F466943

General Info

Members Datasets Scaffolds Average Seq Length
590 229 1180 118

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10918384|Ga0070701_109183841
Length 134
Sequence MSSASTNLNMPQLDPEHIAISKSKGIKIDWKDKHRSEYSLAYLRDECPCATCTGAHGTQPEKTNYSKPANDPFPMFKPVLKMLNVEPVGNYAVRIYWSDGHSSGIYSYERLREICPCAVCRFAREQIETAVTRQ

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
211 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 27.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10918384 3300005438 Unclassified 605
2 Ga0070658_10000944 3300005327 Bacteria 24840
3 Ga0070658_10707902 3300005327 Unclassified 874
4 Ga0070676_10894838 3300005328 Bacteria 661
5 Ga0070683_100109409 3300005329 Bacteria 2606
6 Ga0070683_100250232 3300005329 Bacteria 1685
7 Ga0070683_100508052 3300005329 Bacteria 1151
8 Ga0070683_100972846 3300005329 Bacteria 815
9 Ga0070690_100143383 3300005330 Bacteria 1623
10 Ga0068869_100608910 3300005334 Bacteria 923
11 Ga0068869_100855807 3300005334 Unclassified 784
12 Ga0070666_10006250 3300005335 Bacteria 7328
13 Ga0070680_100167349 3300005336 Bacteria 1849
14 Ga0068868_100787228 3300005338 Unclassified 857
15 Ga0068868_101185850 3300005338 Unclassified 705
16 Ga0068868_101798358 3300005338 Unclassified 579
17 Ga0070660_100000964 3300005339 Bacteria 19258
18 Ga0070660_100853066 3300005339 Unclassified 767
19 Ga0070671_100051600 3300005355 Bacteria 3421
20 Ga0070671_100129518 3300005355 Bacteria 2125
21 Ga0070673_100103484 3300005364 Bacteria 2349
22 Ga0070673_101128899 3300005364 Unclassified 733
23 Ga0070667_100050314 3300005367 Bacteria 3511
24 Ga0070667_100291209 3300005367 Bacteria 1468
25 Ga0070667_100556170 3300005367 Bacteria 1055
26 Ga0070709_10076830 3300005434 Bacteria 2169
27 Ga0070709_10228972 3300005434 Unclassified 1329
28 Ga0070714_100001920 3300005435 Bacteria 15175
29 Ga0070714_100408438 3300005435 Unclassified 1285
30 Ga0070713_100001918 3300005436 Bacteria 13415
31 Ga0070713_100290007 3300005436 Bacteria 1503
32 Ga0070713_100897917 3300005436 Bacteria 852
33 Ga0070713_101697411 3300005436 Bacteria 613
34 Ga0070711_100049351 3300005439 Unclassified 2882
35 Ga0070711_100228954 3300005439 Unclassified 1449
36 Ga0070711_100229864 3300005439 Bacteria 1446
37 Ga0070711_100454598 3300005439 Unclassified 1049
38 Ga0070711_100682170 3300005439 Unclassified 864
39 Ga0070705_100167204 3300005440 Unclassified 1476
40 Ga0070700_101330569 3300005441 Unclassified 605
41 Ga0070708_100359772 3300005445 Bacteria 1372
42 Ga0070678_100116197 3300005456 Bacteria 2102
43 Ga0070678_100670268 3300005456 Bacteria 932
44 Ga0070662_100424883 3300005457 Bacteria 1100
45 Ga0070681_10002161 3300005458 Bacteria 17886
46 Ga0070681_10057439 3300005458 Bacteria 3871
47 Ga0070681_10069519 3300005458 Bacteria 3487
48 Ga0070681_10420165 3300005458 Unclassified 1249
49 Ga0068867_100048313 3300005459 Unclassified 3130
50 Ga0068867_100993306 3300005459 Unclassified 760
51 Ga0070707_100367790 3300005468 Bacteria 1397
52 Ga0070707_101864649 3300005468 Bacteria 569
53 Ga0070679_100116042 3300005530 Bacteria 2662
54 Ga0070679_100844248 3300005530 Unclassified 859
55 Ga0070684_100012898 3300005535 Bacteria 6718
56 Ga0070684_100437165 3300005535 Bacteria 1208
57 Ga0070684_100437191 3300005535 Bacteria 1208
58 Ga0070684_101126485 3300005535 Unclassified 738
59 Ga0070697_100310711 3300005536 Bacteria 1356
60 Ga0070697_100396685 3300005536 Unclassified 1197
61 Ga0068853_100157377 3300005539 Bacteria 2048
62 Ga0068853_100558640 3300005539 Bacteria 1085
63 Ga0068853_100878393 3300005539 Unclassified 861
64 Ga0068853_101505972 3300005539 Unclassified 651
65 Ga0070686_100790099 3300005544 Unclassified 764
66 Ga0070695_100082102 3300005545 Bacteria 2134
67 Ga0070696_101073611 3300005546 Unclassified 676
68 Ga0070693_100025581 3300005547 Bacteria 3179
69 Ga0070665_100226607 3300005548 Bacteria 1869
70 Ga0070665_100345334 3300005548 Bacteria 1493
71 Ga0070665_100408128 3300005548 Bacteria 1367
72 Ga0070665_102098830 3300005548 Unclassified 570
73 Ga0068855_100003302 3300005563 Bacteria 19746
74 Ga0068855_100007430 3300005563 Bacteria 13267
75 Ga0068855_100278670 3300005563 Bacteria 1858
76 Ga0068855_100315652 3300005563 Unclassified 1728
77 Ga0068855_101227820 3300005563 Unclassified 778
78 Ga0070664_100030835 3300005564 Bacteria 4476
79 Ga0070664_100076125 3300005564 Bacteria 2883
80 Ga0070664_101259214 3300005564 Unclassified 698
81 Ga0068857_100019667 3300005577 Bacteria 5931
82 Ga0068857_100019768 3300005577 Bacteria 5916
83 Ga0068857_100122236 3300005577 Bacteria 2345
84 Ga0068854_100137876 3300005578 Unclassified 1869
85 Ga0068854_100293414 3300005578 Bacteria 1313
86 Ga0068856_100086694 3300005614 Bacteria 3111
87 Ga0068856_100242039 3300005614 Bacteria 1819
88 Ga0068856_100559511 3300005614 Unclassified 1165
89 Ga0068856_100911928 3300005614 Bacteria 897
90 Ga0068856_101408503 3300005614 Bacteria 711
91 Ga0068852_100321563 3300005616 Bacteria 1503
92 Ga0068859_100063491 3300005617 Bacteria 3724
93 Ga0068859_100637936 3300005617 Unclassified 1157
94 Ga0068859_101139728 3300005617 Unclassified 858
95 Ga0068864_100488602 3300005618 Bacteria 1183
96 Ga0068864_100968611 3300005618 Bacteria 843
97 Ga0068864_102117801 3300005618 Unclassified 569
98 Ga0068866_10090712 3300005718 Bacteria 1663
99 Ga0068851_10031582 3300005834 Bacteria 2632
100 Ga0068863_100011553 3300005841 Bacteria 8543
101 Ga0068863_100051754 3300005841 Bacteria 3892
102 Ga0068863_100069283 3300005841 Bacteria 3336
103 Ga0068863_100514532 3300005841 Bacteria 1180
104 Ga0068858_100017620 3300005842 Bacteria 6695
