F466965

General Info

Members Datasets Scaffolds Average Seq Length
590 263 511 184

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10002554|Ga0157370_100025544
Length 197
Sequence MTAPQNKGARRMGFSPKITLITALMLLAACRSEPVHYHTLMPQQTGGAAHSNGMYIEFDAVSVPAQVDRTQIVIRQGNSGLVLLETDWWGASLSEELQSALAAQLINANPPRKLSLRVEVQRFDSVPGQYGLIEATWRLRGIGEGNVSSLTCHSTLQTPSATSIEDLVAAQQNNVKRLAAVIGQAARGSQQSCPSSG

Samples

Sample ID Description Type Environment
1 2511231007 Pseudomonas sp. GM18 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231012 Pseudomonas sp. GM33 Isolate Nodule
5 2511231014 Pseudomonas sp. GM48 Isolate Nodule
6 2511231015 Pseudomonas sp. GM49 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
12 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
13 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
14 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
15 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
16 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
17 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
18 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
19 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
20 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
21 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
22 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
23 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
24 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
25 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
26 2773857673 Pseudomonas sp. 443 Isolate Unclassified
27 2784132063 Pseudomonas sp. 424 Isolate Unclassified
28 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
29 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
30 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
31 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
32 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
33 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
34 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
35 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
36 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
37 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
38 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
39 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
40 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
41 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
42 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
43 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
44 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
45 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
46 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
47 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
48 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
49 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
50 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
51 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
52 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
53 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
54 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
55 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
56 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
57 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
58 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
59 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
60 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
61 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
62 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
63 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
64 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
65 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
66 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
67 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
68 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
69 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
70 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
71 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
72 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
73 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
82 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
83 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
142 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
143 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
144 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
145 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
146 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
149 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
150 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
151 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
152 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
153 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
154 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
256 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
257 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
258 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
259 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
260 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
261 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
262 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
263 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.61
Metatranscriptomes 0.17
Isolates 13.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 2.71
Rhizoplane 2.88
Rhizosphere 77.12
Stem 0
Stem Tuber 0
Unclassified 12.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000727 3300002737 Bacteria 22687
2 JGI25163J39215_1000391 3300002771 Bacteria 13931
3 JGI25164J39214_1000433 3300002772 Bacteria 22956
4 JGI25165J46597_1000831 3300003214 Bacteria 22956
5 Ga0006562J51391_1049091 3300003578 Bacteria 2728
6 Ga0055536_1000053 3300003781 Bacteria 110030
7 Ga0055536_1000184 3300003781 Bacteria 51874
8 Ga0055530_10000219 3300003791 Bacteria 51126
9 Ga0055530_10033959 3300003791 Bacteria 1308
10 Ga0055540_1000006 3300003792 Bacteria 372018
11 Ga0055531_10000075 3300003794 Bacteria 107839
12 Ga0065714_10006254 3300005288 Bacteria 7525
13 Ga0065714_10093832 3300005288 Bacteria 1823
14 Ga0065714_10095408 3300005288 Bacteria 1787
15 Ga0065704_10122367 3300005289 Bacteria 1751
16 Ga0065704_10235273 3300005289 Bacteria 1031
17 Ga0065712_10094112 3300005290 Bacteria 2268
18 Ga0070670_100002020 3300005331 Bacteria 16597
19 Ga0070669_100080449 3300005353 Bacteria 2425
20 Ga0070662_100465471 3300005457 Bacteria 1051
21 Ga0070665_100031898 3300005548 Bacteria 5303
22 Ga0075364_10505533 3300006051 Bacteria 826
23 Ga0075432_10032024 3300006058 Bacteria 1821
24 Ga0075432_10173394 3300006058 Bacteria 840
25 Ga0075362_10012032 3300006177 Bacteria 3424
26 Ga0075370_10220410 3300006353 Bacteria 1121
27 Ga0075436_100127699 3300006914 Bacteria 1782
28 Ga0075436_100169946 3300006914 Bacteria 1539
29 Ga0075436_100203880 3300006914 Bacteria 1401
30 Ga0079104_1009278 3300006946 Bacteria 3347
31 Ga0079104_1067987 3300006946 Bacteria 753
32 Ga0079104_1080606 3300006946 Bacteria 670
33 Ga0105251_10002037 3300009011 Bacteria 16395
34 Ga0105251_10004166 3300009011 Bacteria 10042
35 Ga0105251_10022195 3300009011 Bacteria 3301
36 Ga0105251_10044940 3300009011 Bacteria 2131
37 Ga0105244_10000325 3300009036 Bacteria 45650
38 Ga0105244_10000811 3300009036 Bacteria 26483
39 Ga0105244_10001472 3300009036 Bacteria 19010
40 Ga0105244_10008103 3300009036 Bacteria 6600
41 Ga0105244_10011007 3300009036 Bacteria 5451
42 Ga0105244_10018986 3300009036 Bacteria 3848
43 Ga0105244_10032594 3300009036 Bacteria 2756
44 Ga0105244_10038322 3300009036 Bacteria 2500
45 Ga0105244_10247687 3300009036 Bacteria 831
46 Ga0105250_10000675 3300009092 Bacteria 21502
47 Ga0105250_10000729 3300009092 Bacteria 20067
48 Ga0105250_10014076 3300009092 Bacteria 3293
49 Ga0105250_10028361 3300009092 Bacteria 2255
50 Ga0105243_10000020 3300009148 Bacteria 214279
51 Ga0105243_11077739 3300009148 Bacteria 810
52 Ga0105246_10000638 3300011119 Bacteria 19557
53 Ga0157373_10002417 3300013100 Bacteria 14194
54 Ga0157373_10020815 3300013100 Bacteria 4762
55 Ga0157373_10077384 3300013100 Bacteria 2347
56 Ga0157373_10194411 3300013100 Bacteria 1430
57 Ga0157371_10000635 3300013102 Bacteria 41753
58 Ga0157371_10006154 3300013102 Bacteria 9962
