F466727

General Info

Members Datasets Scaffolds Average Seq Length
587 193 1174 251

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8025413630|8025414652
Length 256
Sequence TIRVDGLHVRHRRTTALDGVDLEFSTGVHGLLGPNGAGKTSLIRVLATAAGPTAGRVRILGHDLADRAGRTEVRRRLGYLPQHFGHYPGFTVREFVSYMAWLKEVPAALAPGAVERALDRAGLTADAGTPLKRLSGGLVRRAGIAQALVNEPAVLLLDEPTAGLDPEQRLDFRVLLRALAEETTVLVSTHLVEDVADACSTVTLLDAGRVALRDTPAGLARKGSEAPEELGGNALERGYTLALRDHRSAPAGGGAR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
85 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
88 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
92 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
187 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
188 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
189 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
190 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
191 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
192 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
193 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0.68
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 4.94
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10022211 3300003659 Bacteria 1372
2 Ga0070658_10076078 3300005327 Bacteria 2753
3 Ga0070683_100055222 3300005329 Bacteria 3685
4 Ga0070683_100113089 3300005329 Bacteria 2562
5 Ga0070680_100047352 3300005336 Bacteria 3501
6 Ga0070680_100357548 3300005336 Bacteria 1242
7 Ga0070691_10233328 3300005341 Bacteria 980
8 Ga0070692_10115176 3300005345 Bacteria 1492
9 Ga0070709_10000169 3300005434 Bacteria 41293
10 Ga0070709_10001132 3300005434 Bacteria 14680
11 Ga0070709_10051682 3300005434 Bacteria 2580
12 Ga0070709_10085902 3300005434 Bacteria 2064
13 Ga0070714_100000248 3300005435 Bacteria 42012
14 Ga0070714_100002950 3300005435 Bacteria 12606
15 Ga0070714_100003100 3300005435 Bacteria 12346
16 Ga0070714_100016797 3300005435 Bacteria 5918
17 Ga0070714_100031930 3300005435 Bacteria 4396
18 Ga0070714_100041171 3300005435 Bacteria 3897
19 Ga0070714_100086214 3300005435 Bacteria 2744
20 Ga0070714_100237213 3300005435 Bacteria 1682
21 Ga0070714_100265667 3300005435 Bacteria 1590
22 Ga0070713_100004888 3300005436 Bacteria 9095
23 Ga0070713_100053779 3300005436 Bacteria 3338
24 Ga0070713_100106985 3300005436 Bacteria 2432
25 Ga0070713_100148962 3300005436 Bacteria 2080
26 Ga0070713_100163364 3300005436 Bacteria 1989
27 Ga0070710_10001626 3300005437 Bacteria 10618
28 Ga0070710_10008512 3300005437 Bacteria 4994
29 Ga0070710_10017429 3300005437 Bacteria 3675
30 Ga0070710_10095897 3300005437 Bacteria 1757
31 Ga0070710_10109377 3300005437 Bacteria 1658
32 Ga0070711_100019804 3300005439 Bacteria 4324
33 Ga0070711_100026762 3300005439 Bacteria 3782
34 Ga0070711_100229659 3300005439 Bacteria 1446
35 Ga0070708_100004516 3300005445 Bacteria 10953