105 Ga0068858_100093226 3300005842 Bacteria 2803
106 Ga0068858_101018928 3300005842 Bacteria 812
107 Ga0068858_101149495 3300005842 Bacteria 763
108 Ga0068860_100016728 3300005843 Bacteria 7151
109 Ga0068860_100045655 3300005843 Bacteria 4178
110 Ga0070717_11581084 3300006028 Unclassified 594
111 Ga0070716_100256990 3300006173 Bacteria 1193
112 Ga0097621_100012755 3300006237 Bacteria 6244
113 Ga0097621_100040330 3300006237 Bacteria 3754
114 Ga0097621_100068321 3300006237 Bacteria 2930
115 Ga0097621_100077146 3300006237 Bacteria 2765
116 Ga0097621_100305230 3300006237 Bacteria 1407
117 Ga0097621_100332197 3300006237 Bacteria 1348
118 Ga0097621_100395909 3300006237 Bacteria 1236
119 Ga0097621_100844760 3300006237 Bacteria 850
120 Ga0097621_101141470 3300006237 Bacteria 733
121 Ga0097621_101955046 3300006237 Unclassified 560
122 Ga0068871_100031381 3300006358 Bacteria 4190
123 Ga0068871_100104058 3300006358 Bacteria 2381
124 Ga0068871_100106801 3300006358 Bacteria 2350
125 Ga0068871_100402834 3300006358 Bacteria 1219
126 Ga0068871_101052392 3300006358 Bacteria 759
127 Ga0068871_101560983 3300006358 Unclassified 624
128 Ga0068871_101958597 3300006358 Unclassified 557
129 Ga0068871_102014646 3300006358 Unclassified 550
130 Ga0075430_100003612 3300006846 Bacteria 12974
131 Ga0075434_100422474 3300006871 Bacteria 1354
132 Ga0068865_100005456 3300006881 Bacteria 7717
133 Ga0068865_100954381 3300006881 Bacteria 748
134 Ga0068865_101104661 3300006881 Bacteria 698
135 Ga0075436_100177071 3300006914 Bacteria 1507
136 Ga0097620_100063493 3300006931 Bacteria 3724
137 Ga0097620_100637955 3300006931 Unclassified 1157
138 Ga0097620_101139621 3300006931 Unclassified 858
139 Ga0075435_101253927 3300007076 Unclassified 649
140 Ga0075435_101273378 3300007076 Unclassified 644
141 Ga0105240_10000394 3300009093 Bacteria 81599
142 Ga0105240_10034251 3300009093 Bacteria 6552
143 Ga0105240_10057823 3300009093 Bacteria 4842
144 Ga0105240_10065124 3300009093 Bacteria 4525
145 Ga0105240_10322558 3300009093 Bacteria 1760
146 Ga0105240_10385835 3300009093 Bacteria 1581
147 Ga0105240_10480909 3300009093 Bacteria 1384
148 Ga0105240_10487158 3300009093 Bacteria 1373
149 Ga0105240_10624654 3300009093 Bacteria 1184
150 Ga0105240_12330207 3300009093 Bacteria 554
151 Ga0105245_10002156 3300009098 Bacteria 17826
152 Ga0105245_10006922 3300009098 Bacteria 9941
153 Ga0105245_10011731 3300009098 Bacteria 7624
154 Ga0105245_10015185 3300009098 Bacteria 6709
155 Ga0105245_10020865 3300009098 Bacteria 5743
156 Ga0105245_10027669 3300009098 Bacteria 4996
157 Ga0105245_10146950 3300009098 Bacteria 2225
158 Ga0105245_10149928 3300009098 Unclassified 2204
159 Ga0105245_10391385 3300009098 Bacteria 1387
160 Ga0105245_11898505 3300009098 Unclassified 649
161 Ga0105245_12165968 3300009098 Unclassified 610
162 Ga0105247_10515122 3300009101 Unclassified 874
163 Ga0105247_10669266 3300009101 Unclassified 778
164 Ga0105247_10693637 3300009101 Unclassified 766
165 Ga0105247_11868966 3300009101 Unclassified 501
166 Ga0114129_10104407 3300009147 Bacteria 3916
167 Ga0105243_10198925 3300009148 Bacteria 1756
168 Ga0105243_10346969 3300009148 Unclassified 1362
169 Ga0105243_10589120 3300009148 Bacteria 1069
170 Ga0105241_10027995 3300009174 Bacteria 4197
171 Ga0105241_10042411 3300009174 Bacteria 3442
172 Ga0105241_10120289 3300009174 Bacteria 2114
173 Ga0105241_10214117 3300009174 Unclassified 1616
174 Ga0105241_10229658 3300009174 Bacteria 1564
175 Ga0105242_10006476 3300009176 Bacteria 9016
176 Ga0105242_10010197 3300009176 Bacteria 7200
177 Ga0105242_10084481 3300009176 Bacteria 2660
178 Ga0105242_10849128 3300009176 Bacteria 908
179 Ga0105242_13146584 3300009176 Unclassified 512
180 Ga0105248_10018285 3300009177 Bacteria 7739
181 Ga0105248_10028341 3300009177 Bacteria 6240
182 Ga0105248_10054081 3300009177 Bacteria 4502
183 Ga0105248_10054687 3300009177 Bacteria 4477
184 Ga0105248_10061037 3300009177 Bacteria 4232
185 Ga0105248_10260787 3300009177 Bacteria 1951
186 Ga0105248_10323353 3300009177 Bacteria 1737
187 Ga0105248_10720093 3300009177 Bacteria 1126
188 Ga0105248_10927490 3300009177 Bacteria 983
189 Ga0105248_10978989 3300009177 Unclassified 955
190 Ga0105248_11373644 3300009177 Unclassified 799
191 Ga0105237_10010226 3300009545 Bacteria 9998
192 Ga0105237_10028110 3300009545 Bacteria 5730
193 Ga0105237_10033979 3300009545 Bacteria 5166
194 Ga0105237_10084405 3300009545 Bacteria 3166
195 Ga0105237_10399096 3300009545 Bacteria 1380
196 Ga0105237_10488463 3300009545 Bacteria 1238
197 Ga0105237_10628201 3300009545 Bacteria 1081
198 Ga0105237_10666276 3300009545 Unclassified 1047
199 Ga0105237_10815277 3300009545 Bacteria 940
200 Ga0105238_10001502 3300009551 Bacteria 23337
201 Ga0105238_10005935 3300009551 Bacteria 12103
202 Ga0105238_10021156 3300009551 Bacteria 6630
203 Ga0105238_10025163 3300009551 Bacteria 6066
204 Ga0105238_10030497 3300009551 Bacteria 5490
205 Ga0105238_10032261 3300009551 Bacteria 5330
206 Ga0105238_10124821 3300009551 Unclassified 2554
207 Ga0105238_10126427 3300009551 Bacteria 2535
208 Ga0105238_10604357 3300009551 Bacteria 1105
209 Ga0105238_11070477 3300009551 Bacteria 828
210 Ga0105249_10002845 3300009553 Bacteria 14942
211 Ga0105249_10049174 3300009553 Bacteria 3845
212 Ga0105249_10078516 3300009553 Bacteria 3063
213 Ga0105249_10932897 3300009553 Bacteria 936
214 Ga0105239_10007344 3300010375 Bacteria 12658
215 Ga0105239_10007915 3300010375 Bacteria 12152
216 Ga0105239_10015939 3300010375 Bacteria 8316
217 Ga0105239_10202632 3300010375 Bacteria 2223
218 Ga0105239_10324076 3300010375 Bacteria 1738