59 Ga0157370_10002554 3300013104 Bacteria 21839
60 Ga0157370_10015083 3300013104 Bacteria 7874
61 Ga0157370_10052831 3300013104 Bacteria 3877
62 Ga0157370_10336339 3300013104 Bacteria 1392
63 Ga0157370_10749033 3300013104 Bacteria 890
64 Ga0157370_10886946 3300013104 Bacteria 810
65 Ga0157369_10002770 3300013105 Bacteria 20936
66 Ga0157369_10077336 3300013105 Bacteria 3566
67 Ga0163162_10078364 3300013306 Bacteria 3370
68 Ga0163162_11181261 3300013306 Bacteria 868
69 Ga0182008_10000907 3300014497 Bacteria 20608
70 Ga0182008_10001082 3300014497 Bacteria 18798
71 Ga0182008_10003600 3300014497 Bacteria 9276
72 Ga0182008_10014036 3300014497 Bacteria 4201
73 Ga0182008_10019053 3300014497 Bacteria 3548
74 Ga0182006_1000387 3300015261 Bacteria 36363
75 Ga0182006_1000452 3300015261 Bacteria 32460
76 Ga0182006_1004114 3300015261 Bacteria 7237
77 Ga0182006_1019753 3300015261 Bacteria 2832
78 Ga0182006_1055911 3300015261 Bacteria 1505
79 Ga0182007_10000108 3300015262 Bacteria 57807
80 Ga0182007_10031330 3300015262 Bacteria 1812
81 Ga0182007_10070302 3300015262 Bacteria 1147
82 Ga0182005_1000969 3300015265 Bacteria 12456
83 Ga0182005_1010529 3300015265 Bacteria 2658
84 Ga0182005_1016478 3300015265 Bacteria 2055
85 Ga0182005_1016865 3300015265 Bacteria 2025
86 Ga0182005_1016866 3300015265 Bacteria 2025
87 Ga0163161_10006428 3300017792 Bacteria 8135
88 Ga0163161_10025445 3300017792 Bacteria 4188
89 Ga0163161_10043764 3300017792 Bacteria 3225
90 Ga0163161_10153930 3300017792 Bacteria 1749
91 Ga0209760_100236 3300025207 Bacteria 23284
92 Ga0207427_100094 3300025231 Bacteria 125813
93 Ga0209437_100187 3300025233 Bacteria 125813
94 Ga0209233_1000196 3300025261 Bacteria 125850
95 Ga0209675_1037741 3300025291 Bacteria 1082
96 Ga0209676_1000002 3300025292 Bacteria 1732948
97 Ga0209676_1000158 3300025292 Bacteria 162469
98 Ga0209676_1003284 3300025292 Bacteria 10140
99 Ga0209676_1037244 3300025292 Bacteria 1406
100 Ga0209050_1000006 3300025298 Bacteria 1359702
101 Ga0209050_1000763 3300025298 Bacteria 46213
102 Ga0209051_1000001 3300025303 Bacteria 1732974
103 Ga0209051_1004500 3300025303 Bacteria 8561
104 Ga0209257_1000029 3300025304 Bacteria 695617
105 Ga0207696_1000002 3300025711 Bacteria 1098043
106 Ga0207696_1000052 3300025711 Bacteria 272880
107 Ga0207696_1011058 3300025711 Bacteria 3272
108 Ga0207696_1022676 3300025711 Bacteria 1991
109 Ga0207655_1000098 3300025728 Bacteria 190699
110 Ga0207655_1000410 3300025728 Bacteria 59117
111 Ga0207655_1001112 3300025728 Bacteria 26261
112 Ga0207655_1002318 3300025728 Bacteria 15638
113 Ga0207655_1003003 3300025728 Bacteria 12923
114 Ga0207655_1015886 3300025728 Bacteria 4152
115 Ga0207655_1051514 3300025728 Bacteria 1663
116 Ga0207713_1000518 3300025735 Bacteria 39106
117 Ga0207713_1000528 3300025735 Bacteria 38400
118 Ga0207713_1001602 3300025735 Bacteria 17673
119 Ga0207713_1008826 3300025735 Bacteria 5745
120 Ga0207713_1064025 3300025735 Bacteria 1386
121 Ga0207681_10070699 3300025923 Bacteria 2431
122 Ga0207650_10000988 3300025925 Bacteria 21373
123 Ga0207709_10000004 3300025935 Bacteria 825156
124 Ga0209281_1015200 3300027111 Bacteria 1610
125 Ga0209281_1018206 3300027111 Bacteria 1409
126 Ga0209281_1040485 3300027111 Bacteria 786
127 Ga0207428_10004701 3300027907 Bacteria 12922
128 Ga0207428_10154607 3300027907 Bacteria 1745
129 Ga0207428_10156838 3300027907 Bacteria 1731
130 Ga0307511_10048150 3300030521 Bacteria 3473
131 Ga0316179_1092773 3300030734 Bacteria 2093
132 Ga0316181_1012342 3300030744 Bacteria 4003
133 Ga0307408_100051210 3300031548 Bacteria 2973
134 Ga0307408_100527205 3300031548 Bacteria 1038
135 Ga0307405_10002609 3300031731 Bacteria 8002
136 Ga0307405_10222604 3300031731 Bacteria 1385
137 Ga0307407_10304346 3300031903 Bacteria 1113
138 Ga0307412_10009412 3300031911 Bacteria 5605
139 Ga0307412_10012063 3300031911 Bacteria 5024
140 Ga0307412_10190674 3300031911 Bacteria 1549
141 Ga0307412_10371243 3300031911 Bacteria 1155
142 Ga0307412_10638521 3300031911 Bacteria 906
143 Ga0307412_10812569 3300031911 Bacteria 812
144 Ga0307409_100681110 3300031995 Bacteria 1025
145 Ga0307416_100853879 3300032002 Bacteria 1008
146 Ga0307416_101436891 3300032002 Bacteria 795
147 Ga0307411_10011100 3300032005 Bacteria 4841
148 Ga0439438_002003 3300041405 Bacteria 8897
149 Ga0439438_002109 3300041405 Bacteria 8578
150 Ga0439438_002486 3300041405 Bacteria 7841
151 Ga0439438_007965 3300041405 Bacteria 3568
152 Ga0439438_061710 3300041405 Bacteria 938
153 Ga0439438_083656 3300041405 Bacteria 781
154 Ga0439447_000480 3300041407 Bacteria 14842
155 Ga0439447_001001 3300041407 Bacteria 10324
156 Ga0439447_003818 3300041407 Bacteria 5288
157 Ga0439447_021830 3300041407 Bacteria 1682
158 Ga0439447_026676 3300041407 Bacteria 1479
159 Ga0439447_030863 3300041407 Bacteria 1347
160 Ga0439447_050641 3300041407 Bacteria 992
161 Ga0439466_0001936 3300041411 Bacteria 8127
162 Ga0439466_0004588 3300041411 Bacteria 5306
163 Ga0439466_0005508 3300041411 Bacteria 4830
164 Ga0439466_0006451 3300041411 Bacteria 4459
165 Ga0439466_0010463 3300041411 Bacteria 3448
166 Ga0439466_0037751 3300041411 Bacteria 1625
167 Ga0439466_0135309 3300041411 Bacteria 757
168 Ga0439431_0000699 3300041997 Bacteria 7224
169 Ga0439445_0001020 3300042004 Bacteria 5972
170 Ga0439432_013494 3300042006 Bacteria 2777
171 Ga0439432_015982 3300042006 Bacteria 2528
172 Ga0439451_004649 3300042009 Bacteria 2795
173 Ga0439451_013653 3300042009 Bacteria 1641
174 Ga0439451_014806 3300042009 Bacteria 1573
175 Ga0439451_020384 3300042009 Bacteria 1336
176 Ga0439452_000317 3300042010 Bacteria 30475
177 Ga0439452_000906 3300042010 Bacteria 13525
178 Ga0439452_001174 3300042010 Bacteria 11283
179 Ga0439452_001512 3300042010 Bacteria 9392
180 Ga0439452_019457 3300042010 Bacteria 1794
181 Ga0439456_000106 3300042013 Bacteria 27845
182 Ga0439456_002651 3300042013 Bacteria 3604
183 Ga0439456_003205 3300042013 Bacteria 3310
184 Ga0439456_019703 3300042013 Bacteria 1420
185 Ga0439463_004720 3300042016 Bacteria 3404
186 Ga0439463_056213 3300042016 Bacteria 1005
187 Ga0439463_100564 3300042016 Bacteria 745
188 Ga0450911_000076 3300042115 Bacteria 40401
189 Ga0450894_039758 3300042131 Bacteria 673
190 Ga0450898_001471 3300042134 Bacteria 3111
191 Ga0450899_019939 3300042135 Bacteria 780
192 Ga0450903_002450 3300042138 Bacteria 3306
193 Ga0450903_005731 3300042138 Bacteria 2073
194 Ga0450903_028371 3300042138 Bacteria 849
195 Ga0450904_001607 3300042139 Bacteria 3065
196 Ga0450904_001775 3300042139 Bacteria 2831
197 Ga0450905_001857 3300042142 Bacteria 2705
198 Ga0450905_004627 3300042142 Bacteria 1826
199 Ga0450905_050897 3300042142 Bacteria 675
200 Ga0450906_000334 3300042145 Bacteria 9606
201 Ga0450907_000318 3300042146 Bacteria 15641
202 Ga0450910_001476 3300042147 Bacteria 2970
203 Ga0439446_0016704 3300042156 Bacteria 2045
204 Ga0439434_0000291 3300042435 Bacteria 14351
205 Ga0439460_0001141 3300042461 Bacteria 6211
206 Ga0439460_0002224 3300042461 Bacteria 4658
207 Ga0450901_002716 3300042533 Bacteria 1879
208 Ga0439440_0011865 3300042993 Bacteria 1844
209 Ga0439440_0016931 3300042993 Bacteria 1600
210 Ga0495617_000512 3300046452 Bacteria 20293
211 Ga0495617_005924 3300046452 Bacteria 4314
212 Ga0495617_008208 3300046452 Bacteria 3606
213 Ga0495617_026493 3300046452 Bacteria 1952
214 Ga0495617_041629 3300046452 Bacteria 1535
215 Ga0495617_083260 3300046452 Bacteria 1047
216 Ga0495627_036377 3300046453 Bacteria 1530
217 Ga0495592_0007551 3300046454 Bacteria 8143
218 Ga0495590_0000641 3300046457 Bacteria 16211
219 Ga0495590_0011487 3300046457 Bacteria 3310
220 Ga0495590_0013926 3300046457 Bacteria 2947
221 Ga0495590_0093053 3300046457 Bacteria 1067
222 Ga0495591_000166 3300046458 Bacteria 70296
223 Ga0495591_005461 3300046458 Bacteria 5882
224 Ga0495591_012328 3300046458 Bacteria 3188
225 Ga0495591_013726 3300046458 Bacteria 2947
226 Ga0495638_0001052 3300046460 Bacteria 27165
227 Ga0495638_0001323 3300046460 Bacteria 22805
228 Ga0495638_0002354 3300046460 Bacteria 15497
229 Ga0495638_0003194 3300046460 Bacteria 12955
230 Ga0495638_0003330 3300046460 Bacteria 12672
231 Ga0495638_0008642 3300046460 Bacteria 7203
232 Ga0495638_0017200 3300046460 Bacteria 4826
233 Ga0495638_0062321 3300046460 Bacteria 2302
234 Ga0495638_0073947 3300046460 Bacteria 2079
235 Ga0495653_0006240 3300046463 Bacteria 9779
236 Ga0495653_0048816 3300046463 Bacteria 3264