36 Ga0070708_100009003 3300005445 Bacteria 8045
37 Ga0070708_100010798 3300005445 Bacteria 7417
38 Ga0070708_100030949 3300005445 Bacteria 4629
39 Ga0070708_100175435 3300005445 Bacteria 2002
40 Ga0070708_100179095 3300005445 Bacteria 1981
41 Ga0070708_100249438 3300005445 Bacteria 1667
42 Ga0070681_10042209 3300005458 Bacteria 4571
43 Ga0070681_10382986 3300005458 Bacteria 1317
44 Ga0070706_100005913 3300005467 Bacteria 11592
45 Ga0070706_100007912 3300005467 Bacteria 9925
46 Ga0070706_100008434 3300005467 Bacteria 9599
47 Ga0070706_100011354 3300005467 Bacteria 8278
48 Ga0070706_100024777 3300005467 Bacteria 5523
49 Ga0070706_100207065 3300005467 Bacteria 1832
50 Ga0070706_100370169 3300005467 Bacteria 1335
51 Ga0070707_100000524 3300005468 Bacteria 38316
52 Ga0070707_100026532 3300005468 Bacteria 5501
53 Ga0070707_100030252 3300005468 Bacteria 5153
54 Ga0070707_100052037 3300005468 Bacteria 3925
55 Ga0070707_100138502 3300005468 Bacteria 2368
56 Ga0070707_100327481 3300005468 Bacteria 1488
57 Ga0070698_100001175 3300005471 Bacteria 29045
58 Ga0070698_100003208 3300005471 Bacteria 18015
59 Ga0070698_100057071 3300005471 Bacteria 3952
60 Ga0070698_100081309 3300005471 Bacteria 3235
61 Ga0070698_100091655 3300005471 Bacteria 3021
62 Ga0070699_100017806 3300005518 Bacteria 6101
63 Ga0070699_100058095 3300005518 Bacteria 3351
64 Ga0070699_100267275 3300005518 Bacteria 1530
65 Ga0070679_100039363 3300005530 Bacteria 4698
66 Ga0070679_100710109 3300005530 Bacteria 948
67 Ga0070684_100059330 3300005535 Bacteria 3345
68 Ga0070684_100093119 3300005535 Bacteria 2682
69 Ga0070697_100016531 3300005536 Bacteria 5804
70 Ga0070697_100203264 3300005536 Bacteria 1684
71 Ga0070696_100088341 3300005546 Bacteria 2203
72 Ga0070704_100419187 3300005549 Bacteria 1146
73 Ga0068855_100277070 3300005563 Bacteria 1864
74 Ga0070664_100132797 3300005564 Bacteria 2187
75 Ga0070664_100135180 3300005564 Bacteria 2168
76 Ga0068857_100009921 3300005577 Bacteria 8265
77 Ga0068857_100217920 3300005577 Bacteria 1743
78 Ga0068856_100248210 3300005614 Bacteria 1795
79 Ga0068864_100021320 3300005618 Bacteria 5428
80 Ga0068863_100049864 3300005841 Bacteria 3970
81 Ga0068863_100089235 3300005841 Bacteria 2923
82 Ga0081540_1000058 3300005983 Bacteria 120635
83 Ga0081539_10038756 3300005985 Bacteria 2820
84 Ga0070717_10017491 3300006028 Bacteria 5579
85 Ga0070717_10056782 3300006028 Bacteria 3235
86 Ga0070717_10068657 3300006028 Bacteria 2951
87 Ga0070717_10171930 3300006028 Bacteria 1885
88 Ga0070715_10067946 3300006163 Bacteria 1583
89 Ga0070716_100000322 3300006173 Bacteria 19284
90 Ga0070716_100013661 3300006173 Bacteria 4143
91 Ga0070716_100018054 3300006173 Bacteria 3669
92 Ga0070716_100039677 3300006173 Bacteria 2615
93 Ga0070712_100005009 3300006175 Bacteria 8201
94 Ga0070712_100124381 3300006175 Bacteria 1945
95 Ga0070712_100137390 3300006175 Bacteria 1860