219 Ga0105239_10724859 3300010375 Unclassified 1137
220 Ga0105239_10979769 3300010375 Bacteria 972
221 Ga0105239_11283111 3300010375 Bacteria 845
222 Ga0105239_11537165 3300010375 Bacteria 769
223 Ga0105246_10003178 3300011119 Bacteria 9980
224 Ga0105246_10007648 3300011119 Bacteria 6630
225 Ga0105246_10031506 3300011119 Bacteria 3510
226 Ga0105246_10198191 3300011119 Bacteria 1559
227 Ga0105246_10932295 3300011119 Unclassified 781
228 Ga0105246_11020327 3300011119 Unclassified 750
229 Ga0105246_11152151 3300011119 Unclassified 711
230 Ga0157373_10325951 3300013100 Bacteria 1093
231 Ga0157373_11396152 3300013100 Unclassified 532
232 Ga0157370_10012916 3300013104 Bacteria 8632
233 Ga0157370_10055879 3300013104 Bacteria 3759
234 Ga0157369_10008518 3300013105 Bacteria 11759
235 Ga0157369_10029116 3300013105 Bacteria 6105
236 Ga0157369_10710621 3300013105 Bacteria 1035
237 Ga0157374_10015114 3300013296 Bacteria 6768
238 Ga0157374_10092192 3300013296 Bacteria 2890
239 Ga0157374_10097527 3300013296 Bacteria 2813
240 Ga0157374_11674798 3300013296 Unclassified 661
241 Ga0157374_11762680 3300013296 Unclassified 644
242 Ga0157378_10023319 3300013297 Bacteria 5447
243 Ga0157378_10085974 3300013297 Bacteria 2850
244 Ga0157378_10108785 3300013297 Bacteria 2538
245 Ga0157378_10115949 3300013297 Bacteria 2462
246 Ga0157378_11291420 3300013297 Bacteria 771
247 Ga0157378_12006888 3300013297 Bacteria 628
248 Ga0163162_10052674 3300013306 Bacteria 4088
249 Ga0163162_10163218 3300013306 Bacteria 2351
250 Ga0163162_10338428 3300013306 Unclassified 1637
251 Ga0163162_10533050 3300013306 Bacteria 1303
252 Ga0163162_10940293 3300013306 Unclassified 976
253 Ga0163162_11745729 3300013306 Unclassified 711
254 Ga0163162_12181367 3300013306 Unclassified 636
255 Ga0163162_12863674 3300013306 Unclassified 555
256 Ga0157372_10011215 3300013307 Bacteria 9535
257 Ga0157372_10028663 3300013307 Bacteria 6078
258 Ga0157372_10128882 3300013307 Bacteria 2910
259 Ga0157372_10809004 3300013307 Bacteria 1089
260 Ga0157372_10874836 3300013307 Unclassified 1043
261 Ga0157372_11252176 3300013307 Unclassified 857
262 Ga0157372_11911357 3300013307 Unclassified 682
263 Ga0157372_12776517 3300013307 Bacteria 562
264 Ga0157375_10114037 3300013308 Bacteria 2804
265 Ga0157375_10152209 3300013308 Bacteria 2449
266 Ga0157375_10249836 3300013308 Bacteria 1934
267 Ga0157375_10666228 3300013308 Unclassified 1196
268 Ga0157375_10859558 3300013308 Bacteria 1053
269 Ga0163163_10022506 3300014325 Bacteria 5969
270 Ga0163163_10103149 3300014325 Bacteria 2876
271 Ga0163163_10143270 3300014325 Bacteria 2432
272 Ga0163163_10212359 3300014325 Bacteria 1984
273 Ga0163163_10215641 3300014325 Bacteria 1968
274 Ga0163163_10387192 3300014325 Bacteria 1456
275 Ga0163163_10482678 3300014325 Bacteria 1300
276 Ga0163163_11032618 3300014325 Unclassified 885
277 Ga0163163_12625130 3300014325 Bacteria 561
278 Ga0157379_10073883 3300014968 Bacteria 3052
279 Ga0157379_10149183 3300014968 Bacteria 2109
280 Ga0157379_10166866 3300014968 Bacteria 1987
281 Ga0157379_10841470 3300014968 Bacteria 868
282 Ga0157376_10023587 3300014969 Bacteria 4818
283 Ga0157376_10060917 3300014969 Bacteria 3171
284 Ga0157376_10165875 3300014969 Bacteria 2007
285 Ga0157376_10998572 3300014969 Bacteria 859
286 Ga0163161_10692236 3300017792 Bacteria 848
287 Ga0213873_10004467 3300021358 Bacteria 2613
288 Ga0207642_10043076 3300025899 Bacteria 1988
289 Ga0207642_10175139 3300025899 Unclassified 1164
290 Ga0207680_10011962 3300025903 Bacteria 4406
291 Ga0207685_10782335 3300025905 Bacteria 524
292 Ga0207699_10034184 3300025906 Bacteria 2881
293 Ga0207699_10478029 3300025906 Bacteria 897
294 Ga0207645_10045433 3300025907 Bacteria 2807
295 Ga0207705_10017058 3300025909 Bacteria 5201
296 Ga0207705_10324718 3300025909 Unclassified 1183
297 Ga0207654_10018109 3300025911 Bacteria 3692
298 Ga0207654_10030169 3300025911 Bacteria 2974
299 Ga0207654_10036828 3300025911 Bacteria 2736
300 Ga0207654_10279876 3300025911 Unclassified 1128
301 Ga0207654_10509345 3300025911 Unclassified 851
302 Ga0207707_10018202 3300025912 Bacteria 6123
303 Ga0207707_10141716 3300025912 Bacteria 2102
304 Ga0207707_10210964 3300025912 Bacteria 1692
305 Ga0207707_10244446 3300025912 Bacteria 1560
306 Ga0207707_10477598 3300025912 Unclassified 1065
307 Ga0207707_10892991 3300025912 Bacteria 735
308 Ga0207695_10001654 3300025913 Bacteria 35916
309 Ga0207695_10014280 3300025913 Bacteria 9419
310 Ga0207695_10101960 3300025913 Bacteria 2864
311 Ga0207695_10104318 3300025913 Bacteria 2825
312 Ga0207695_10161671 3300025913 Bacteria 2170
313 Ga0207695_10376614 3300025913 Bacteria 1305
314 Ga0207695_10390616 3300025913 Bacteria 1276
315 Ga0207695_11051156 3300025913 Bacteria 694
316 Ga0207695_11059653 3300025913 Unclassified 690
317 Ga0207671_10012366 3300025914 Bacteria 6868
318 Ga0207671_10019330 3300025914 Bacteria 5210
319 Ga0207671_10025500 3300025914 Bacteria 4441
320 Ga0207671_10027105 3300025914 Bacteria 4286
321 Ga0207671_10152124 3300025914 Bacteria 1788
322 Ga0207671_10330864 3300025914 Bacteria 1206
323 Ga0207693_10758808 3300025915 Unclassified 749
324 Ga0207693_11458407 3300025915 Unclassified 506
325 Ga0207663_10182596 3300025916 Bacteria 1500
326 Ga0207663_10408359 3300025916 Unclassified 1040
327 Ga0207663_10896292 3300025916 Unclassified 709
328 Ga0207663_11211708 3300025916 Unclassified 608
329 Ga0207660_10309564 3300025917 Bacteria 1259
330 Ga0207657_10002306 3300025919 Bacteria 20684
331 Ga0207657_10020464 3300025919 Bacteria 6251
332 Ga0207649_11419704 3300025920 Unclassified 549