237 Ga0495650_0004713 3300046471 Bacteria 9192
238 Ga0495650_0007441 3300046471 Bacteria 6580
239 Ga0495650_0018402 3300046471 Bacteria 3472
240 Ga0495650_0028620 3300046471 Bacteria 2554
241 Ga0495580_0072721 3300046472 Bacteria 2401
242 Ga0495580_0264088 3300046472 Bacteria 1177
243 Ga0495605_0000778 3300046474 Bacteria 22880
244 Ga0495605_0002335 3300046474 Bacteria 11819
245 Ga0495605_0034414 3300046474 Bacteria 2565
246 Ga0495605_0051730 3300046474 Bacteria 1999
247 Ga0495639_0000053 3300046475 Bacteria 50537
248 Ga0495639_0009681 3300046475 Bacteria 4136
249 Ga0495584_0000120 3300046491 Bacteria 54113
250 Ga0495584_0000715 3300046491 Bacteria 21886
251 Ga0495584_0001056 3300046491 Bacteria 17142
252 Ga0495584_0006307 3300046491 Bacteria 6217
253 Ga0495584_0048517 3300046491 Bacteria 2140
254 Ga0495584_0229071 3300046491 Bacteria 944
255 Ga0495585_0010941 3300046492 Bacteria 5391
256 Ga0495594_0006338 3300046499 Bacteria 6084
257 Ga0495594_0095845 3300046499 Bacteria 1666
258 Ga0495607_0000041 3300046501 Bacteria 132443
259 Ga0495607_0003897 3300046501 Bacteria 11242
260 Ga0495607_0004231 3300046501 Bacteria 10644
261 Ga0495607_0006657 3300046501 Bacteria 8096
262 Ga0495607_0021681 3300046501 Bacteria 4040
263 Ga0495607_0097086 3300046501 Bacteria 1585
264 Ga0495607_0124651 3300046501 Bacteria 1348
265 Ga0495583_0004324 3300046506 Bacteria 10250
266 Ga0495583_0029883 3300046506 Bacteria 2661
267 Ga0495606_0002232 3300046507 Bacteria 23058
268 Ga0495606_0002606 3300046507 Bacteria 20632
269 Ga0495606_0008134 3300046507 Bacteria 9187
270 Ga0495606_0065396 3300046507 Bacteria 2310
271 Ga0495610_0028229 3300046512 Bacteria 2970
272 Ga0495610_0030925 3300046512 Bacteria 2798
273 Ga0495616_0006004 3300046513 Bacteria 7403
274 Ga0495616_0061733 3300046513 Bacteria 1837
275 Ga0495620_0001300 3300046515 Bacteria 15185
276 Ga0495620_0009488 3300046515 Bacteria 5173
277 Ga0495628_0390712 3300046516 Bacteria 1018
278 Ga0495630_0004903 3300046517 Bacteria 9401
279 Ga0495631_0000175 3300046518 Bacteria 43711
280 Ga0495631_0038208 3300046518 Bacteria 2135
281 Ga0495632_0009607 3300046519 Bacteria 5813
282 Ga0495632_0011499 3300046519 Bacteria 5160
283 Ga0495632_0192085 3300046519 Bacteria 932
284 Ga0495637_0002447 3300046520 Bacteria 10261
285 Ga0495637_0009047 3300046520 Bacteria 4866
286 Ga0495637_0009526 3300046520 Bacteria 4732
287 Ga0495637_0009974 3300046520 Bacteria 4616
288 Ga0495637_0046631 3300046520 Bacteria 1832
289 Ga0495643_0243694 3300046522 Bacteria 842
290 Ga0495644_0000088 3300046523 Bacteria 45850
291 Ga0495644_0059208 3300046523 Bacteria 1440
292 Ga0495648_0000156 3300046524 Bacteria 81149
293 Ga0495648_0002231 3300046524 Bacteria 18107
294 Ga0495648_0006399 3300046524 Bacteria 9622
295 Ga0495648_0023072 3300046524 Bacteria 4269
296 Ga0495648_0059239 3300046524 Bacteria 2285
297 Ga0495648_0077930 3300046524 Bacteria 1897
298 Ga0495648_0109395 3300046524 Bacteria 1507
299 Ga0495666_0000675 3300046526 Bacteria 15451
300 Ga0495666_0005483 3300046526 Bacteria 6392
301 Ga0495666_0228321 3300046526 Bacteria 851
302 Ga0495642_0000044 3300046528 Bacteria 74850
303 Ga0495654_0000600 3300046530 Bacteria 28665
304 Ga0495654_0011501 3300046530 Bacteria 4786
305 Ga0495654_0030206 3300046530 Bacteria 2758
306 Ga0495654_0071286 3300046530 Bacteria 1646
307 Ga0495609_0005054 3300046538 Bacteria 7044
308 Ga0495609_0007678 3300046538 Bacteria 5357
309 Ga0495609_0147192 3300046538 Bacteria 1003
310 Ga0495609_0276928 3300046538 Bacteria 687
311 Ga0495597_0001357 3300046542 Bacteria 17745
312 Ga0495597_0019620 3300046542 Bacteria 3160
313 Ga0495597_0022830 3300046542 Bacteria 2898
314 Ga0495597_0039322 3300046542 Bacteria 2118
315 Ga0495597_0125001 3300046542 Bacteria 1069
316 Ga0495597_0295732 3300046542 Bacteria 629
317 Ga0495645_0019996 3300046543 Bacteria 4827
318 Ga0495622_0000249 3300046557 Bacteria 41910
319 Ga0495622_0002237 3300046557 Bacteria 9415
320 Ga0495622_0009353 3300046557 Bacteria 4533
321 Ga0495622_0045277 3300046557 Bacteria 2044
322 Ga0495622_0139352 3300046557 Bacteria 1102
323 Ga0495633_0278228 3300046558 Bacteria 761
324 Ga0495633_0282145 3300046558 Bacteria 755
325 Ga0495656_0287849 3300046615 Bacteria 839
326 Ga0495656_0386453 3300046615 Bacteria 730
327 Ga0495656_0434772 3300046615 Bacteria 690
328 Ga0495634_0008313 3300046642 Bacteria 7736
329 Ga0495611_0001709 3300046648 Bacteria 10664
330 Ga0495611_0009705 3300046648 Bacteria 4069
331 Ga0495611_0078823 3300046648 Bacteria 1512
332 Ga0495625_0005062 3300046660 Bacteria 12202
333 Ga0495625_0006520 3300046660 Bacteria 10369
334 Ga0495625_0013111 3300046660 Bacteria 6678
335 Ga0495625_0045094 3300046660 Bacteria 3189
336 Ga0495659_0000119 3300046664 Bacteria 34751
337 Ga0495659_0006572 3300046664 Bacteria 3672
338 Ga0495661_0016567 3300046665 Bacteria 4881
339 Ga0495661_0022049 3300046665 Bacteria 4144
340 Ga0495588_0026241 3300046674 Bacteria 2907
341 Ga0495588_0036889 3300046674 Bacteria 2482
342 Ga0495623_0035309 3300046679 Bacteria 3204
343 Ga0495646_0011972 3300046680 Bacteria 5518
344 Ga0495669_0394871 3300046684 Bacteria 670
345 Ga0495613_0004677 3300046689 Bacteria 10269
346 Ga0495624_0000237 3300046690 Bacteria 43145
347 Ga0495670_0000777 3300046691 Bacteria 15304
348 Ga0495670_0001715 3300046691 Bacteria 10789
349 Ga0495670_0014230 3300046691 Bacteria 3914
350 Ga0495670_0137409 3300046691 Bacteria 1276
351 Ga0495671_0000210 3300046692 Bacteria 51181
352 Ga0495671_0004486 3300046692 Bacteria 8337
353 Ga0495671_0006039 3300046692 Bacteria 7038
354 Ga0495671_0007263 3300046692 Bacteria 6329
355 Ga0495671_0058212 3300046692 Bacteria 1912
356 Ga0495671_0096353 3300046692 Bacteria 1448
357 Ga0495671_0097171 3300046692 Bacteria 1440
358 Ga0495649_0000128 3300046694 Bacteria 66267
359 Ga0495649_0002159 3300046694 Bacteria 14075
360 Ga0495649_0002235 3300046694 Bacteria 13781
361 Ga0495649_0003135 3300046694 Bacteria 11327
362 Ga0495649_0014343 3300046694 Bacteria 4544
363 Ga0495649_0016669 3300046694 Bacteria 4163
364 Ga0495649_0066934 3300046694 Bacteria 1927
365 Ga0495589_0000998 3300046794 Bacteria 17194
366 Ga0495589_0011534 3300046794 Bacteria 4588
367 Ga0495589_0024743 3300046794 Bacteria 3050
368 Ga0495589_0058249 3300046794 Bacteria 1899
369 Ga0495600_0009244 3300046809 Bacteria 6080
370 Ga0495600_0010106 3300046809 Bacteria 5850
371 Ga0495660_0003215 3300046810 Bacteria 10151
372 Ga0495660_0005612 3300046810 Bacteria 7502
373 Ga0495660_0006326 3300046810 Bacteria 7019
374 Ga0495660_0010403 3300046810 Bacteria 5412
375 Ga0495660_0019904 3300046810 Bacteria 3849
376 Ga0495660_0020970 3300046810 Bacteria 3744
377 Ga0495581_0000629 3300047315 Bacteria 18436
378 Ga0495604_0003585 3300047317 Bacteria 12371
379 Ga0495604_0178561 3300047317 Bacteria 1486
380 Ga0495672_0000787 3300047320 Bacteria 34376
381 Ga0495672_0001650 3300047320 Bacteria 21692
382 Ga0495672_0001897 3300047320 Bacteria 19895
383 Ga0495672_0009495 3300047320 Bacteria 7045
384 Ga0495672_0020182 3300047320 Bacteria 4374
385 Ga0495672_0050921 3300047320 Bacteria 2441
386 Ga0495672_0081496 3300047320 Bacteria 1802
387 Ga0495672_0134893 3300047320 Bacteria 1295
388 Ga0495676_0002622 3300047321 Bacteria 16070
389 Ga0495680_0005904 3300047322 Bacteria 11450
390 Ga0495680_0008709 3300047322 Bacteria 9194
391 Ga0495680_0029966 3300047322 Bacteria 4448
392 Ga0495683_0000356 3300047323 Bacteria 37720
393 Ga0495683_0002013 3300047323 Bacteria 12610
394 Ga0495683_0004833 3300047323 Bacteria 7557
395 Ga0495683_0014340 3300047323 Bacteria 4129
396 Ga0495683_0024409 3300047323 Bacteria 3102
397 Ga0495683_0044439 3300047323 Bacteria 2234
398 Ga0495683_0135393 3300047323 Bacteria 1158
399 Ga0495687_047718 3300047443 Bacteria 1841
400 Ga0495677_0045910 3300047445 Bacteria 1603
401 Ga0495673_0000465 3300047469 Bacteria 43951
402 Ga0495673_0002619 3300047469 Bacteria 12469
403 Ga0495673_0003008 3300047469 Bacteria 11350
404 Ga0495673_0003971 3300047469 Bacteria 9458
405 Ga0495673_0018736 3300047469 Bacteria 3484
406 Ga0495673_0053598 3300047469 Bacteria 1757
407 Ga0495673_0069390 3300047469 Bacteria 1487
408 Ga0495673_0109911 3300047469 Bacteria 1103
409 Ga0495673_0237584 3300047469 Bacteria 669
410 Ga0495681_0000353 3300047470 Bacteria 35846
411 Ga0495681_0001105 3300047470 Bacteria 20484
412 Ga0495681_0001748 3300047470 Bacteria 16034
413 Ga0495681_0002137 3300047470 Bacteria 14330
414 Ga0495681_0002538 3300047470 Bacteria 13003