96 Ga0070712_100194361 3300006175 Bacteria 1590
97 Ga0070712_100367497 3300006175 Bacteria 1181
98 Ga0075434_100089743 3300006871 Bacteria 3075
99 Ga0075436_100447264 3300006914 Bacteria 941
100 Ga0075435_100003850 3300007076 Bacteria 10231
101 Ga0075435_100064687 3300007076 Bacteria 2972
102 Ga0105250_10027254 3300009092 Bacteria 2302
103 Ga0114129_10019031 3300009147 Bacteria 9782
104 Ga0114129_10130036 3300009147 Bacteria 3459
105 Ga0105243_10129055 3300009148 Bacteria 2142
106 Ga0105248_10010665 3300009177 Bacteria 10137
107 Ga0157369_10050108 3300013105 Bacteria 4524
108 Ga0157378_10168282 3300013297 Bacteria 2054
109 Ga0157372_10863274 3300013307 Bacteria 1050
110 Ga0163163_10019356 3300014325 Bacteria 6393
111 Ga0157379_10130752 3300014968 Bacteria 2260
112 Ga0157376_10015006 3300014969 Bacteria 5840
113 Ga0206356_10327652 3300020070 Bacteria 3343
114 Ga0206354_11008789 3300020081 Bacteria 2394
115 Ga0213875_10000870 3300021388 Bacteria 22272
116 Ga0213875_10008766 3300021388 Bacteria 5162
117 Ga0224712_10012697 3300022467 Bacteria 2659
118 Ga0224712_10148584 3300022467 Bacteria 1037
119 Ga0224572_1000848 3300024225 Bacteria 4088
120 Ga0224572_1003225 3300024225 Bacteria 2732
121 Ga0207692_10001114 3300025898 Bacteria 9877
122 Ga0207692_10006577 3300025898 Bacteria 4722
123 Ga0207692_10021898 3300025898 Bacteria 2932
124 Ga0207692_10056455 3300025898 Bacteria 2014
125 Ga0207692_10110367 3300025898 Bacteria 1525
126 Ga0207688_10008057 3300025901 Bacteria 5733
127 Ga0207685_10001214 3300025905 Bacteria 5224
128 Ga0207685_10007308 3300025905 Bacteria 3070
129 Ga0207685_10027659 3300025905 Bacteria 1988
130 Ga0207685_10035050 3300025905 Bacteria 1828
131 Ga0207685_10128083 3300025905 Bacteria 1123
132 Ga0207699_10000201 3300025906 Bacteria 35645
133 Ga0207699_10001064 3300025906 Bacteria 12975
134 Ga0207699_10031159 3300025906 Bacteria 2992
135 Ga0207699_10036494 3300025906 Bacteria 2802
136 Ga0207699_10037080 3300025906 Bacteria 2784
137 Ga0207699_10066467 3300025906 Bacteria 2189
138 Ga0207699_10251592 3300025906 Bacteria 1218
139 Ga0207705_10106679 3300025909 Bacteria 2066
140 Ga0207684_10006667 3300025910 Bacteria 10492
141 Ga0207684_10016082 3300025910 Bacteria 6426
142 Ga0207684_10044702 3300025910 Bacteria 3756
143 Ga0207684_10066150 3300025910 Bacteria 3070
144 Ga0207684_10066188 3300025910 Bacteria 3069
145 Ga0207684_10067517 3300025910 Bacteria 3039
146 Ga0207684_10234533 3300025910 Bacteria 1583
147 Ga0207684_10256030 3300025910 Bacteria 1510
148 Ga0207654_10318244 3300025911 Bacteria 1063
149 Ga0207707_10175105 3300025912 Bacteria 1874
150 Ga0207707_10239383 3300025912 Bacteria 1578
151 Ga0207693_10020950 3300025915 Bacteria 5197
152 Ga0207693_10183076 3300025915 Bacteria 1649
153 Ga0207693_10265232 3300025915 Bacteria 1346
154 Ga0207693_10382838 3300025915 Bacteria 1100