333 Ga0207652_10227234 3300025921 Bacteria 1682
334 Ga0207646_11924917 3300025922 Bacteria 503
335 Ga0207694_10002547 3300025924 Bacteria 14797
336 Ga0207694_10003306 3300025924 Bacteria 12829
337 Ga0207694_10005254 3300025924 Bacteria 9978
338 Ga0207694_10008203 3300025924 Bacteria 7896
339 Ga0207694_10025793 3300025924 Bacteria 4468
340 Ga0207694_10244574 3300025924 Bacteria 1467
341 Ga0207694_10256442 3300025924 Bacteria 1432
342 Ga0207694_10560380 3300025924 Bacteria 959
343 Ga0207694_10889827 3300025924 Unclassified 753
344 Ga0207694_11881045 3300025924 Bacteria 502
345 Ga0207687_10000566 3300025927 Bacteria 24947
346 Ga0207687_10001782 3300025927 Bacteria 14809
347 Ga0207687_10011275 3300025927 Bacteria 5840
348 Ga0207687_10026554 3300025927 Bacteria 3879
349 Ga0207687_10027205 3300025927 Bacteria 3836
350 Ga0207687_10027803 3300025927 Bacteria 3796
351 Ga0207687_10165318 3300025927 Bacteria 1702
352 Ga0207687_10170276 3300025927 Bacteria 1679
353 Ga0207700_10001718 3300025928 Bacteria 12434
354 Ga0207700_11212054 3300025928 Bacteria 674
355 Ga0207664_10004500 3300025929 Bacteria 9442
356 Ga0207664_10048017 3300025929 Bacteria 3356
357 Ga0207644_10087373 3300025931 Bacteria 2317
358 Ga0207644_10154008 3300025931 Bacteria 1781
359 Ga0207706_10010536 3300025933 Bacteria 8446
360 Ga0207686_10004339 3300025934 Bacteria 7598
361 Ga0207686_10010763 3300025934 Bacteria 4984
362 Ga0207686_10027607 3300025934 Bacteria 3325
363 Ga0207686_10037738 3300025934 Bacteria 2918
364 Ga0207686_10138357 3300025934 Bacteria 1680
365 Ga0207686_11443026 3300025934 Unclassified 567
366 Ga0207709_10041224 3300025935 Bacteria 2769
367 Ga0207709_10069042 3300025935 Bacteria 2235
368 Ga0207704_10004781 3300025938 Bacteria 6221
369 Ga0207665_10515648 3300025939 Bacteria 925
370 Ga0207711_10000701 3300025941 Bacteria 33020
371 Ga0207711_10008558 3300025941 Bacteria 8558
372 Ga0207711_10116493 3300025941 Bacteria 2382
373 Ga0207711_10157834 3300025941 Bacteria 2051
374 Ga0207711_10167962 3300025941 Bacteria 1989
375 Ga0207711_10569790 3300025941 Bacteria 1056
376 Ga0207711_10773968 3300025941 Unclassified 894
377 Ga0207711_11841056 3300025941 Unclassified 548
378 Ga0207689_10171645 3300025942 Bacteria 1788
379 Ga0207689_10198680 3300025942 Bacteria 1655
380 Ga0207661_10018400 3300025944 Bacteria 5190
381 Ga0207661_10061290 3300025944 Bacteria 3038
382 Ga0207661_10067535 3300025944 Bacteria 2908
383 Ga0207661_10132954 3300025944 Unclassified 2133
384 Ga0207661_10496145 3300025944 Unclassified 1115
385 Ga0207679_10041487 3300025945 Bacteria 3300
386 Ga0207679_10186253 3300025945 Bacteria 1721
387 Ga0207679_10370270 3300025945 Unclassified 1254
388 Ga0207679_11875617 3300025945 Unclassified 547
389 Ga0207667_10005331 3300025949 Bacteria 15672
390 Ga0207667_10018395 3300025949 Bacteria 7837
391 Ga0207667_10235088 3300025949 Bacteria 1876
392 Ga0207667_10374830 3300025949 Bacteria 1450
393 Ga0207667_11012952 3300025949 Unclassified 817
394 Ga0207712_10129302 3300025961 Bacteria 1922
395 Ga0207712_10579691 3300025961 Unclassified 968
396 Ga0207712_10734495 3300025961 Bacteria 864
397 Ga0207640_10093218 3300025981 Unclassified 2092
398 Ga0207640_11263042 3300025981 Unclassified 658
399 Ga0207658_10212054 3300025986 Bacteria 1624
400 Ga0207658_10900962 3300025986 Unclassified 805
401 Ga0207677_10042469 3300026023 Bacteria 3015
402 Ga0207677_10091676 3300026023 Bacteria 2211
403 Ga0207677_10125146 3300026023 Bacteria 1941
404 Ga0207677_10138312 3300026023 Bacteria 1861
405 Ga0207703_10008848 3300026035 Bacteria 7936
406 Ga0207703_10039566 3300026035 Bacteria 3768
407 Ga0207703_10955611 3300026035 Bacteria 821
408 Ga0207639_10379153 3300026041 Bacteria 1270
409 Ga0207639_10938370 3300026041 Unclassified 809
410 Ga0207678_11063282 3300026067 Unclassified 716
411 Ga0207708_10905254 3300026075 Bacteria 764
412 Ga0207702_10051298 3300026078 Bacteria 3485
413 Ga0207702_10438774 3300026078 Bacteria 1265
414 Ga0207702_10539844 3300026078 Bacteria 1140
415 Ga0207702_10812116 3300026078 Bacteria 925
416 Ga0207641_10045077 3300026088 Bacteria 3712
417 Ga0207641_10054513 3300026088 Bacteria 3393
418 Ga0207641_10162679 3300026088 Bacteria 2030
419 Ga0207648_10021934 3300026089 Bacteria 5737
420 Ga0207648_10298005 3300026089 Bacteria 1445
421 Ga0207676_10031677 3300026095 Bacteria 3978
422 Ga0207676_10330705 3300026095 Unclassified 1402
423 Ga0207676_10767756 3300026095 Bacteria 938
424 Ga0207676_10883261 3300026095 Unclassified 876
425 Ga0207676_11340040 3300026095 Unclassified 711
426 Ga0207674_10007498 3300026116 Bacteria 12718
427 Ga0207674_10010952 3300026116 Bacteria 10207
428 Ga0207674_10057757 3300026116 Bacteria 3933
429 Ga0207674_10176236 3300026116 Bacteria 2090
430 Ga0207674_10684557 3300026116 Unclassified 990
431 Ga0207683_10141641 3300026121 Bacteria 2167
432 Ga0207698_10036052 3300026142 Bacteria 3626
433 Ga0268266_10130924 3300028379 Bacteria 2243
434 Ga0268266_11046060 3300028379 Bacteria 790
435 Ga0268264_10011760 3300028381 Bacteria 7216
436 Ga0268264_10072861 3300028381 Bacteria 2913
437 Ga0265323_10001898 3300028653 Bacteria 9860
438 Ga0265338_10250555 3300028800 Bacteria 1307
439 Ga0265338_10477296 3300028800 Bacteria 880
440 Ga0265760_10327200 3300031090 Bacteria 546
441 Ga0265332_10025449 3300031238 Bacteria 2598
442 Ga0265325_10012824 3300031241 Bacteria 4783
443 Ga0265325_10034264 3300031241 Bacteria 2703
444 Ga0265325_10175178 3300031241 Unclassified 1002
445 Ga0265339_10213089 3300031249 Unclassified 948
446 Ga0265316_10509821 3300031344 Bacteria 859