415 Ga0495681_0007590 3300047470 Bacteria 6900
416 Ga0495681_0213420 3300047470 Bacteria 777
417 Ga0495684_0004126 3300047471 Bacteria 11345
418 Ga0495684_0009792 3300047471 Bacteria 7396
419 Ga0495593_0001031 3300047673 Bacteria 16359
420 Ga0495593_0001066 3300047673 Bacteria 16000
421 Ga0495593_0004641 3300047673 Bacteria 8169
422 Ga0495602_0002865 3300048088 Bacteria 17657
423 Ga0495626_0000064 3300048091 Bacteria 142060
424 Ga0495626_0000616 3300048091 Bacteria 34739
425 Ga0495626_0005220 3300048091 Bacteria 7688
426 Ga0495626_0008700 3300048091 Bacteria 5536
427 Ga0495626_0037675 3300048091 Bacteria 2296
428 Ga0496102_0380589 3300048905 Bacteria 1328
429 Ga0496103_0454287 3300048906 Bacteria 822
430 Ga0496104_0131327 3300048907 Bacteria 2406
431 Ga0496105_0196817 3300048908 Bacteria 1646
432 Ga0496106_0029887 3300048909 Bacteria 4062
433 Ga0496107_0611160 3300048910 Bacteria 805
434 Ga0496110_0173658 3300048913 Bacteria 1956
435 Ga0496111_0743938 3300048914 Bacteria 711
436 Ga0496114_0163998 3300048917 Bacteria 1934
437 Ga0496115_0294542 3300048918 Bacteria 1330
438 Ga0496116_0001933 3300048919 Bacteria 22333
439 Ga0496116_0002265 3300048919 Bacteria 20408
440 Ga0496116_0003233 3300048919 Bacteria 16227
441 Ga0496117_0000842 3300048920 Bacteria 47420
442 Ga0496117_0004097 3300048920 Bacteria 16333
443 Ga0496117_0027683 3300048920 Bacteria 4408
444 Ga0496117_0030913 3300048920 Bacteria 4099
445 Ga0496117_0073126 3300048920 Bacteria 2288
446 Ga0496117_0073129 3300048920 Bacteria 2288
447 Ga0496117_0181823 3300048920 Bacteria 1207
448 Ga0496118_0000883 3300048921 Bacteria 47300
449 Ga0496118_0006407 3300048921 Bacteria 12951
450 Ga0496118_0006676 3300048921 Bacteria 12585
451 Ga0496118_0031350 3300048921 Bacteria 4408
452 Ga0496118_0037040 3300048921 Bacteria 3932
453 Ga0496118_0045775 3300048921 Bacteria 3410
454 Ga0496118_0062149 3300048921 Bacteria 2760
455 Ga0496118_0077420 3300048921 Bacteria 2359
456 Ga0496118_0084822 3300048921 Bacteria 2208
457 Ga0496118_0188244 3300048921 Bacteria 1237
458 Ga0496119_0049442 3300048922 Bacteria 2599
459 Ga0496119_0260448 3300048922 Bacteria 870
460 Ga0496120_0023178 3300048923 Bacteria 3889
461 Ga0496120_0031813 3300048923 Bacteria 3188
462 Ga0496121_0001195 3300048924 Bacteria 45470
463 Ga0496121_0001708 3300048924 Bacteria 35986
464 Ga0496121_0005672 3300048924 Bacteria 15875
465 Ga0496121_0011571 3300048924 Bacteria 9772
466 Ga0496121_0073629 3300048924 Bacteria 2736
467 Ga0496121_0104125 3300048924 Bacteria 2181
468 Ga0496121_0345304 3300048924 Bacteria 993
469 Ga0496122_0003219 3300048925 Bacteria 21715
470 Ga0496122_0031110 3300048925 Bacteria 4451
471 Ga0496122_0148660 3300048925 Bacteria 1450
472 Ga0496122_0178429 3300048925 Bacteria 1270
473 Ga0496123_0004383 3300048926 Bacteria 14891
474 Ga0496123_0013879 3300048926 Bacteria 6716
475 Ga0496123_0018021 3300048926 Bacteria 5649
476 Ga0496124_0007616 3300048927 Bacteria 11477
477 Ga0496124_0017966 3300048927 Bacteria 6645
478 Ga0496124_0032616 3300048927 Bacteria 4596
479 Ga0496124_0039747 3300048927 Bacteria 4074
480 Ga0496124_0047391 3300048927 Bacteria 3677
481 Ga0496124_0066372 3300048927 Bacteria 3005
482 Ga0496124_0205929 3300048927 Bacteria 1492
483 Ga0496124_0232489 3300048927 Bacteria 1377
484 Ga0496124_0444963 3300048927 Bacteria 885
485 Ga0496125_0030802 3300048928 Bacteria 4792
486 Ga0496125_0043963 3300048928 Bacteria 3784
487 Ga0496125_0057327 3300048928 Bacteria 3156
488 Ga0496125_0088619 3300048928 Bacteria 2331
489 Ga0496125_0347904 3300048928 Bacteria 886
490 Ga0496126_0016050 3300048929 Bacteria 7510
491 Ga0496126_0081906 3300048929 Bacteria 2852
492 Ga0496126_0182826 3300048929 Bacteria 1780
493 Ga0495678_000634 3300049459 Bacteria 32563
494 Ga0495678_043175 3300049459 Bacteria 1792
495 Ga0495678_087091 3300049459 Bacteria 1108
496 Ga0495678_111122 3300049459 Bacteria 934
497 Ga0495678_118010 3300049459 Bacteria 895
498 Ga0495678_152074 3300049459 Bacteria 746
499 Ga0495682_0001201 3300049460 Bacteria 14720
500 Ga0495682_0001269 3300049460 Bacteria 14164
501 Ga0495682_0032989 3300049460 Bacteria 1912
502 Ga0495682_0048385 3300049460 Bacteria 1550
503 Ga0495682_0221017 3300049460 Bacteria 671
504 Ga0501241_000300 3300049758 Bacteria 10905
505 nmdc:mga03683_16189_c1 3300050489 Bacteria 2796
506 nmdc:mga00v17_59349_c1 3300050491 Bacteria 1286
507 nmdc:mga08x19_109501_c1 3300050514 Bacteria 1841
508 nmdc:mga08x19_145026_c1 3300050514 Bacteria 1605
509 nmdc:mga08x19_183077_c1 3300050514 Bacteria 1431
510 nmdc:mga08x19_497661_c1 3300050514 Bacteria 860
511 Ga0500586_021839 3300053145 Bacteria 2024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0181823 Ga0496117_0181823_700_1149 149
2 3300048921 Ga0496118_0188244 Ga0496118_0188244_14_463 149
3 3300046452 Ga0495617_041629 Ga0495617_041629_65_616 167
4 3300046458 Ga0495591_013726 Ga0495591_013726_437_988 167
5 3300046460 Ga0495638_0001323 Ga0495638_0001323_18625_19176 167
6 3300046471 Ga0495650_0028620 Ga0495650_0028620_268_819 167
7 3300046474 Ga0495605_0051730 Ga0495605_0051730_1304_1855 167
8 3300046492 Ga0495585_0010941 Ga0495585_0010941_3021_3572 167
9 3300046501 Ga0495607_0097086 Ga0495607_0097086_1005_1556 167
10 3300046507 Ga0495606_0065396 Ga0495606_0065396_335_886 167
11 3300046520 Ga0495637_0009047 Ga0495637_0009047_1519_2070 167
12 3300046522 Ga0495643_0243694 Ga0495643_0243694_128_679 167
13 3300046524 Ga0495648_0023072 Ga0495648_0023072_1842_2393 167
14 3300046530 Ga0495654_0071286 Ga0495654_0071286_145_696 167
15 3300046538 Ga0495609_0007678 Ga0495609_0007678_3057_3608 167
16 3300046648 Ga0495611_0009705 Ga0495611_0009705_1792_2343 167
17 3300046694 Ga0495649_0014343 Ga0495649_0014343_2120_2671 167
18 3300046794 Ga0495589_0011534 Ga0495589_0011534_3056_3607 167
19 3300046810 Ga0495660_0020970 Ga0495660_0020970_2208_2759 167
20 3300047469 Ga0495673_0053598 Ga0495673_0053598_951_1502 167
21 3300047469 Ga0495673_0109911 Ga0495673_0109911_65_616 167
22 3300048091 Ga0495626_0008700 Ga0495626_0008700_3047_3598 167
23 3300049459 Ga0495678_043175 Ga0495678_043175_952_1503 167
24 3300053145 Ga0500586_021839 Ga0500586_021839_1295_1846 167
25 3300048927 Ga0496124_0032616 Ga0496124_0032616_1881_2405 172
26 iso_pu_bacteria 2599185188 2599504825 172
27 iso_pu_bacteria 2599185300 2599934850 172
28 iso_pu_bacteria 2791355520 2794597555 172
29 iso_pu_bacteria 2808606361 2808854244 172
30 iso_pu_bacteria 2808606376 2808923114 172
31 iso_pu_bacteria 2808606378 2808934276 172
32 iso_pu_bacteria 2808606380 2808945012 172
33 iso_pu_bacteria 2808606383 2808962750 172
34 iso_pu_bacteria 2808606389 2808997835 172
35 iso_pu_bacteria 2988728565 2988733870 172
36 3300006946 Ga0079104_1080606 Ga0079104_10806062 173
37 3300013100 Ga0157373_10020815 Ga0157373_100208152 173
38 3300031548 Ga0307408_100527205 Ga0307408_1005272051 173
39 3300031911 Ga0307412_10638521 Ga0307412_106385211 173
40 3300031995 Ga0307409_100681110 Ga0307409_1006811102 173
41 3300048927 Ga0496124_0232489 Ga0496124_0232489_516_1058 174
42 3300013105 Ga0157369_10002770 Ga0157369_1000277013 175
43 iso_pu_bacteria 2912963787 2912966595 175
44 3300003781 Ga0055536_1000184 Ga0055536_100018434 176
45 3300006914 Ga0075436_100203880 Ga0075436_1002038802 176
46 3300013104 Ga0157370_10052831 Ga0157370_100528313 176
47 3300013105 Ga0157369_10077336 Ga0157369_100773363 176
48 3300015261 Ga0182006_1019753 Ga0182006_10197533 176
49 3300025292 Ga0209676_1000158 Ga0209676_1000158112 176
50 3300030744 Ga0316181_1012342 Ga0316181_10123422 176
51 3300041405 Ga0439438_002003 Ga0439438_002003_1461_1997 176
52 3300041411 Ga0439466_0006451 Ga0439466_0006451_2494_3030 176
53 3300041997 Ga0439431_0000699 Ga0439431_0000699_1144_1680 176
54 3300042004 Ga0439445_0001020 Ga0439445_0001020_154_690 176
55 3300042010 Ga0439452_019457 Ga0439452_019457_60_596 176
56 3300042016 Ga0439463_004720 Ga0439463_004720_1834_2370 176
57 3300042139 Ga0450904_001607 Ga0450904_001607_2024_2572 176
58 3300042147 Ga0450910_001476 Ga0450910_001476_508_1044 176
59 3300042156 Ga0439446_0016704 Ga0439446_0016704_169_705 176
60 3300042993 Ga0439440_0011865 Ga0439440_0011865_985_1521 176
61 3300050514 nmdc:mga08x19_497661_c1 nmdc:mga08x19_497661_c1_68_616 176
62 iso_pu_bacteria 2808606445 2809214783 177
63 iso_pu_bacteria 2939651529 2939651729 177
64 3300042533 Ga0450901_002716 Ga0450901_002716_419_979 178
65 iso_pu_bacteria 2713897148 2715753213 178
