338 325
536 iso_pu_bacteria 2667528171 2671100440 325
537 iso_pu_bacteria 2671180172 2671772853 325
538 iso_pu_bacteria 2740892503 2743738490 325
539 iso_pu_bacteria 2818991464 2819706101 325
540 iso_pu_bacteria 2844665904 2844671500 325
541 iso_pu_bacteria 2917070673 2917074813 325
542 iso_pu_bacteria 2923153595 2923157548 325
543 iso_pu_bacteria 2935353572 2935355200 325
544 iso_pu_bacteria 2984286254 2984288587 325
545 iso_pu_bacteria 637000220 637321286 325
546 iso_pu_bacteria 8055770955 8055774898 325
547 iso_pu_bacteria 8056155041 8056158996 325
548 iso_pu_bacteria 2946027586 2946031473 327
549 3300005288 Ga0065714_10065878 Ga0065714_100658788 328
550 3300009011 Ga0105251_10001335 Ga0105251_100013352 328
551 3300009092 Ga0105250_10001304 Ga0105250_1000130412 328
552 3300015261 Ga0182006_1001031 Ga0182006_100103117 328
553 3300015265 Ga0182005_1000856 Ga0182005_10008569 328
554 3300017792 Ga0163161_10001094 Ga0163161_1000109417 328
555 3300025711 Ga0207696_1002068 Ga0207696_10020682 328
556 3300025728 Ga0207655_1010852 Ga0207655_10108525 328
557 3300025735 Ga0207713_1002273 Ga0207713_10022739 328
558 3300041407 Ga0439447_000052 Ga0439447_000052_14496_15485 328
559 3300041407 Ga0439447_005377 Ga0439447_005377_589_1578 328
560 3300041411 Ga0439466_0000139 Ga0439466_0000139_22695_23684 328
561 3300041411 Ga0439466_0071442 Ga0439466_0071442_36_1025 328
562 3300042006 Ga0439432_009061 Ga0439432_009061_1281_2270 328
563 3300042010 Ga0439452_000770 Ga0439452_000770_945_1934 328
564 3300042010 Ga0439452_005035 Ga0439452_005035_452_1441 328
565 3300042013 Ga0439456_006283 Ga0439456_006283_504_1493 328
566 3300042016 Ga0439463_000157 Ga0439463_000157_5593_6582 328
567 3300042146 Ga0450907_016220 Ga0450907_016220_102_1091 328
568 3300048913 Ga0496110_0188761 Ga0496110_0188761_215_1204 328
569 3300002737 JGI25162J39368_1000095 JGI25162J39368_100009553 329
570 3300002771 JGI25163J39215_1000303 JGI25163J39215_10003039 329
571 3300002772 JGI25164J39214_1000069 JGI25164J39214_100006955 329
572 3300003214 JGI25165J46597_1000168 JGI25165J46597_100016838 329
573 3300009148 Ga0105243_10006203 Ga0105243_100062036 329
574 3300009553 Ga0105249_10092704 Ga0105249_100927043 329
575 3300013102 Ga0157371_10001096 Ga0157371_1000109617 329
576 3300014497 Ga0182008_10001418 Ga0182008_100014183 329
577 3300025207 Ga0209760_100018 Ga0209760_100018108 329
578 3300025231 Ga0207427_100015 Ga0207427_100015400 329
579 3300025233 Ga0209437_100027 Ga0209437_100027115 329
580 3300025261 Ga0209233_1000039 Ga0209233_1000039400 329
581 3300025935 Ga0207709_10003534 Ga0207709_100035346 329
582 3300041407 Ga0439447_038365 Ga0439447_038365_52_1077 329
583 3300041411 Ga0439466_0004872 Ga0439466_0004872_1361_2386 329
584 3300042010 Ga0439452_003593 Ga0439452_003593_955_1980 329
585 3300048919 Ga0496116_0000514 Ga0496116_0000514_12475_13464 329
586 3300048920 Ga0496117_0001404 Ga0496117_0001404_12396_13385 329
587 3300048921 Ga0496118_0009033 Ga0496118_0009033_4203_5192 329
588 3300048924 Ga0496121_0000955 Ga0496121_0000955_38867_39856 329
589 3300048925 Ga0496122_0002553 Ga0496122_0002553_15389_16378 329
590 3300048926 Ga0496123_0001630 Ga0496123_0001630_12409_13398 329
591 iso_pu_bacteria 8019769354 8019772110 329
592 iso_pu_bacteria 8057798959 8057801420 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05229

SCPU

Spore Coat Protein U domain

197

338

0.9

PF05229

SCPU

Spore Coat Protein U domain

28

173

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fm5-assembly1.cif.gz_A crystal structure of self-complemented csua/b major subunit from archaic chaperone-usher csu pili of acinetobacter baumannii 0.6796 27 195
6fm5-assembly1.cif.gz_A crystal structure of self-complemented csua/b major subunit from archaic chaperone-usher csu pili of acinetobacter baumannii 0.6682 27 195
4akr-assembly1.cif.gz_A crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum 0.6551 150 195
1ze3-assembly1.cif.gz_H crystal structure of the ternary complex of fimd (n-terminal domain) with fimc and the pilin domain of fimh 0.6403 197 329
7zl4-assembly1.cif.gz_A cryo-em structure of archaic chaperone-usher csu pilus of acinetobacter baumannii 0.6385 220 329
ID Description Score Start End Superfamily
af_P38052_25_170_2.60.40.1090 Mainly Beta;Sandwich;Immunoglobulin-like;Fimbrial-type adhesion domain 0.6515 197 329 2.60.40.1090
2wmpB00 Mainly Beta;Sandwich;Immunoglobulin-like;Fimbrial-type adhesion domain 0.6357 196 327 2.60.40.1090
3bwuF00 Mainly Beta;Sandwich;Immunoglobulin-like;Fimbrial-type adhesion domain 0.6257 195 328 2.60.40.1090
af_P77789_23_176_2.60.40.1090 Mainly Beta;Sandwich;Immunoglobulin-like;Fimbrial-type adhesion domain 0.6254 195 329 2.60.40.1090
3bwuF00 Mainly Beta;Sandwich;Immunoglobulin-like;Fimbrial-type adhesion domain 0.6149 195 328 2.60.40.1090
ID Description Score Start End GO Terms
AF-A0A3D4NRZ3-F1-model_v4 Spore coat protein U/FanG domain-containing protein 0.9363 21 276
AF-A0A1B8NYX4-F1-model_v4 Spore coat protein U domain protein 0.8991 214 329
AF-A0A2A2GXG5-F1-model_v4 Spore coat protein U/FanG domain-containing protein 0.8948 197 329
AF-A0A506PWK4-F1-model_v4 Spore coat protein U domain-containing protein 0.8877 195 329
AF-A0A6M0D259-F1-model_v4 Spore coat protein U domain-containing protein 0.8874 12 182

Feature Viewer

pLDDT pTM Quality
80.21 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map