447 Ga0265316_10676866 3300031344 Bacteria 728
448 Ga0265313_10081691 3300031595 Bacteria 1467
449 Ga0265314_10000961 3300031711 Bacteria 33842
450 Ga0265314_10068787 3300031711 Bacteria 2379
451 Ga0265314_10314264 3300031711 Unclassified 874
452 Ga0265342_10347339 3300031712 Unclassified 773
453 Ga0373944_0177765 3300035089 Unclassified 762
454 Ga0373923_0039475 3300035111 Bacteria 1939
455 Ga0373923_0060050 3300035111 Unclassified 1613
456 Ga0373936_0226406 3300035113 Bacteria 831
457 Ga0373941_0060439 3300035115 Bacteria 1232
458 Ga0373945_0083652 3300035116 Bacteria 1226
459 Ga0373954_0008740 3300035118 Bacteria 4453
460 Ga0373954_0062273 3300035118 Unclassified 1762
461 Ga0373954_0123992 3300035118 Bacteria 1255
462 Ga0373956_0116651 3300035119 Unclassified 1245
463 Ga0373956_0590750 3300035119 Unclassified 530
464 Ga0373957_0308297 3300035120 Unclassified 672
465 Ga0373946_0035416 3300035171 Bacteria 2020
466 Ga0373955_0070270 3300035172 Bacteria 1956
467 Ga0373955_0830222 3300035172 Unclassified 568
468 Ga0373924_0320417 3300035410 Bacteria 689
469 Ga0373935_0248359 3300035692 Unclassified 1244
470 Ga0373935_0304546 3300035692 Unclassified 1127
471 Ga0373935_0902566 3300035692 Bacteria 655
472 Ga0373935_1167382 3300035692 Bacteria 574
473 Ga0373935_1253038 3300035692 Unclassified 553
474 Ga0373927_0006720 3300035695 Bacteria 7828
475 Ga0373927_0017205 3300035695 Bacteria 4762
476 Ga0373927_0408300 3300035695 Unclassified 896
477 Ga0373927_1125764 3300035695 Unclassified 518
478 Ga0373947_0045329 3300035725 Bacteria 2631
479 Ga0373937_0004697 3300036401 Bacteria 11618
480 Ga0373937_0027583 3300036401 Bacteria 5136
481 Ga0373937_0326960 3300036401 Unclassified 1451
482 Ga0373937_1410079 3300036401 Unclassified 644
483 Ga0373925_0009655 3300037068 Bacteria 7030
484 Ga0373925_0026762 3300037068 Bacteria 4222
485 Ga0373925_0311327 3300037068 Bacteria 1273
486 Ga0373925_0905565 3300037068 Unclassified 727
487 Ga0436364_0845902 3300037853 Unclassified 500
488 Ga0436364_1287601 3300037853 Bacteria 1124
489 Ga0436364_1450240 3300037853 Unclassified 667
490 Ga0436360_1113823 3300039438 Unclassified 516
491 Ga0451576_0080923 3300045051 Bacteria 3379
492 Ga0451576_0630933 3300045051 Bacteria 1126
493 Ga0451576_0783787 3300045051 Bacteria 1001
494 Ga0451576_0801494 3300045051 Bacteria 989
495 Ga0466958_0702508 3300045836 Bacteria 659
496 Ga0495653_0206146 3300046463 Bacteria 1331
497 Ga0495653_0279848 3300046463 Bacteria 1095
498 Ga0495580_0001458 3300046472 Bacteria 20739
499 Ga0495580_0238535 3300046472 Unclassified 1247
500 Ga0495580_0240635 3300046472 Bacteria 1241
501 Ga0495580_0480595 3300046472 Unclassified 831
502 Ga0495580_0715549 3300046472 Unclassified 654
503 Ga0495582_0223241 3300046473 Bacteria 1078
504 Ga0495582_0296149 3300046473 Unclassified 930
505 Ga0495664_0196680 3300046477 Unclassified 1222
506 Ga0495664_0460765 3300046477 Unclassified 761
507 Ga0495594_0800663 3300046499 Unclassified 531
508 Ga0495608_0341184 3300046511 Bacteria 923
509 Ga0495630_1531550 3300046517 Unclassified 500
510 Ga0495652_0107299 3300046529 Bacteria 2253
511 Ga0495665_0121749 3300046531 Unclassified 1366
512 Ga0495586_0556306 3300046535 Bacteria 662
513 Ga0495587_0040764 3300046536 Bacteria 2773
514 Ga0495645_0175342 3300046543 Unclassified 1473
515 Ga0495645_0436982 3300046543 Bacteria 828
516 Ga0495635_0154713 3300046663 Unclassified 1561
517 Ga0495635_0362700 3300046663 Unclassified 966
518 Ga0495623_0605246 3300046679 Unclassified 569
519 Ga0495658_0051752 3300046683 Bacteria 2327
520 Ga0495658_0548605 3300046683 Unclassified 740
521 Ga0495669_0337215 3300046684 Bacteria 728
522 Ga0495613_0099988 3300046689 Unclassified 2095
523 Ga0495613_0283928 3300046689 Bacteria 1149
524 Ga0495674_0036855 3300047319 Bacteria 4398
525 Ga0495674_0133321 3300047319 Bacteria 2092
526 Ga0495674_0455755 3300047319 Unclassified 1027
527 Ga0495680_0412537 3300047322 Unclassified 930
528 Ga0495675_0104051 3300047444 Bacteria 1775
529 Ga0495675_0206218 3300047444 Bacteria 1195
530 Ga0495684_0003975 3300047471 Bacteria 11533
531 Ga0495684_0074587 3300047471 Bacteria 2578
532 Ga0495684_0933315 3300047471 Unclassified 556
533 Ga0495593_0651625 3300047673 Unclassified 529
534 Ga0496103_0661914 3300048906 Unclassified 663
535 Ga0496104_0488727 3300048907 Unclassified 1142
536 Ga0496106_1180671 3300048909 Unclassified 597
537 Ga0496107_1093049 3300048910 Unclassified 576
538 Ga0496112_0867567 3300048915 Bacteria 825
539 Ga0496115_0099050 3300048918 Bacteria 2388
540 Ga0501031_0001167 3300049568 Bacteria 15970
541 Ga0501032_0000322 3300049569 Bacteria 40127
542 Ga0501032_0109885 3300049569 Bacteria 1825
543 Ga0501033_0011744 3300049570 Bacteria 6697
544 Ga0501034_0018211 3300049571 Bacteria 7205
545 Ga0501034_0143744 3300049571 Unclassified 2364
546 Ga0501036_0000861 3300049572 Bacteria 22548
547 Ga0501037_0026323 3300049573 Bacteria 4298
548 Ga0501038_0000547 3300049574 Bacteria 33036
549 Ga0501039_0067437 3300049575 Unclassified 2778
550 Ga0501043_0001136 3300049579 Bacteria 23377
551 Ga0501043_1295979 3300049579 Unclassified 508
552 Ga0501046_0000679 3300049580 Bacteria 33015
553 Ga0501047_0028074 3300049581 Bacteria 5424
554 Ga0501047_0039341 3300049581 Bacteria 4574
555 Ga0501048_0007878 3300049582 Bacteria 8071
556 Ga0501048_0946440 3300049582 Unclassified 620
557 Ga0501067_0000421 3300049583 Bacteria 23106
558 Ga0501068_0000365 3300049584 Bacteria 22749
559 Ga0501069_0011826 3300049585 Bacteria 4627
560 Ga0501069_0436866 3300049585 Bacteria 777
561 Ga0501070_0011218 3300049586 Bacteria 7566