155 Ga0207663_10011651 3300025916 Bacteria 4730
156 Ga0207663_10039599 3300025916 Bacteria 2857
157 Ga0207646_10000065 3300025922 Bacteria 149387
158 Ga0207646_10012147 3300025922 Bacteria 8285
159 Ga0207646_10029326 3300025922 Bacteria 5003
160 Ga0207646_10039254 3300025922 Bacteria 4261
161 Ga0207646_10058533 3300025922 Bacteria 3442
162 Ga0207646_10110000 3300025922 Bacteria 2473
163 Ga0207646_10128566 3300025922 Bacteria 2279
164 Ga0207646_10392563 3300025922 Bacteria 1253
165 Ga0207646_10718433 3300025922 Bacteria 893
166 Ga0207700_10000229 3300025928 Bacteria 33559
167 Ga0207700_10002334 3300025928 Bacteria 10877
168 Ga0207700_10003787 3300025928 Bacteria 8839
169 Ga0207700_10055210 3300025928 Bacteria 2985
170 Ga0207700_10063995 3300025928 Bacteria 2800
171 Ga0207700_10092031 3300025928 Bacteria 2397
172 Ga0207700_10322581 3300025928 Bacteria 1339
173 Ga0207664_10000991 3300025929 Bacteria 19053
174 Ga0207664_10001429 3300025929 Bacteria 15697
175 Ga0207664_10003308 3300025929 Bacteria 10722
176 Ga0207664_10007535 3300025929 Bacteria 7551
177 Ga0207664_10026474 3300025929 Bacteria 4385
178 Ga0207664_10037601 3300025929 Bacteria 3748
179 Ga0207664_10041648 3300025929 Bacteria 3579
180 Ga0207664_10055236 3300025929 Bacteria 3151
181 Ga0207664_10067729 3300025929 Bacteria 2866
182 Ga0207664_10085017 3300025929 Bacteria 2581
183 Ga0207664_10102988 3300025929 Bacteria 2361
184 Ga0207664_10153825 3300025929 Bacteria 1956
185 Ga0207665_10003623 3300025939 Bacteria 10319
186 Ga0207665_10022924 3300025939 Bacteria 4110
187 Ga0207665_10024184 3300025939 Bacteria 4004
188 Ga0207665_10025720 3300025939 Bacteria 3883
189 Ga0207665_10213710 3300025939 Bacteria 1410
190 Ga0207665_10228622 3300025939 Bacteria 1366
191 Ga0207711_10044604 3300025941 Bacteria 3785
192 Ga0207711_10177434 3300025941 Bacteria 1936
193 Ga0207661_10031985 3300025944 Bacteria 4071
194 Ga0207667_10134489 3300025949 Bacteria 2546
195 Ga0207703_10272313 3300026035 Bacteria 1534
196 Ga0207702_10126046 3300026078 Bacteria 2299
197 Ga0207702_10271031 3300026078 Bacteria 1601
198 Ga0207702_10364799 3300026078 Bacteria 1385
199 Ga0207641_10177324 3300026088 Bacteria 1949
200 Ga0207641_10203753 3300026088 Bacteria 1826
201 Ga0207641_10264471 3300026088 Bacteria 1612
202 Ga0207676_10052365 3300026095 Bacteria 3190
203 Ga0207674_10101830 3300026116 Bacteria 2852
204 Ga0307512_10004906 3300030522 Bacteria 14286
205 Ga0265316_10382926 3300031344 Bacteria 1015
206 Ga0307513_10342951 3300031456 Bacteria 1244
207 Ga0307516_10028339 3300031730 Bacteria 5668
208 Ga0307406_10080957 3300031901 Bacteria 2158
209 Ga0307407_10218959 3300031903 Bacteria 1286
210 Ga0307412_10715768 3300031911 Bacteria 861
211 Ga0307416_100045692 3300032002 Bacteria 3450
212 Ga0307507_10138564 3300033179 Bacteria 1874
213 Ga0373958_0019851 3300034819 Bacteria 1232