66 iso_pu_bacteria 2818991456 2819658824 178
67 iso_pu_bacteria 2842843487 2842843697 178
68 iso_pu_bacteria 2919385768 2919387029 178
69 iso_pu_bacteria 2919487758 2919492281 178
70 iso_pu_bacteria 2974289157 2974290909 178
71 iso_pu_bacteria 8056172158 8056174294 178
72 iso_pu_bacteria 2511231010 2511288066 179
73 iso_pu_bacteria 2511231011 2511298648 179
74 iso_pu_bacteria 2511231014 2511312498 179
75 iso_pu_bacteria 2600255318 2601798979 179
76 iso_pu_bacteria 2603880185 2606077874 179
77 iso_pu_bacteria 2603880199 2606129951 179
78 iso_pu_bacteria 2623620443 2624480900 179
79 iso_pu_bacteria 2713897149 2715756953 179
80 iso_pu_bacteria 2718217725 2718634025 179
81 iso_pu_bacteria 2773857673 2774133723 179
82 iso_pu_bacteria 2784132063 2784264510 179
83 iso_pu_bacteria 2842832357 2842834656 179
84 iso_pu_bacteria 2852657418 2852662072 179
85 iso_pu_bacteria 2878029506 2878032832 179
86 iso_pu_bacteria 2880230671 2880233434 179
87 iso_pu_bacteria 2904518522 2904520210 179
88 iso_pu_bacteria 2904550169 2904552467 179
89 iso_pu_bacteria 2919063839 2919064880 179
90 iso_pu_bacteria 2998139840 2998142910 179
91 iso_pu_bacteria 3007718800 3007719884 179
92 iso_pu_bacteria 3007855910 3007856929 179
93 iso_pu_bacteria 8029995093 8029997884 179
94 iso_pu_bacteria 8056166840 8056168284 179
95 iso_pu_bacteria 8056569372 8056573847 179
96 3300046516 Ga0495628_0390712 Ga0495628_0390712_458_1000 180
97 3300046526 Ga0495666_0228321 Ga0495666_0228321_68_610 180
98 3300047322 Ga0495680_0008709 Ga0495680_0008709_4203_4745 180
99 iso_pu_bacteria 2511231007 2511271826 180
100 iso_pu_bacteria 2511231012 2511301544 180
101 iso_pu_bacteria 2511231015 2511318247 180
102 iso_pu_bacteria 2511231016 2511329420 180
103 iso_pu_bacteria 2511231017 2511334553 180
104 iso_pu_bacteria 2623620446 2624492234 180
105 iso_pu_bacteria 2738543015 2739258774 180
106 iso_pu_bacteria 2919697872 2919698420 180
107 iso_pu_bacteria 3007861166 3007862085 180
108 iso_pu_bacteria 8019775933 8019779151 180
109 iso_pu_bacteria 8055878733 8055882193 180
110 iso_pu_bacteria 8056125926 8056129120 180
111 3300013104 Ga0157370_10749033 Ga0157370_107490332 181
112 3300041405 Ga0439438_002109 Ga0439438_002109_5986_6531 181
113 3300041407 Ga0439447_026676 Ga0439447_026676_17_562 181
114 3300042013 Ga0439456_000106 Ga0439456_000106_21626_22171 181
115 3300042139 Ga0450904_001775 Ga0450904_001775_2195_2743 181
116 3300046463 Ga0495653_0048816 Ga0495653_0048816_237_782 181
117 3300046517 Ga0495630_0004903 Ga0495630_0004903_4599_5144 181
118 3300046524 Ga0495648_0006399 Ga0495648_0006399_1306_1854 181
119 3300046526 Ga0495666_0000675 Ga0495666_0000675_10288_10833 181
120 3300046557 Ga0495622_0139352 Ga0495622_0139352_419_964 181
121 3300046558 Ga0495633_0282145 Ga0495633_0282145_73_621 181
122 3300046679 Ga0495623_0035309 Ga0495623_0035309_255_800 181
123 3300046809 Ga0495600_0010106 Ga0495600_0010106_848_1393 181
124 3300047317 Ga0495604_0003585 Ga0495604_0003585_7195_7740 181
125 3300047322 Ga0495680_0029966 Ga0495680_0029966_1446_1991 181
126 3300047471 Ga0495684_0009792 Ga0495684_0009792_3685_4230 181
127 3300047673 Ga0495593_0001031 Ga0495593_0001031_11296_11841 181
128 iso_pu_bacteria 2511231018 2511337051 181
129 iso_pu_bacteria 2511231019 2511343398 181
130 iso_pu_bacteria 2599185288 2599879515 181
131 iso_pu_bacteria 2599185303 2599948014 181
132 iso_pu_bacteria 2738541294 2738808973 181
133 iso_pu_bacteria 2738541309 2738896333 181
134 iso_pu_bacteria 2808606377 2808929126 181
135 iso_pu_bacteria 2808606381 2808951247 181
136 iso_pu_bacteria 2808606382 2808958533 181
137 iso_pu_bacteria 2808606385 2808975111 181
138 iso_pu_bacteria 2808606388 2808991250 181
139 iso_pu_bacteria 2852612431 2852615638 181
140 iso_pu_bacteria 2852667396 2852670606 181
141 iso_pu_bacteria 2860867994 2860868905 181
142 iso_pu_bacteria 2908446538 2908447651 181
143 iso_pu_bacteria 2931396565 2931401714 181
144 iso_pu_bacteria 2945928738 2945929683 181
145 iso_pu_bacteria 2946006987 2946011968 181
146 iso_pu_bacteria 2946027586 2946029142 181
147 iso_pu_bacteria 3007511990 3007514394 181
148 iso_pu_bacteria 8056161164 8056161342 181
149 3300009036 Ga0105244_10000811 Ga0105244_1000081118 182
150 3300009036 Ga0105244_10001472 Ga0105244_100014724 182
151 3300009036 Ga0105244_10032594 Ga0105244_100325943 182
152 3300009148 Ga0105243_10000020 Ga0105243_10000020128 182
153 3300011119 Ga0105246_10000638 Ga0105246_100006385 182
154 3300013102 Ga0157371_10006154 Ga0157371_100061545 182
155 3300014497 Ga0182008_10001082 Ga0182008_100010825 182
156 3300015261 Ga0182006_1000452 Ga0182006_100045228 182
157 3300015265 Ga0182005_1016865 Ga0182005_10168652 182
158 3300015265 Ga0182005_1016866 Ga0182005_10168662 182
159 3300017792 Ga0163161_10153930 Ga0163161_101539302 182
160 3300025292 Ga0209676_1037244 Ga0209676_10372442 182
161 3300025728 Ga0207655_1000098 Ga0207655_100009821 182
162 3300025728 Ga0207655_1001112 Ga0207655_10011123 182
163 3300025728 Ga0207655_1051514 Ga0207655_10515142 182
164 3300025935 Ga0207709_10000004 Ga0207709_10000004494 182
165 3300031911 Ga0307412_10009412 Ga0307412_100094124 182
166 3300032002 Ga0307416_100853879 Ga0307416_1008538792 182
167 3300046471 Ga0495650_0018402 Ga0495650_0018402_857_1432 182
168 3300046501 Ga0495607_0006657 Ga0495607_0006657_1114_1662 182
169 3300046524 Ga0495648_0000156 Ga0495648_0000156_9373_9933 182
170 3300046664 Ga0495659_0006572 Ga0495659_0006572_1996_2544 182
171 3300046691 Ga0495670_0000777 Ga0495670_0000777_8176_8724 182
172 3300046694 Ga0495649_0000128 Ga0495649_0000128_42092_42667 182
173 3300047445 Ga0495677_0045910 Ga0495677_0045910_938_1486 182
174 3300048920 Ga0496117_0000842 Ga0496117_0000842_20265_20819 182
175 3300048921 Ga0496118_0000883 Ga0496118_0000883_26482_27036 182
176 3300048921 Ga0496118_0077420 Ga0496118_0077420_432_980 182
177 3300048924 Ga0496121_0001195 Ga0496121_0001195_18244_18798 182
178 3300048929 Ga0496126_0182826 Ga0496126_0182826_419_973 182
179 3300003781 Ga0055536_1000053 Ga0055536_100005369 183
180 3300003791 Ga0055530_10000219 Ga0055530_1000021914 183
181 3300003792 Ga0055540_1000006 Ga0055540_100000635 183
182 3300003794 Ga0055531_10000075 Ga0055531_100000758 183
183 3300005288 Ga0065714_10095408 Ga0065714_100954082 183
184 3300005353 Ga0070669_100080449 Ga0070669_1000804492 183
185 3300005457 Ga0070662_100465471 Ga0070662_1004654712 183
186 3300006946 Ga0079104_1009278 Ga0079104_10092782 183
187 3300006946 Ga0079104_1067987 Ga0079104_10679872 183
188 3300009011 Ga0105251_10022195 Ga0105251_100221952 183
189 3300009036 Ga0105244_10008103 Ga0105244_100081033 183
190 3300009036 Ga0105244_10011007 Ga0105244_100110073 183
191 3300009036 Ga0105244_10247687 Ga0105244_102476871 183
192 3300009092 Ga0105250_10000729 Ga0105250_1000072912 183
193 3300009092 Ga0105250_10014076 Ga0105250_100140762 183
194 3300013100 Ga0157373_10002417 Ga0157373_100024174 183
195 3300013100 Ga0157373_10194411 Ga0157373_101944112 183
196 3300013104 Ga0157370_10886946 Ga0157370_108869462 183
197 3300015261 Ga0182006_1004114 Ga0182006_10041144 183
198 3300015261 Ga0182006_1055911 Ga0182006_10559112 183
199 3300017792 Ga0163161_10043764 Ga0163161_100437642 183
200 3300025291 Ga0209675_1037741 Ga0209675_10377412 183
201 3300025292 Ga0209676_1000002 Ga0209676_1000002998 183
202 3300025298 Ga0209050_1000006 Ga0209050_1000006572 183
203 3300025303 Ga0209051_1000001 Ga0209051_1000001998 183
204 3300025304 Ga0209257_1000029 Ga0209257_1000029572 183
205 3300025711 Ga0207696_1000002 Ga0207696_1000002909 183
206 3300025711 Ga0207696_1011058 Ga0207696_10110582 183
207 3300025728 Ga0207655_1002318 Ga0207655_100231811 183
208 3300025728 Ga0207655_1003003 Ga0207655_10030036 183
209 3300025735 Ga0207713_1000518 Ga0207713_100051816 183
210 3300025735 Ga0207713_1001602 Ga0207713_100160215 183
211 3300025735 Ga0207713_1008826 Ga0207713_10088262 183
212 3300025923 Ga0207681_10070699 Ga0207681_100706992 183
213 3300027111 Ga0209281_1015200 Ga0209281_10152001 183
214 3300027111 Ga0209281_1018206 Ga0209281_10182062 183
215 3300027111 Ga0209281_1040485 Ga0209281_10404851 183
216 3300030734 Ga0316179_1092773 Ga0316179_10927732 183
217 3300031548 Ga0307408_100051210 Ga0307408_1000512102 183
218 3300031731 Ga0307405_10222604 Ga0307405_102226042 183
219 3300031903 Ga0307407_10304346 Ga0307407_103043462 183
220 3300031911 Ga0307412_10190674 Ga0307412_101906742 183