562 Ga0501070_0023646 3300049586 Bacteria 5148
563 Ga0501074_0028870 3300049590 Bacteria 4018
564 Ga0501076_0042455 3300049592 Bacteria 3580
565 Ga0501077_0172892 3300049593 Unclassified 1372
566 Ga0501240_079709 3300049673 Bacteria 605
567 Ga0501257_082969 3300049686 Bacteria 828
568 Ga0501225_0275853 3300049705 Bacteria 561
569 Ga0501079_0004407 3300049741 Bacteria 10424
570 Ga0501080_0002099 3300049742 Bacteria 17305
571 Ga0501083_0004808 3300049744 Bacteria 9545
572 Ga0501268_086329 3300049765 Bacteria 655
573 Ga0501035_0029672 3300049822 Bacteria 4987
574 Ga0501035_0116052 3300049822 Bacteria 2343
575 Ga0501044_0000766 3300049823 Bacteria 38886
576 Ga0501044_0005535 3300049823 Bacteria 14017
577 Ga0501044_0034013 3300049823 Bacteria 5349
578 Ga0501044_0168596 3300049823 Unclassified 2162
579 nmdc:mga05p37_69753_c1 3300050507 Bacteria 4323
580 nmdc:mga0qj67_61820_c1 3300050509 Bacteria 2974
581 nmdc:mga06r32_32254_c1 3300050510 Bacteria 4927
582 nmdc:mga0n895_1278390_c1 3300050512 Unclassified 705
583 nmdc:mga0rr50_1483475_c1 3300050513 Unclassified 573
584 nmdc:mga08x19_651827_c1 3300050514 Bacteria 747
585 nmdc:mga08x19_78314_c1 3300050514 Bacteria 2166
586 Ga0495601_0308853 3300053077 Bacteria 1030
587 Ga0495612_0292947 3300053078 Bacteria 729
588 Ga0495619_0308704 3300053085 Unclassified 1096
589 Ga0501084_0007579 3300054114 Bacteria 8949
590 Ga0501082_0004260 3300060353 Bacteria 12498
591 Ga0070701_10918384
592 Ga0070658_10000944
593 Ga0070658_10707902
594 Ga0070676_10894838
595 Ga0070683_100109409
596 Ga0070683_100250232
597 Ga0070683_100508052
598 Ga0070683_100972846
599 Ga0070690_100143383
600 Ga0068869_100608910
601 Ga0068869_100855807
602 Ga0070666_10006250
603 Ga0070680_100167349
604 Ga0068868_100787228
605 Ga0068868_101185850
606 Ga0068868_101798358
607 Ga0070660_100000964
608 Ga0070660_100853066
609 Ga0070671_100051600
610 Ga0070671_100129518
611 Ga0070673_100103484
612 Ga0070673_101128899
613 Ga0070667_100050314
614 Ga0070667_100291209
615 Ga0070667_100556170
616 Ga0070709_10076830
617 Ga0070709_10228972
618 Ga0070714_100001920
619 Ga0070714_100408438
620 Ga0070713_100001918
621 Ga0070713_100290007
622 Ga0070713_100897917
623 Ga0070713_101697411
624 Ga0070711_100049351
625 Ga0070711_100228954
626 Ga0070711_100229864
627 Ga0070711_100454598
628 Ga0070711_100682170
629 Ga0070705_100167204
630 Ga0070700_101330569
631 Ga0070708_100359772
632 Ga0070678_100116197
633 Ga0070678_100670268
634 Ga0070662_100424883
635 Ga0070681_10002161
636 Ga0070681_10057439
637 Ga0070681_10069519
638 Ga0070681_10420165
639 Ga0068867_100048313
640 Ga0068867_100993306
641 Ga0070707_100367790
642 Ga0070707_101864649
643 Ga0070679_100116042
644 Ga0070679_100844248
645 Ga0070684_100012898
646 Ga0070684_100437165
647 Ga0070684_100437191
648 Ga0070684_101126485
649 Ga0070697_100310711
650 Ga0070697_100396685
651 Ga0068853_100157377
652 Ga0068853_100558640
653 Ga0068853_100878393
654 Ga0068853_101505972
655 Ga0070686_100790099
656 Ga0070695_100082102
657 Ga0070696_101073611
658 Ga0070693_100025581
659 Ga0070665_100226607
660 Ga0070665_100345334
661 Ga0070665_100408128
662 Ga0070665_102098830
663 Ga0068855_100003302
664 Ga0068855_100007430
665 Ga0068855_100278670
666 Ga0068855_100315652
667 Ga0068855_101227820
668 Ga0070664_100030835
669 Ga0070664_100076125
670 Ga0070664_101259214
671 Ga0068857_100019667
672 Ga0068857_100019768
673 Ga0068857_100122236
674 Ga0068854_100137876
675 Ga0068854_100293414
676 Ga0068856_100086694
677 Ga0068856_100242039
678 Ga0068856_100559511
679 Ga0068856_100911928
680 Ga0068856_101408503
681 Ga0068852_100321563
682 Ga0068859_100063491
683 Ga0068859_100637936
684 Ga0068859_101139728
685 Ga0068864_100488602
686 Ga0068864_100968611
687 Ga0068864_102117801
688 Ga0068866_10090712
689 Ga0068851_10031582
690 Ga0068863_100011553
691 Ga0068863_100051754
692 Ga0068863_100069283
693 Ga0068863_100514532
694 Ga0068858_100017620
695 Ga0068858_100093226
696 Ga0068858_101018928
697 Ga0068858_101149495
698 Ga0068860_100016728
699 Ga0068860_100045655
700 Ga0070717_11581084
701 Ga0070716_100256990
702 Ga0097621_100012755
703 Ga0097621_100040330
704 Ga0097621_100068321
705 Ga0097621_100077146
706 Ga0097621_100305230
707 Ga0097621_100332197
708 Ga0097621_100395909
709 Ga0097621_100844760
710 Ga0097621_101141470
711 Ga0097621_101955046
712 Ga0068871_100031381
713 Ga0068871_100104058
714 Ga0068871_100106801
715 Ga0068871_100402834
716 Ga0068871_101052392
717 Ga0068871_101560983
718 Ga0068871_101958597
719 Ga0068871_102014646
720 Ga0075430_100003612
721 Ga0075434_100422474
722 Ga0068865_100005456
723 Ga0068865_100954381
724 Ga0068865_101104661
725 Ga0075436_100177071
726 Ga0097620_100063493
727 Ga0097620_100637955
728 Ga0097620_101139621
729 Ga0075435_101253927
730 Ga0075435_101273378
731 Ga0105240_10000394
732 Ga0105240_10034251
733 Ga0105240_10057823
734 Ga0105240_10065124
735 Ga0105240_10322558
736 Ga0105240_10385835
737 Ga0105240_10480909
738 Ga0105240_10487158
739 Ga0105240_10624654
740 Ga0105240_12330207
741 Ga0105245_10002156
742 Ga0105245_10006922
743 Ga0105245_10011731
744 Ga0105245_10015185
745 Ga0105245_10020865
746 Ga0105245_10027669
747 Ga0105245_10146950
748 Ga0105245_10149928
749 Ga0105245_10391385
750 Ga0105245_11898505
751 Ga0105245_12165968
752 Ga0105247_10515122
753 Ga0105247_10669266
754 Ga0105247_10693637
755 Ga0105247_11868966
756 Ga0114129_10104407
757 Ga0105243_10198925
758 Ga0105243_10346969
759 Ga0105243_10589120
760 Ga0105241_10027995
761 Ga0105241_10042411
762 Ga0105241_10120289
763 Ga0105241_10214117
764 Ga0105241_10229658
765 Ga0105242_10006476