214 Ga0373938_0008049 3300034957 Bacteria 1874
215 Ga0373934_0000023 3300035086 Bacteria 49590
216 Ga0373934_0000154 3300035086 Bacteria 25135
217 Ga0373934_0021112 3300035086 Bacteria 2508
218 Ga0373934_0045924 3300035086 Bacteria 1727
219 Ga0373934_0079020 3300035086 Bacteria 1320
220 Ga0373940_0014396 3300035088 Bacteria 1929
221 Ga0373949_0017673 3300035090 Bacteria 1610
222 Ga0373923_0003399 3300035111 Bacteria 5095
223 Ga0373923_0004181 3300035111 Bacteria 4763
224 Ga0373923_0018323 3300035111 Bacteria 2693
225 Ga0373923_0133214 3300035111 Bacteria 1118
226 Ga0373936_0001459 3300035113 Bacteria 8588
227 Ga0373939_0019201 3300035114 Bacteria 1841
228 Ga0373941_0061518 3300035115 Bacteria 1223
229 Ga0373945_0009453 3300035116 Bacteria 3195
230 Ga0373953_0000008 3300035117 Bacteria 51677
231 Ga0373953_0030223 3300035117 Bacteria 2099
232 Ga0373953_0040390 3300035117 Bacteria 1852
233 Ga0373954_0000628 3300035118 Bacteria 13484
234 Ga0373954_0012902 3300035118 Bacteria 3721
235 Ga0373954_0013336 3300035118 Bacteria 3663
236 Ga0373956_0000126 3300035119 Bacteria 26958
237 Ga0373956_0001007 3300035119 Bacteria 11616
238 Ga0373956_0004478 3300035119 Bacteria 5586
239 Ga0373956_0028741 3300035119 Bacteria 2420
240 Ga0373956_0035682 3300035119 Bacteria 2193
241 Ga0373957_0000300 3300035120 Bacteria 12384
242 Ga0373957_0034167 3300035120 Bacteria 1881
243 Ga0373957_0052340 3300035120 Bacteria 1564
244 Ga0373946_0076237 3300035171 Bacteria 1459
245 Ga0373955_0000005 3300035172 Bacteria 108267
246 Ga0373955_0000074 3300035172 Bacteria 40758
247 Ga0373955_0009927 3300035172 Bacteria 4480
248 Ga0373955_0013706 3300035172 Bacteria 3928
249 Ga0373955_0022467 3300035172 Bacteria 3200
250 Ga0373942_0043635 3300035207 Bacteria 1233
251 Ga0373942_0047755 3300035207 Bacteria 1190
252 Ga0373924_0001962 3300035410 Bacteria 6842
253 Ga0373924_0019271 3300035410 Bacteria 2641
254 Ga0373924_0020366 3300035410 Bacteria 2577
255 Ga0373924_0021438 3300035410 Bacteria 2520
256 Ga0373924_0049520 3300035410 Bacteria 1738
257 Ga0373924_0270298 3300035410 Bacteria 754
258 Ga0373935_0018404 3300035692 Bacteria 4248
259 Ga0373935_0034285 3300035692 Bacteria 3163
260 Ga0373935_0041809 3300035692 Bacteria 2880
261 Ga0373935_0365459 3300035692 Bacteria 1031
262 Ga0373927_0043458 3300035695 Bacteria 2909
263 Ga0373933_0000043 3300035724 Bacteria 78147
264 Ga0373933_0000050 3300035724 Bacteria 72501
265 Ga0373933_0000337 3300035724 Bacteria 30069
266 Ga0373933_0043680 3300035724 Bacteria 2652
267 Ga0373933_0141053 3300035724 Bacteria 1521
268 Ga0373947_0096590 3300035725 Bacteria 1850
269 Ga0373947_0122592 3300035725 Bacteria 1652
270 Ga0373947_0125117 3300035725 Bacteria 1636
271 Ga0373947_0176833 3300035725 Bacteria 1387
272 Ga0373947_0351366 3300035725 Bacteria 989
273 Ga0373937_0000245 3300036401 Bacteria 53041