221 3300031911 Ga0307412_10371243 Ga0307412_103712432 183
222 3300031911 Ga0307412_10812569 Ga0307412_108125692 183
223 3300032002 Ga0307416_101436891 Ga0307416_1014368912 183
224 3300032005 Ga0307411_10011100 Ga0307411_100111003 183
225 3300041405 Ga0439438_002486 Ga0439438_002486_5265_5816 183
226 3300041407 Ga0439447_021830 Ga0439447_021830_809_1360 183
227 3300041407 Ga0439447_030863 Ga0439447_030863_380_931 183
228 3300041411 Ga0439466_0004588 Ga0439466_0004588_2926_3477 183
229 3300042006 Ga0439432_013494 Ga0439432_013494_359_910 183
230 3300042009 Ga0439451_004649 Ga0439451_004649_1760_2311 183
231 3300042010 Ga0439452_000317 Ga0439452_000317_1997_2548 183
232 3300042016 Ga0439463_100564 Ga0439463_100564_38_589 183
233 3300042115 Ga0450911_000076 Ga0450911_000076_34403_34954 183
234 3300042138 Ga0450903_028371 Ga0450903_028371_178_729 183
235 3300042142 Ga0450905_004627 Ga0450905_004627_40_594 183
236 3300042145 Ga0450906_000334 Ga0450906_000334_5994_6545 183
237 3300046452 Ga0495617_008208 Ga0495617_008208_2391_2942 183
238 3300046454 Ga0495592_0007551 Ga0495592_0007551_3190_3741 183
239 3300046457 Ga0495590_0000641 Ga0495590_0000641_12458_13009 183
240 3300046458 Ga0495591_000166 Ga0495591_000166_5847_6398 183
241 3300046460 Ga0495638_0002354 Ga0495638_0002354_2308_2859 183
242 3300046463 Ga0495653_0006240 Ga0495653_0006240_4578_5129 183
243 3300046472 Ga0495580_0072721 Ga0495580_0072721_387_938 183
244 3300046501 Ga0495607_0000041 Ga0495607_0000041_103817_104368 183
245 3300046515 Ga0495620_0009488 Ga0495620_0009488_1490_2044 183
246 3300046526 Ga0495666_0005483 Ga0495666_0005483_3143_3694 183
247 3300046543 Ga0495645_0019996 Ga0495645_0019996_1981_2532 183
248 3300046557 Ga0495622_0009353 Ga0495622_0009353_1472_2023 183
249 3300046642 Ga0495634_0008313 Ga0495634_0008313_5220_5771 183
250 3300046680 Ga0495646_0011972 Ga0495646_0011972_1406_1957 183
251 3300046689 Ga0495613_0004677 Ga0495613_0004677_3182_3733 183
252 3300046690 Ga0495624_0000237 Ga0495624_0000237_5149_5700 183
253 3300046694 Ga0495649_0002159 Ga0495649_0002159_2056_2607 183
254 3300046809 Ga0495600_0009244 Ga0495600_0009244_3246_3797 183
255 3300047317 Ga0495604_0178561 Ga0495604_0178561_244_795 183
256 3300047320 Ga0495672_0000787 Ga0495672_0000787_5154_5705 183
257 3300047320 Ga0495672_0020182 Ga0495672_0020182_1983_2537 183
258 3300047321 Ga0495676_0002622 Ga0495676_0002622_3141_3692 183
259 3300047322 Ga0495680_0005904 Ga0495680_0005904_9125_9676 183
260 3300047470 Ga0495681_0001105 Ga0495681_0001105_14264_14815 183
261 3300047471 Ga0495684_0004126 Ga0495684_0004126_7644_8195 183
262 3300047673 Ga0495593_0004641 Ga0495593_0004641_1081_1632 183
263 3300048088 Ga0495602_0002865 Ga0495602_0002865_3379_3930 183
264 3300048091 Ga0495626_0037675 Ga0495626_0037675_24_578 183
265 3300048919 Ga0496116_0002265 Ga0496116_0002265_16544_17095 183
266 3300048919 Ga0496116_0003233 Ga0496116_0003233_3250_3801 183
267 3300048920 Ga0496117_0004097 Ga0496117_0004097_12453_13004 183
268 3300048920 Ga0496117_0073126 Ga0496117_0073126_208_759 183
269 3300048920 Ga0496117_0073129 Ga0496117_0073129_208_759 183
270 3300048921 Ga0496118_0006676 Ga0496118_0006676_3403_3954 183
271 3300048921 Ga0496118_0037040 Ga0496118_0037040_1530_2081 183
272 3300048921 Ga0496118_0084822 Ga0496118_0084822_1530_2081 183
273 3300048922 Ga0496119_0049442 Ga0496119_0049442_1360_1911 183
274 3300048922 Ga0496119_0260448 Ga0496119_0260448_205_756 183
275 3300048923 Ga0496120_0031813 Ga0496120_0031813_2214_2765 183
276 3300048924 Ga0496121_0005672 Ga0496121_0005672_3155_3706 183
277 3300048925 Ga0496122_0031110 Ga0496122_0031110_449_1000 183
278 3300048925 Ga0496122_0148660 Ga0496122_0148660_133_684 183
279 3300048925 Ga0496122_0178429 Ga0496122_0178429_635_1186 183
280 3300048926 Ga0496123_0004383 Ga0496123_0004383_2645_3196 183
281 3300048926 Ga0496123_0013879 Ga0496123_0013879_3101_3652 183
282 3300048927 Ga0496124_0017966 Ga0496124_0017966_1618_2169 183
283 3300048927 Ga0496124_0047391 Ga0496124_0047391_343_894 183
284 3300048927 Ga0496124_0205929 Ga0496124_0205929_782_1333 183
285 3300048927 Ga0496124_0444963 Ga0496124_0444963_136_687 183
286 3300048928 Ga0496125_0057327 Ga0496125_0057327_365_916 183
287 3300049459 Ga0495678_152074 Ga0495678_152074_134_685 183
288 3300049460 Ga0495682_0001201 Ga0495682_0001201_11966_12517 183
289 3300049758 Ga0501241_000300 Ga0501241_000300_6967_7518 183
290 3300003578 Ga0006562J51391_1049091 Ga0006562J51391_10490912 184
291 3300003791 Ga0055530_10033959 Ga0055530_100339593 184
292 3300005288 Ga0065714_10006254 Ga0065714_100062542 184
293 3300005288 Ga0065714_10006254 Ga0065714_100062543 184
294 3300005288 Ga0065714_10093832 Ga0065714_100938321 184
295 3300005289 Ga0065704_10122367 Ga0065704_101223671 184
296 3300005289 Ga0065704_10235273 Ga0065704_102352732 184
297 3300006051 Ga0075364_10505533 Ga0075364_105055331 184
298 3300006058 Ga0075432_10032024 Ga0075432_100320242 184
299 3300006058 Ga0075432_10173394 Ga0075432_101733941 184
300 3300006177 Ga0075362_10012032 Ga0075362_100120322 184
301 3300006353 Ga0075370_10220410 Ga0075370_102204101 184
302 3300006914 Ga0075436_100127699 Ga0075436_1001276992 184
303 3300006914 Ga0075436_100169946 Ga0075436_1001699462 184
304 3300009011 Ga0105251_10044940 Ga0105251_100449402 184
305 3300009036 Ga0105244_10000325 Ga0105244_1000032516 184
306 3300009036 Ga0105244_10018986 Ga0105244_100189862 184
307 3300009036 Ga0105244_10038322 Ga0105244_100383222 184
308 3300009092 Ga0105250_10028361 Ga0105250_100283612 184
309 3300009148 Ga0105243_11077739 Ga0105243_110777391 184
310 3300013100 Ga0157373_10077384 Ga0157373_100773842 184
311 3300013104 Ga0157370_10336339 Ga0157370_103363392 184
312 3300013306 Ga0163162_11181261 Ga0163162_111812612 184
313 3300014497 Ga0182008_10000907 Ga0182008_1000090715 184
314 3300014497 Ga0182008_10014036 Ga0182008_100140361 184
315 3300014497 Ga0182008_10019053 Ga0182008_100190532 184
316 3300015261 Ga0182006_1000387 Ga0182006_100038724 184
317 3300015262 Ga0182007_10000108 Ga0182007_1000010825 184
318 3300015262 Ga0182007_10070302 Ga0182007_100703022 184
319 3300015265 Ga0182005_1000969 Ga0182005_10009695 184
320 3300015265 Ga0182005_1016478 Ga0182005_10164782 184
321 3300017792 Ga0163161_10025445 Ga0163161_100254452 184
322 3300025292 Ga0209676_1003284 Ga0209676_10032845 184
323 3300025298 Ga0209050_1000763 Ga0209050_100076317 184
324 3300025303 Ga0209051_1004500 Ga0209051_10045007 184
325 3300025711 Ga0207696_1022676 Ga0207696_10226762 184
326 3300025728 Ga0207655_1000410 Ga0207655_100041016 184
327 3300025728 Ga0207655_1015886 Ga0207655_10158863 184
328 3300027907 Ga0207428_10004701 Ga0207428_100047017 184
329 3300027907 Ga0207428_10154607 Ga0207428_101546073 184
330 3300027907 Ga0207428_10156838 Ga0207428_101568382 184
331 3300041405 Ga0439438_007965 Ga0439438_007965_208_768 184
332 3300041405 Ga0439438_083656 Ga0439438_083656_71_628 184
333 3300041407 Ga0439447_001001 Ga0439447_001001_4487_5044 184
334 3300041407 Ga0439447_003818 Ga0439447_003818_4024_4584 184
335 3300041407 Ga0439447_050641 Ga0439447_050641_321_875 184
336 3300041411 Ga0439466_0001936 Ga0439466_0001936_4724_5281 184
337 3300041411 Ga0439466_0005508 Ga0439466_0005508_247_807 184
338 3300041411 Ga0439466_0037751 Ga0439466_0037751_541_1098 184
339 3300042006 Ga0439432_015982 Ga0439432_015982_323_880 184
340 3300042009 Ga0439451_013653 Ga0439451_013653_125_682 184
341 3300042009 Ga0439451_014806 Ga0439451_014806_60_617 184
342 3300042010 Ga0439452_000906 Ga0439452_000906_6373_6933 184
343 3300042010 Ga0439452_001174 Ga0439452_001174_4120_4677 184
344 3300042010 Ga0439452_001512 Ga0439452_001512_3006_3563 184
345 3300042013 Ga0439456_002651 Ga0439456_002651_2367_2924 184
346 3300042013 Ga0439456_003205 Ga0439456_003205_1416_1973 184
347 3300042138 Ga0450903_005731 Ga0450903_005731_1465_2022 184
348 3300042146 Ga0450907_000318 Ga0450907_000318_4981_5538 184
349 3300042435 Ga0439434_0000291 Ga0439434_0000291_4855_5412 184
350 3300042461 Ga0439460_0001141 Ga0439460_0001141_4844_5401 184
351 3300042461 Ga0439460_0002224 Ga0439460_0002224_3842_4399 184
352 3300042993 Ga0439440_0016931 Ga0439440_0016931_915_1472 184
353 3300046452 Ga0495617_000512 Ga0495617_000512_8497_9054 184
354 3300046452 Ga0495617_005924 Ga0495617_005924_2525_3115 184
355 3300046452 Ga0495617_026493 Ga0495617_026493_311_868 184
356 3300046453 Ga0495627_036377 Ga0495627_036377_675_1232 184