766 Ga0105242_10010197
767 Ga0105242_10084481
768 Ga0105242_10849128
769 Ga0105242_13146584
770 Ga0105248_10018285
771 Ga0105248_10028341
772 Ga0105248_10054081
773 Ga0105248_10054687
774 Ga0105248_10061037
775 Ga0105248_10260787
776 Ga0105248_10323353
777 Ga0105248_10720093
778 Ga0105248_10927490
779 Ga0105248_10978989
780 Ga0105248_11373644
781 Ga0105237_10010226
782 Ga0105237_10028110
783 Ga0105237_10033979
784 Ga0105237_10084405
785 Ga0105237_10399096
786 Ga0105237_10488463
787 Ga0105237_10628201
788 Ga0105237_10666276
789 Ga0105237_10815277
790 Ga0105238_10001502
791 Ga0105238_10005935
792 Ga0105238_10021156
793 Ga0105238_10025163
794 Ga0105238_10030497
795 Ga0105238_10032261
796 Ga0105238_10124821
797 Ga0105238_10126427
798 Ga0105238_10604357
799 Ga0105238_11070477
800 Ga0105249_10002845
801 Ga0105249_10049174
802 Ga0105249_10078516
803 Ga0105249_10932897
804 Ga0105239_10007344
805 Ga0105239_10007915
806 Ga0105239_10015939
807 Ga0105239_10202632
808 Ga0105239_10324076
809 Ga0105239_10724859
810 Ga0105239_10979769
811 Ga0105239_11283111
812 Ga0105239_11537165
813 Ga0105246_10003178
814 Ga0105246_10007648
815 Ga0105246_10031506
816 Ga0105246_10198191
817 Ga0105246_10932295
818 Ga0105246_11020327
819 Ga0105246_11152151
820 Ga0157373_10325951
821 Ga0157373_11396152
822 Ga0157370_10012916
823 Ga0157370_10055879
824 Ga0157369_10008518
825 Ga0157369_10029116
826 Ga0157369_10710621
827 Ga0157374_10015114
828 Ga0157374_10092192
829 Ga0157374_10097527
830 Ga0157374_11674798
831 Ga0157374_11762680
832 Ga0157378_10023319
833 Ga0157378_10085974
834 Ga0157378_10108785
835 Ga0157378_10115949
836 Ga0157378_11291420
837 Ga0157378_12006888
838 Ga0163162_10052674
839 Ga0163162_10163218
840 Ga0163162_10338428
841 Ga0163162_10533050
842 Ga0163162_10940293
843 Ga0163162_11745729
844 Ga0163162_12181367
845 Ga0163162_12863674
846 Ga0157372_10011215
847 Ga0157372_10028663
848 Ga0157372_10128882
849 Ga0157372_10809004
850 Ga0157372_10874836
851 Ga0157372_11252176
852 Ga0157372_11911357
853 Ga0157372_12776517
854 Ga0157375_10114037
855 Ga0157375_10152209
856 Ga0157375_10249836
857 Ga0157375_10666228
858 Ga0157375_10859558
859 Ga0163163_10022506
860 Ga0163163_10103149
861 Ga0163163_10143270
862 Ga0163163_10212359
863 Ga0163163_10215641
864 Ga0163163_10387192
865 Ga0163163_10482678
866 Ga0163163_11032618
867 Ga0163163_12625130
868 Ga0157379_10073883
869 Ga0157379_10149183
870 Ga0157379_10166866
871 Ga0157379_10841470
872 Ga0157376_10023587
873 Ga0157376_10060917
874 Ga0157376_10165875
875 Ga0157376_10998572
876 Ga0163161_10692236
877 Ga0213873_10004467
878 Ga0207642_10043076
879 Ga0207642_10175139
880 Ga0207680_10011962
881 Ga0207685_10782335
882 Ga0207699_10034184
883 Ga0207699_10478029
884 Ga0207645_10045433
885 Ga0207705_10017058
886 Ga0207705_10324718
887 Ga0207654_10018109
888 Ga0207654_10030169
889 Ga0207654_10036828
890 Ga0207654_10279876
891 Ga0207654_10509345
892 Ga0207707_10018202
893 Ga0207707_10141716
894 Ga0207707_10210964
895 Ga0207707_10244446
896 Ga0207707_10477598
897 Ga0207707_10892991
898 Ga0207695_10001654
899 Ga0207695_10014280
900 Ga0207695_10101960
901 Ga0207695_10104318
902 Ga0207695_10161671
903 Ga0207695_10376614
904 Ga0207695_10390616
905 Ga0207695_11051156
906 Ga0207695_11059653
907 Ga0207671_10012366
908 Ga0207671_10019330
909 Ga0207671_10025500
910 Ga0207671_10027105
911 Ga0207671_10152124
912 Ga0207671_10330864
913 Ga0207693_10758808
914 Ga0207693_11458407
915 Ga0207663_10182596
916 Ga0207663_10408359
917 Ga0207663_10896292
918 Ga0207663_11211708
919 Ga0207660_10309564
920 Ga0207657_10002306
921 Ga0207657_10020464
922 Ga0207649_11419704
923 Ga0207652_10227234
924 Ga0207646_11924917
925 Ga0207694_10002547
926 Ga0207694_10003306
927 Ga0207694_10005254
928 Ga0207694_10008203
929 Ga0207694_10025793
930 Ga0207694_10244574
931 Ga0207694_10256442
932 Ga0207694_10560380
933 Ga0207694_10889827
934 Ga0207694_11881045
935 Ga0207687_10000566
936 Ga0207687_10001782
937 Ga0207687_10011275
938 Ga0207687_10026554
939 Ga0207687_10027205
940 Ga0207687_10027803
941 Ga0207687_10165318
942 Ga0207687_10170276
943 Ga0207700_10001718
944 Ga0207700_11212054
945 Ga0207664_10004500
946 Ga0207664_10048017
947 Ga0207644_10087373
948 Ga0207644_10154008
949 Ga0207706_10010536
950 Ga0207686_10004339
951 Ga0207686_10010763
952 Ga0207686_10027607
953 Ga0207686_10037738
954 Ga0207686_10138357
955 Ga0207686_11443026
956 Ga0207709_10041224
957 Ga0207709_10069042
958 Ga0207704_10004781
959 Ga0207665_10515648
960 Ga0207711_10000701
961 Ga0207711_10008558
962 Ga0207711_10116493
963 Ga0207711_10157834
964 Ga0207711_10167962
965 Ga0207711_10569790
966 Ga0207711_10773968
967 Ga0207711_11841056
968 Ga0207689_10171645
969 Ga0207689_10198680
970 Ga0207661_10018400
971 Ga0207661_10061290
972 Ga0207661_10067535
973 Ga0207661_10132954
974 Ga0207661_10496145
975 Ga0207679_10041487
976 Ga0207679_10186253
977 Ga0207679_10370270
978 Ga0207679_11875617
979 Ga0207667_10005331
980 Ga0207667_10018395
981 Ga0207667_10235088
982 Ga0207667_10374830
983 Ga0207667_11012952
984 Ga0207712_10129302
985 Ga0207712_10579691
986 Ga0207712_10734495
987 Ga0207640_10093218
988 Ga0207640_11263042
989 Ga0207658_10212054
990 Ga0207658_10900962
991 Ga0207677_10042469
992 Ga0207677_10091676
993 Ga0207677_10125146
994 Ga0207677_10138312
995 Ga0207703_10008848
996 Ga0207703_10039566
997 Ga0207703_10955611
998 Ga0207639_10379153
999 Ga0207639_10938370
1000 Ga0207678_11063282
1001 Ga0207708_10905254
1002 Ga0207702_10051298
1003 Ga0207702_10438774
1004 Ga0207702_10539844
1005 Ga0207702_10812116
1006 Ga0207641_10045077
1007 Ga0207641_10054513