274 Ga0373937_0000314 3300036401 Bacteria 45886
275 Ga0373937_0001672 3300036401 Bacteria 18646
276 Ga0373937_0006134 3300036401 Bacteria 10348
277 Ga0373937_0219085 3300036401 Bacteria 1791
278 Ga0373937_1104758 3300036401 Bacteria 741
279 Ga0373925_0000338 3300037068 Bacteria 48691
280 Ga0373925_0000356 3300037068 Bacteria 47640
281 Ga0373925_0018059 3300037068 Bacteria 5122
282 Ga0373925_0085318 3300037068 Bacteria 2407
283 Ga0373925_0110536 3300037068 Bacteria 2122
284 Ga0373925_0268259 3300037068 Bacteria 1372
285 Ga0436364_0646689 3300037853 Bacteria 5194
286 Ga0436364_0658848 3300037853 Bacteria 108122
287 Ga0436363_0363212 3300039450 Bacteria 896
288 Ga0466969_0108825 3300044656 Bacteria 1299
289 Ga0466966_0049230 3300044684 Bacteria 2684
290 Ga0466961_0026303 3300044693 Bacteria 3741
291 Ga0466963_0324905 3300044694 Bacteria 1083
292 Ga0466959_0069610 3300045049 Bacteria 2549
293 Ga0466958_0073254 3300045836 Bacteria 2098
294 Ga0466967_0495796 3300045976 Bacteria 1198
295 Ga0495592_0000092 3300046454 Bacteria 79147
296 Ga0495592_0000251 3300046454 Bacteria 45886
297 Ga0495592_0004954 3300046454 Bacteria 9801
298 Ga0495592_0010673 3300046454 Bacteria 6925
299 Ga0495592_0040563 3300046454 Bacteria 3493
300 Ga0495592_0059115 3300046454 Bacteria 2824
301 Ga0495603_0074294 3300046455 Bacteria 1996
302 Ga0495629_0004925 3300046459 Bacteria 10026
303 Ga0495629_0015538 3300046459 Bacteria 5465
304 Ga0495629_0025170 3300046459 Bacteria 4233
305 Ga0495629_0142343 3300046459 Bacteria 1668
306 Ga0495629_0171132 3300046459 Bacteria 1507
307 Ga0495629_0320006 3300046459 Bacteria 1060
308 Ga0495651_0000066 3300046462 Bacteria 77538
309 Ga0495651_0000194 3300046462 Bacteria 45886
310 Ga0495651_0006216 3300046462 Bacteria 9130
311 Ga0495651_0013362 3300046462 Bacteria 6351
312 Ga0495651_0062829 3300046462 Bacteria 2840
313 Ga0495651_0079149 3300046462 Bacteria 2484
314 Ga0495651_0250401 3300046462 Bacteria 1210
315 Ga0495651_0292197 3300046462 Bacteria 1096
316 Ga0495653_0004097 3300046463 Bacteria 11789
317 Ga0495653_0005027 3300046463 Bacteria 10732
318 Ga0495653_0005849 3300046463 Bacteria 10065
319 Ga0495653_0014016 3300046463 Bacteria 6535
320 Ga0495653_0016024 3300046463 Bacteria 6108
321 Ga0495653_0020637 3300046463 Bacteria 5338
322 Ga0495653_0037618 3300046463 Bacteria 3800
323 Ga0495653_0044709 3300046463 Bacteria 3436
324 Ga0495580_0025329 3300046472 Bacteria 4336
325 Ga0495580_0194793 3300046472 Bacteria 1397
326 Ga0495580_0408023 3300046472 Bacteria 915
327 Ga0495582_0013316 3300046473 Bacteria 4528
328 Ga0495582_0014138 3300046473 Bacteria 4392
329 Ga0495582_0014688 3300046473 Bacteria 4303
330 Ga0495639_0007314 3300046475 Bacteria 4737
331 Ga0495639_0037175 3300046475 Bacteria 2182
332 Ga0495639_0073239 3300046475 Bacteria 1585
333 Ga0495639_0103509 3300046475 Bacteria 1346
334 Ga0495662_0000815 3300046476 Bacteria 15150