357 3300046457 Ga0495590_0013926 Ga0495590_0013926_1122_1679 184
358 3300046457 Ga0495590_0093053 Ga0495590_0093053_49_603 184
359 3300046458 Ga0495591_012328 Ga0495591_012328_1460_2050 184
360 3300046460 Ga0495638_0003194 Ga0495638_0003194_5178_5735 184
361 3300046460 Ga0495638_0008642 Ga0495638_0008642_4693_5250 184
362 3300046460 Ga0495638_0017200 Ga0495638_0017200_1750_2307 184
363 3300046460 Ga0495638_0062321 Ga0495638_0062321_1531_2085 184
364 3300046471 Ga0495650_0007441 Ga0495650_0007441_4021_4611 184
365 3300046472 Ga0495580_0264088 Ga0495580_0264088_22_576 184
366 3300046474 Ga0495605_0002335 Ga0495605_0002335_1534_2124 184
367 3300046474 Ga0495605_0034414 Ga0495605_0034414_564_1121 184
368 3300046475 Ga0495639_0000053 Ga0495639_0000053_20807_21361 184
369 3300046491 Ga0495584_0000120 Ga0495584_0000120_32662_33216 184
370 3300046491 Ga0495584_0000715 Ga0495584_0000715_5116_5673 184
371 3300046491 Ga0495584_0001056 Ga0495584_0001056_8377_8934 184
372 3300046491 Ga0495584_0006307 Ga0495584_0006307_3911_4468 184
373 3300046499 Ga0495594_0006338 Ga0495594_0006338_2270_2824 184
374 3300046501 Ga0495607_0003897 Ga0495607_0003897_8517_9107 184
375 3300046501 Ga0495607_0021681 Ga0495607_0021681_736_1293 184
376 3300046506 Ga0495583_0004324 Ga0495583_0004324_8410_8967 184
377 3300046506 Ga0495583_0029883 Ga0495583_0029883_273_827 184
378 3300046507 Ga0495606_0002232 Ga0495606_0002232_8492_9049 184
379 3300046507 Ga0495606_0002606 Ga0495606_0002606_5934_6491 184
380 3300046512 Ga0495610_0030925 Ga0495610_0030925_1541_2131 184
381 3300046513 Ga0495616_0006004 Ga0495616_0006004_460_1017 184
382 3300046515 Ga0495620_0001300 Ga0495620_0001300_2156_2746 184
383 3300046518 Ga0495631_0000175 Ga0495631_0000175_19623_20180 184
384 3300046518 Ga0495631_0038208 Ga0495631_0038208_1304_1858 184
385 3300046519 Ga0495632_0011499 Ga0495632_0011499_2485_3042 184
386 3300046520 Ga0495637_0002447 Ga0495637_0002447_7312_7866 184
387 3300046520 Ga0495637_0009974 Ga0495637_0009974_3467_4024 184
388 3300046523 Ga0495644_0059208 Ga0495644_0059208_433_1023 184
389 3300046524 Ga0495648_0002231 Ga0495648_0002231_8641_9198 184
390 3300046524 Ga0495648_0059239 Ga0495648_0059239_105_695 184
391 3300046524 Ga0495648_0077930 Ga0495648_0077930_1045_1599 184
392 3300046530 Ga0495654_0000600 Ga0495654_0000600_6635_7189 184
393 3300046530 Ga0495654_0011501 Ga0495654_0011501_2150_2740 184
394 3300046538 Ga0495609_0147192 Ga0495609_0147192_130_720 184
395 3300046538 Ga0495609_0276928 Ga0495609_0276928_49_612 184
396 3300046542 Ga0495597_0019620 Ga0495597_0019620_771_1328 184
397 3300046542 Ga0495597_0039322 Ga0495597_0039322_949_1509 184
398 3300046542 Ga0495597_0295732 Ga0495597_0295732_30_587 184
399 3300046557 Ga0495622_0000249 Ga0495622_0000249_27780_28334 184
400 3300046558 Ga0495633_0278228 Ga0495633_0278228_174_731 184
401 3300046615 Ga0495656_0386453 Ga0495656_0386453_134_688 184
402 3300046660 Ga0495625_0005062 Ga0495625_0005062_4769_5326 184
403 3300046660 Ga0495625_0006520 Ga0495625_0006520_7439_7996 184
404 3300046660 Ga0495625_0013111 Ga0495625_0013111_4343_4897 184
405 3300046660 Ga0495625_0045094 Ga0495625_0045094_2168_2758 184
406 3300046664 Ga0495659_0000119 Ga0495659_0000119_29053_29607 184
407 3300046665 Ga0495661_0016567 Ga0495661_0016567_2024_2581 184
408 3300046665 Ga0495661_0022049 Ga0495661_0022049_1601_2191 184
409 3300046684 Ga0495669_0394871 Ga0495669_0394871_87_641 184
410 3300046691 Ga0495670_0014230 Ga0495670_0014230_2307_2864 184
411 3300046691 Ga0495670_0137409 Ga0495670_0137409_124_714 184
412 3300046692 Ga0495671_0000210 Ga0495671_0000210_16059_16613 184
413 3300046692 Ga0495671_0096353 Ga0495671_0096353_518_1075 184
414 3300046692 Ga0495671_0097171 Ga0495671_0097171_837_1394 184
415 3300046694 Ga0495649_0002235 Ga0495649_0002235_4745_5299 184
416 3300046694 Ga0495649_0016669 Ga0495649_0016669_1494_2051 184
417 3300046694 Ga0495649_0066934 Ga0495649_0066934_1073_1663 184
418 3300046794 Ga0495589_0000998 Ga0495589_0000998_9668_10225 184
419 3300046794 Ga0495589_0024743 Ga0495589_0024743_1329_1883 184
420 3300046794 Ga0495589_0058249 Ga0495589_0058249_745_1335 184
421 3300046810 Ga0495660_0003215 Ga0495660_0003215_7248_7805 184
422 3300046810 Ga0495660_0005612 Ga0495660_0005612_5068_5622 184
423 3300046810 Ga0495660_0006326 Ga0495660_0006326_1293_1868 184
424 3300047315 Ga0495581_0000629 Ga0495581_0000629_2071_2625 184
425 3300047320 Ga0495672_0009495 Ga0495672_0009495_2007_2561 184
426 3300047320 Ga0495672_0050921 Ga0495672_0050921_1688_2251 184
427 3300047320 Ga0495672_0081496 Ga0495672_0081496_388_945 184
428 3300047320 Ga0495672_0134893 Ga0495672_0134893_333_890 184
429 3300047323 Ga0495683_0000356 Ga0495683_0000356_14720_15310 184
430 3300047323 Ga0495683_0004833 Ga0495683_0004833_2801_3358 184
431 3300047323 Ga0495683_0014340 Ga0495683_0014340_1535_2089 184
432 3300047323 Ga0495683_0024409 Ga0495683_0024409_2111_2665 184
433 3300047443 Ga0495687_047718 Ga0495687_047718_1140_1694 184
434 3300047469 Ga0495673_0003971 Ga0495673_0003971_3654_4244 184
435 3300047469 Ga0495673_0069390 Ga0495673_0069390_368_922 184
436 3300047469 Ga0495673_0237584 Ga0495673_0237584_16_606 184
437 3300047470 Ga0495681_0001748 Ga0495681_0001748_2528_3085 184
438 3300047470 Ga0495681_0002137 Ga0495681_0002137_11605_12195 184
439 3300047470 Ga0495681_0007590 Ga0495681_0007590_1654_2208 184
440 3300047673 Ga0495593_0001066 Ga0495593_0001066_15040_15594 184
441 3300048091 Ga0495626_0000064 Ga0495626_0000064_134792_135349 184
442 3300048091 Ga0495626_0000616 Ga0495626_0000616_6500_7054 184
443 3300048091 Ga0495626_0005220 Ga0495626_0005220_3833_4387 184
444 3300048905 Ga0496102_0380589 Ga0496102_0380589_311_868 184
445 3300048907 Ga0496104_0131327 Ga0496104_0131327_642_1196 184
446 3300048908 Ga0496105_0196817 Ga0496105_0196817_402_956 184
447 3300048909 Ga0496106_0029887 Ga0496106_0029887_1944_2498 184
448 3300048910 Ga0496107_0611160 Ga0496107_0611160_32_586 184
449 3300048913 Ga0496110_0173658 Ga0496110_0173658_125_682 184
450 3300048919 Ga0496116_0001933 Ga0496116_0001933_20612_21166 184
451 3300048920 Ga0496117_0030913 Ga0496117_0030913_251_805 184
452 3300048921 Ga0496118_0006407 Ga0496118_0006407_11510_12064 184
453 3300048921 Ga0496118_0062149 Ga0496118_0062149_1928_2485 184
454 3300048924 Ga0496121_0001708 Ga0496121_0001708_6368_6922 184
455 3300048925 Ga0496122_0003219 Ga0496122_0003219_4797_5351 184
456 3300048926 Ga0496123_0018021 Ga0496123_0018021_740_1294 184
457 3300048927 Ga0496124_0066372 Ga0496124_0066372_350_907 184
458 3300048928 Ga0496125_0088619 Ga0496125_0088619_268_858 184
459 3300049459 Ga0495678_000634 Ga0495678_000634_15943_16497 184
460 3300049459 Ga0495678_087091 Ga0495678_087091_126_683 184
461 3300049459 Ga0495678_118010 Ga0495678_118010_117_707 184
462 3300049460 Ga0495682_0001269 Ga0495682_0001269_8484_9041 184
463 3300049460 Ga0495682_0032989 Ga0495682_0032989_28_582 184
464 3300049460 Ga0495682_0048385 Ga0495682_0048385_733_1287 184
465 3300049460 Ga0495682_0221017 Ga0495682_0221017_17_607 184
466 3300050489 nmdc:mga03683_16189_c1 nmdc:mga03683_16189_c1_1179_1736 184
467 3300050491 nmdc:mga00v17_59349_c1 nmdc:mga00v17_59349_c1_293_850 184
468 3300050514 nmdc:mga08x19_109501_c1 nmdc:mga08x19_109501_c1_922_1479 184
469 3300050514 nmdc:mga08x19_145026_c1 nmdc:mga08x19_145026_c1_601_1158 184
470 3300050514 nmdc:mga08x19_183077_c1 nmdc:mga08x19_183077_c1_716_1273 184
471 iso_pu_bacteria 2919456309 2919460680 184
472 3300005290 Ga0065712_10094112 Ga0065712_100941122 185
473 3300005331 Ga0070670_100002020 Ga0070670_1000020208 185
474 3300005548 Ga0070665_100031898 Ga0070665_1000318982 185
475 3300009011 Ga0105251_10002037 Ga0105251_1000203714 185
476 3300009011 Ga0105251_10004166 Ga0105251_100041663 185
477 3300009092 Ga0105250_10000675 Ga0105250_100006759 185
478 3300013102 Ga0157371_10000635 Ga0157371_1000063520 185
479 3300013104 Ga0157370_10002554 Ga0157370_100025544 185
480 3300013104 Ga0157370_10015083 Ga0157370_100150837 185
481 3300013306 Ga0163162_10078364 Ga0163162_100783643 185
482 3300014497 Ga0182008_10003600 Ga0182008_100036008 185
483 3300015262 Ga0182007_10031330 Ga0182007_100313302 185
484 3300015265 Ga0182005_1010529 Ga0182005_10105291 185
485 3300017792 Ga0163161_10006428 Ga0163161_100064286 185
486 3300025711 Ga0207696_1000052 Ga0207696_1000052267 185
487 3300025735 Ga0207713_1000528 Ga0207713_100052816 185