1008 Ga0207641_10162679
1009 Ga0207648_10021934
1010 Ga0207648_10298005
1011 Ga0207676_10031677
1012 Ga0207676_10330705
1013 Ga0207676_10767756
1014 Ga0207676_10883261
1015 Ga0207676_11340040
1016 Ga0207674_10007498
1017 Ga0207674_10010952
1018 Ga0207674_10057757
1019 Ga0207674_10176236
1020 Ga0207674_10684557
1021 Ga0207683_10141641
1022 Ga0207698_10036052
1023 Ga0268266_10130924
1024 Ga0268266_11046060
1025 Ga0268264_10011760
1026 Ga0268264_10072861
1027 Ga0265323_10001898
1028 Ga0265338_10250555
1029 Ga0265338_10477296
1030 Ga0265760_10327200
1031 Ga0265332_10025449
1032 Ga0265325_10012824
1033 Ga0265325_10034264
1034 Ga0265325_10175178
1035 Ga0265339_10213089
1036 Ga0265316_10509821
1037 Ga0265316_10676866
1038 Ga0265313_10081691
1039 Ga0265314_10000961
1040 Ga0265314_10068787
1041 Ga0265314_10314264
1042 Ga0265342_10347339
1043 Ga0373944_0177765
1044 Ga0373923_0039475
1045 Ga0373923_0060050
1046 Ga0373936_0226406
1047 Ga0373941_0060439
1048 Ga0373945_0083652
1049 Ga0373954_0008740
1050 Ga0373954_0062273
1051 Ga0373954_0123992
1052 Ga0373956_0116651
1053 Ga0373956_0590750
1054 Ga0373957_0308297
1055 Ga0373946_0035416
1056 Ga0373955_0070270
1057 Ga0373955_0830222
1058 Ga0373924_0320417
1059 Ga0373935_0248359
1060 Ga0373935_0304546
1061 Ga0373935_0902566
1062 Ga0373935_1167382
1063 Ga0373935_1253038
1064 Ga0373927_0006720
1065 Ga0373927_0017205
1066 Ga0373927_0408300
1067 Ga0373927_1125764
1068 Ga0373947_0045329
1069 Ga0373937_0004697
1070 Ga0373937_0027583
1071 Ga0373937_0326960
1072 Ga0373937_1410079
1073 Ga0373925_0009655
1074 Ga0373925_0026762
1075 Ga0373925_0311327
1076 Ga0373925_0905565
1077 Ga0436364_0845902
1078 Ga0436364_1287601
1079 Ga0436364_1450240
1080 Ga0436360_1113823
1081 Ga0451576_0080923
1082 Ga0451576_0630933
1083 Ga0451576_0783787
1084 Ga0451576_0801494
1085 Ga0466958_0702508
1086 Ga0495653_0206146
1087 Ga0495653_0279848
1088 Ga0495580_0001458
1089 Ga0495580_0238535
1090 Ga0495580_0240635
1091 Ga0495580_0480595
1092 Ga0495580_0715549
1093 Ga0495582_0223241
1094 Ga0495582_0296149
1095 Ga0495664_0196680
1096 Ga0495664_0460765
1097 Ga0495594_0800663
1098 Ga0495608_0341184
1099 Ga0495630_1531550
1100 Ga0495652_0107299
1101 Ga0495665_0121749
1102 Ga0495586_0556306
1103 Ga0495587_0040764
1104 Ga0495645_0175342
1105 Ga0495645_0436982
1106 Ga0495635_0154713
1107 Ga0495635_0362700
1108 Ga0495623_0605246
1109 Ga0495658_0051752
1110 Ga0495658_0548605
1111 Ga0495669_0337215
1112 Ga0495613_0099988
1113 Ga0495613_0283928
1114 Ga0495674_0036855
1115 Ga0495674_0133321
1116 Ga0495674_0455755
1117 Ga0495680_0412537
1118 Ga0495675_0104051
1119 Ga0495675_0206218
1120 Ga0495684_0003975
1121 Ga0495684_0074587
1122 Ga0495684_0933315
1123 Ga0495593_0651625
1124 Ga0496103_0661914
1125 Ga0496104_0488727
1126 Ga0496106_1180671
1127 Ga0496107_1093049
1128 Ga0496112_0867567
1129 Ga0496115_0099050
1130 Ga0501031_0001167
1131 Ga0501032_0000322
1132 Ga0501032_0109885
1133 Ga0501033_0011744
1134 Ga0501034_0018211
1135 Ga0501034_0143744
1136 Ga0501036_0000861
1137 Ga0501037_0026323
1138 Ga0501038_0000547
1139 Ga0501039_0067437
1140 Ga0501043_0001136
1141 Ga0501043_1295979
1142 Ga0501046_0000679
1143 Ga0501047_0028074
1144 Ga0501047_0039341
1145 Ga0501048_0007878
1146 Ga0501048_0946440
1147 Ga0501067_0000421
1148 Ga0501068_0000365
1149 Ga0501069_0011826
1150 Ga0501069_0436866
1151 Ga0501070_0011218
1152 Ga0501070_0023646
1153 Ga0501074_0028870
1154 Ga0501076_0042455
1155 Ga0501077_0172892
1156 Ga0501240_079709
1157 Ga0501257_082969
1158 Ga0501225_0275853
1159 Ga0501079_0004407
1160 Ga0501080_0002099
1161 Ga0501083_0004808
1162 Ga0501268_086329
1163 Ga0501035_0029672
1164 Ga0501035_0116052
1165 Ga0501044_0000766
1166 Ga0501044_0005535
1167 Ga0501044_0034013
1168 Ga0501044_0168596
1169 nmdc:mga05p37_69753_c1
1170 nmdc:mga0qj67_61820_c1
1171 nmdc:mga06r32_32254_c1
1172 nmdc:mga0n895_1278390_c1
1173 nmdc:mga0rr50_1483475_c1
1174 nmdc:mga08x19_651827_c1
1175 nmdc:mga08x19_78314_c1
1176 Ga0495601_0308853
1177 Ga0495612_0292947
1178 Ga0495619_0308704
1179 Ga0501084_0007579
1180 Ga0501082_0004260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

18

112

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ofs-assembly1.cif.gz_A the crystal structure of the periplasmic protease pqql from escherichia coli 0.8085 69 98
7mp5-assembly1.cif.gz_A autoinhibited neurofibrobmin 0.7912 73 101
8etg-assembly1.cif.gz_p fkbp39 associated 60s nascent ribosome state 3 0.772 7 33
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.7697 2 105
2jk6-assembly1.cif.gz_A structure of trypanothione reductase from leishmania infantum 0.7551 70 97
ID Description Score Start End Superfamily
af_Q54FW9_1_133_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.837 72 98 2.130.10.10
af_Q9FKR9_263_472_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.826 72 99 2.130.10.10
af_Q58732_1_146_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8114 11 32 3.40.1190.20
1qhuA01 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.797 72 98 2.110.10.10
af_A0A0P0Y636_76_246_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7931 67 100 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A7C3DCB0-F1-model_v4 DUF971 domain-containing protein 0.897 5 115 GO:0046872
AF-A0A7V2HHM3-F1-model_v4 DUF971 domain-containing protein 0.8883 1 116 GO:0046872
AF-A0A7V2HHM3-F1-model_v4 DUF971 domain-containing protein 0.8812 1 116 GO:0046872
AF-A0A7C5EYK4-F1-model_v4 DUF971 domain-containing protein 0.8776 3 115 GO:0046872
AF-A0A2V8TUP0-F1-model_v4 DUF971 domain-containing protein 0.8651 1 115 GO:0046872

Map