335 Ga0495662_0004835 3300046476 Bacteria 6748
336 Ga0495662_0012577 3300046476 Bacteria 4128
337 Ga0495662_0015998 3300046476 Bacteria 3639
338 Ga0495662_0021623 3300046476 Bacteria 3108
339 Ga0495662_0178026 3300046476 Bacteria 1048
340 Ga0495662_0196456 3300046476 Bacteria 994
341 Ga0495664_0001742 3300046477 Bacteria 11573
342 Ga0495664_0016190 3300046477 Bacteria 4246
343 Ga0495664_0022388 3300046477 Bacteria 3662
344 Ga0495664_0026341 3300046477 Bacteria 3386
345 Ga0495664_0108067 3300046477 Bacteria 1678
346 Ga0495664_0130992 3300046477 Bacteria 1518
347 Ga0495608_0000070 3300046511 Bacteria 77533
348 Ga0495608_0000172 3300046511 Bacteria 46028
349 Ga0495608_0006176 3300046511 Bacteria 8506
350 Ga0495608_0047887 3300046511 Bacteria 2840
351 Ga0495608_0054814 3300046511 Bacteria 2635
352 Ga0495618_0006205 3300046514 Bacteria 7250
353 Ga0495618_0017789 3300046514 Bacteria 4362
354 Ga0495618_0023687 3300046514 Bacteria 3798
355 Ga0495618_0029451 3300046514 Bacteria 3426
356 Ga0495618_0046304 3300046514 Bacteria 2745
357 Ga0495618_0078317 3300046514 Bacteria 2107
358 Ga0495618_0139584 3300046514 Bacteria 1550
359 Ga0495628_0002286 3300046516 Bacteria 17334
360 Ga0495628_0003161 3300046516 Bacteria 14759
361 Ga0495628_0009644 3300046516 Bacteria 8237
362 Ga0495628_0027304 3300046516 Bacteria 4646
363 Ga0495628_0027968 3300046516 Bacteria 4584
364 Ga0495628_0077657 3300046516 Bacteria 2582
365 Ga0495630_0094141 3300046517 Bacteria 2265
366 Ga0495630_0142933 3300046517 Bacteria 1819
367 Ga0495630_0180740 3300046517 Bacteria 1608
368 Ga0495630_0187378 3300046517 Bacteria 1578
369 Ga0495630_0201896 3300046517 Bacteria 1517
370 Ga0495666_0012825 3300046526 Bacteria 4178
371 Ga0495652_0000232 3300046529 Bacteria 65303
372 Ga0495652_0001412 3300046529 Bacteria 26641
373 Ga0495652_0001678 3300046529 Bacteria 24017
374 Ga0495652_0004890 3300046529 Bacteria 12716
375 Ga0495652_0022659 3300046529 Bacteria 5572
376 Ga0495652_0073706 3300046529 Bacteria 2841
377 Ga0495652_0095564 3300046529 Bacteria 2421
378 Ga0495652_0105690 3300046529 Bacteria 2274
379 Ga0495652_0132401 3300046529 Bacteria 1972
380 Ga0495652_0147573 3300046529 Bacteria 1841
381 Ga0495652_0166431 3300046529 Bacteria 1706
382 Ga0495652_0274199 3300046529 Bacteria 1238
383 Ga0495665_0004965 3300046531 Bacteria 7167
384 Ga0495665_0007717 3300046531 Bacteria 5823
385 Ga0495665_0011035 3300046531 Bacteria 4888
386 Ga0495665_0024583 3300046531 Bacteria 3236
387 Ga0495665_0059916 3300046531 Bacteria 2009
388 Ga0495640_0003431 3300046533 Bacteria 12761
389 Ga0495640_0004263 3300046533 Bacteria 11434
390 Ga0495640_0005105 3300046533 Bacteria 10428
391 Ga0495640_0018371 3300046533 Bacteria 5189
392 Ga0495640_0058649 3300046533 Bacteria 2624
393 Ga0495640_0185254 3300046533 Bacteria 1325
394 Ga0495586_0027343 3300046535 Bacteria 3052