488 3300025735 Ga0207713_1064025 Ga0207713_10640252 185
489 3300025925 Ga0207650_10000988 Ga0207650_100009888 185
490 3300030521 Ga0307511_10048150 Ga0307511_100481502 185
491 3300031731 Ga0307405_10002609 Ga0307405_100026093 185
492 3300031911 Ga0307412_10012063 Ga0307412_100120632 185
493 3300041405 Ga0439438_061710 Ga0439438_061710_134_694 185
494 3300041407 Ga0439447_000480 Ga0439447_000480_5442_6002 185
495 3300041411 Ga0439466_0010463 Ga0439466_0010463_407_967 185
496 3300041411 Ga0439466_0135309 Ga0439466_0135309_57_617 185
497 3300042009 Ga0439451_020384 Ga0439451_020384_468_1028 185
498 3300042013 Ga0439456_019703 Ga0439456_019703_252_812 185
499 3300042016 Ga0439463_056213 Ga0439463_056213_73_633 185
500 3300042131 Ga0450894_039758 Ga0450894_039758_96_656 185
501 3300042134 Ga0450898_001471 Ga0450898_001471_1422_1982 185
502 3300042135 Ga0450899_019939 Ga0450899_019939_127_687 185
503 3300042138 Ga0450903_002450 Ga0450903_002450_274_834 185
504 3300042142 Ga0450905_001857 Ga0450905_001857_197_757 185
505 3300042142 Ga0450905_050897 Ga0450905_050897_46_606 185
506 3300046452 Ga0495617_083260 Ga0495617_083260_56_643 185
507 3300046457 Ga0495590_0011487 Ga0495590_0011487_2604_3191 185
508 3300046458 Ga0495591_005461 Ga0495591_005461_4113_4700 185
509 3300046460 Ga0495638_0001052 Ga0495638_0001052_5027_5614 185
510 3300046460 Ga0495638_0003330 Ga0495638_0003330_9070_9627 185
511 3300046460 Ga0495638_0073947 Ga0495638_0073947_859_1419 185
512 3300046471 Ga0495650_0004713 Ga0495650_0004713_4174_4731 185
513 3300046474 Ga0495605_0000778 Ga0495605_0000778_17416_17976 185
514 3300046475 Ga0495639_0009681 Ga0495639_0009681_2265_2858 185
515 3300046491 Ga0495584_0048517 Ga0495584_0048517_1561_2118 185
516 3300046491 Ga0495584_0229071 Ga0495584_0229071_231_818 185
517 3300046499 Ga0495594_0095845 Ga0495594_0095845_1032_1625 185
518 3300046501 Ga0495607_0004231 Ga0495607_0004231_5202_5789 185
519 3300046501 Ga0495607_0124651 Ga0495607_0124651_161_721 185
520 3300046507 Ga0495606_0008134 Ga0495606_0008134_5562_6122 185
521 3300046512 Ga0495610_0028229 Ga0495610_0028229_1897_2454 185
522 3300046513 Ga0495616_0061733 Ga0495616_0061733_475_1062 185
523 3300046519 Ga0495632_0009607 Ga0495632_0009607_4350_4937 185
524 3300046519 Ga0495632_0192085 Ga0495632_0192085_19_579 185
525 3300046520 Ga0495637_0009526 Ga0495637_0009526_2118_2675 185
526 3300046520 Ga0495637_0046631 Ga0495637_0046631_357_920 185
527 3300046523 Ga0495644_0000088 Ga0495644_0000088_40169_40756 185
528 3300046524 Ga0495648_0109395 Ga0495648_0109395_508_1101 185
529 3300046528 Ga0495642_0000044 Ga0495642_0000044_50954_51514 185
530 3300046530 Ga0495654_0030206 Ga0495654_0030206_526_1113 185
531 3300046538 Ga0495609_0005054 Ga0495609_0005054_2311_2904 185
532 3300046542 Ga0495597_0001357 Ga0495597_0001357_3131_3691 185
533 3300046542 Ga0495597_0022830 Ga0495597_0022830_1896_2462 185
534 3300046542 Ga0495597_0125001 Ga0495597_0125001_289_876 185
535 3300046557 Ga0495622_0002237 Ga0495622_0002237_6695_7255 185
536 3300046557 Ga0495622_0045277 Ga0495622_0045277_1262_1855 185
537 3300046615 Ga0495656_0287849 Ga0495656_0287849_255_818 185
538 3300046615 Ga0495656_0434772 Ga0495656_0434772_53_640 185
539 3300046648 Ga0495611_0001709 Ga0495611_0001709_5398_5985 185
540 3300046648 Ga0495611_0078823 Ga0495611_0078823_621_1181 185
541 3300046674 Ga0495588_0026241 Ga0495588_0026241_1140_1700 185
542 3300046674 Ga0495588_0036889 Ga0495588_0036889_283_876 185
543 3300046691 Ga0495670_0001715 Ga0495670_0001715_8142_8735 185
544 3300046692 Ga0495671_0004486 Ga0495671_0004486_7174_7755 185
545 3300046692 Ga0495671_0006039 Ga0495671_0006039_1247_1834 185
546 3300046692 Ga0495671_0007263 Ga0495671_0007263_1397_1957 185
547 3300046692 Ga0495671_0058212 Ga0495671_0058212_1278_1841 185
548 3300046694 Ga0495649_0003135 Ga0495649_0003135_5010_5597 185
549 3300046810 Ga0495660_0010403 Ga0495660_0010403_2382_2969 185
550 3300046810 Ga0495660_0019904 Ga0495660_0019904_2336_2929 185
551 3300047320 Ga0495672_0001650 Ga0495672_0001650_20579_21166 185
552 3300047320 Ga0495672_0001897 Ga0495672_0001897_527_1114 185
553 3300047323 Ga0495683_0002013 Ga0495683_0002013_6851_7438 185
554 3300047323 Ga0495683_0044439 Ga0495683_0044439_1398_1991 185
555 3300047323 Ga0495683_0135393 Ga0495683_0135393_149_706 185
556 3300047469 Ga0495673_0000465 Ga0495673_0000465_36270_36830 185
557 3300047469 Ga0495673_0002619 Ga0495673_0002619_9620_10180 185
558 3300047469 Ga0495673_0003008 Ga0495673_0003008_5826_6413 185
559 3300047469 Ga0495673_0018736 Ga0495673_0018736_1042_1602 185
560 3300047470 Ga0495681_0000353 Ga0495681_0000353_6658_7218 185
561 3300047470 Ga0495681_0002538 Ga0495681_0002538_8184_8741 185
562 3300047470 Ga0495681_0213420 Ga0495681_0213420_49_609 185
563 3300048906 Ga0496103_0454287 Ga0496103_0454287_247_807 185
564 3300048914 Ga0496111_0743938 Ga0496111_0743938_23_610 185
565 3300048917 Ga0496114_0163998 Ga0496114_0163998_383_943 185
566 3300048918 Ga0496115_0294542 Ga0496115_0294542_23_583 185
567 3300048920 Ga0496117_0027683 Ga0496117_0027683_2892_3452 185
568 3300048921 Ga0496118_0031350 Ga0496118_0031350_957_1517 185
569 3300048921 Ga0496118_0045775 Ga0496118_0045775_2403_2963 185
570 3300048923 Ga0496120_0023178 Ga0496120_0023178_1108_1668 185
571 3300048924 Ga0496121_0011571 Ga0496121_0011571_6450_7010 185
572 3300048924 Ga0496121_0073629 Ga0496121_0073629_2034_2594 185
573 3300048924 Ga0496121_0104125 Ga0496121_0104125_1192_1752 185
574 3300048924 Ga0496121_0345304 Ga0496121_0345304_210_803 185
575 3300048927 Ga0496124_0007616 Ga0496124_0007616_5017_5604 185
576 3300048927 Ga0496124_0039747 Ga0496124_0039747_2630_3190 185
577 3300048928 Ga0496125_0030802 Ga0496125_0030802_1132_1725 185
578 3300048928 Ga0496125_0043963 Ga0496125_0043963_2777_3337 185
579 3300048928 Ga0496125_0347904 Ga0496125_0347904_168_728 185
580 3300048929 Ga0496126_0016050 Ga0496126_0016050_4316_4876 185
581 3300048929 Ga0496126_0081906 Ga0496126_0081906_236_796 185
582 3300049459 Ga0495678_111122 Ga0495678_111122_80_640 185
583 3300002737 JGI25162J39368_1000727 JGI25162J39368_10007273 186
584 3300002771 JGI25163J39215_1000391 JGI25163J39215_100039113 186
585 3300002772 JGI25164J39214_1000433 JGI25164J39214_100043320 186
586 3300003214 JGI25165J46597_1000831 JGI25165J46597_100083120 186
587 3300025207 Ga0209760_100236 Ga0209760_10023619 186
588 3300025231 Ga0207427_100094 Ga0207427_100094126 186
589 3300025233 Ga0209437_100187 Ga0209437_100187126 186
590 3300025261 Ga0209233_1000196 Ga0209233_1000196126 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03886

ABC_trans_aux

ABC-type transport auxiliary lipoprotein component

38

183

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8q2d-assembly1.cif.gz_A crystal structure of the e. coli pqic lipoprotein residues 17-187 0.8166 24 173
6osx-assembly1.cif.gz_A crystal structure of uncharacterized protein ecl_02694 0.8007 22 176
6osx-assembly1.cif.gz_A crystal structure of uncharacterized protein ecl_02694 0.7958 22 176
8q2d-assembly1.cif.gz_A crystal structure of the e. coli pqic lipoprotein residues 17-187 0.7761 24 173
4kz1-assembly1.cif.gz_A-2 crystal structure of the soluble domain of virb8 from bartonella grahamii 0.7266 102 150
ID Description Score Start End Superfamily
af_P0AB10_20_185_3.40.50.10610 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.8122 23 173 3.40.50.10610
af_P0AB10_20_185_3.40.50.10610 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component 0.7397 23 173 3.40.50.10610
af_O33346_31_139_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7345 104 148 3.10.450.50
4kz1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.7266 102 150 3.10.450.230
af_P34406_1_98_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.726 104 148 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6I6V4U3-F1-model_v4 deleted 0.9342 8 186
AF-A0A2Z4RCN0-F1-model_v4 ABC-type transport auxiliary lipoprotein component domain-containing protein 0.9253 5 185
AF-A0A7Z3CEH0-F1-model_v4 Membrane integrity-associated transporter subunit PqiC 0.9252 21 183
AF-A0A2M8UX81-F1-model_v4 ABC-type transport auxiliary lipoprotein component domain-containing protein 0.9234 19 183
AF-A0A143GBF5-F1-model_v4 Membrane integrity-associated transporter subunit PqiC 0.921 1 186

Feature Viewer

pLDDT pTM Quality
83.59 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map