395 Ga0495586_0027932 3300046535 Bacteria 3019
396 Ga0495586_0052799 3300046535 Bacteria 2201
397 Ga0495587_0000077 3300046536 Bacteria 77532
398 Ga0495587_0000148 3300046536 Bacteria 52704
399 Ga0495587_0003079 3300046536 Bacteria 11139
400 Ga0495587_0006336 3300046536 Bacteria 7715
401 Ga0495587_0014996 3300046536 Bacteria 4844
402 Ga0495587_0027708 3300046536 Bacteria 3449
403 Ga0495587_0064313 3300046536 Bacteria 2143
404 Ga0495645_0003078 3300046543 Bacteria 11300
405 Ga0495645_0003719 3300046543 Bacteria 10372
406 Ga0495645_0028779 3300046543 Bacteria 4037
407 Ga0495645_0093284 3300046543 Bacteria 2149
408 Ga0495645_0131392 3300046543 Bacteria 1754
409 Ga0495645_0199289 3300046543 Bacteria 1359
410 Ga0495645_0227680 3300046543 Bacteria 1250
411 Ga0495667_0000071 3300046559 Bacteria 77538
412 Ga0495667_0000196 3300046559 Bacteria 40761
413 Ga0495667_0003378 3300046559 Bacteria 10680
414 Ga0495667_0013506 3300046559 Bacteria 5525
415 Ga0495667_0027045 3300046559 Bacteria 3866
416 Ga0495667_0066187 3300046559 Bacteria 2362
417 Ga0495667_0076913 3300046559 Bacteria 2171
418 Ga0495667_0276892 3300046559 Bacteria 1065
419 Ga0495634_0007289 3300046642 Bacteria 8327
420 Ga0495634_0017638 3300046642 Bacteria 5092
421 Ga0495634_0039899 3300046642 Bacteria 3195
422 Ga0495634_0094725 3300046642 Bacteria 1934
423 Ga0495634_0096460 3300046642 Bacteria 1914
424 Ga0495634_0105181 3300046642 Bacteria 1820
425 Ga0495635_0023771 3300046663 Bacteria 4270
426 Ga0495635_0045999 3300046663 Bacteria 3010
427 Ga0495635_0046149 3300046663 Bacteria 3005
428 Ga0495635_0063531 3300046663 Bacteria 2535
429 Ga0495657_0000095 3300046675 Bacteria 77538
430 Ga0495657_0000287 3300046675 Bacteria 45887
431 Ga0495657_0030088 3300046675 Bacteria 3804
432 Ga0495657_0056349 3300046675 Bacteria 2617
433 Ga0495657_0060319 3300046675 Bacteria 2513
434 Ga0495657_0096347 3300046675 Bacteria 1890
435 Ga0495599_0000145 3300046678 Bacteria 45886
436 Ga0495599_0008828 3300046678 Bacteria 6136
437 Ga0495599_0010868 3300046678 Bacteria 5579
438 Ga0495599_0016158 3300046678 Bacteria 4632
439 Ga0495599_0120183 3300046678 Bacteria 1633
440 Ga0495623_0000117 3300046679 Bacteria 48360
441 Ga0495623_0002521 3300046679 Bacteria 12124
442 Ga0495623_0010376 3300046679 Bacteria 6029
443 Ga0495623_0041666 3300046679 Bacteria 2927
444 Ga0495623_0095557 3300046679 Bacteria 1817
445 Ga0495623_0185747 3300046679 Bacteria 1204
446 Ga0495646_0006841 3300046680 Bacteria 7237
447 Ga0495646_0026270 3300046680 Bacteria 3656
448 Ga0495646_0044367 3300046680 Bacteria 2718
449 Ga0495646_0079947 3300046680 Bacteria 1907
450 Ga0495647_0064231 3300046681 Bacteria 1455
451 Ga0495658_0046836 3300046683 Bacteria 2432
452 Ga0495658_0070550 3300046683 Bacteria 2028
453 Ga0495658_0119698 3300046683 Bacteria 1591
454 Ga0495613_0018087 3300046689 Bacteria 5251
455 Ga0495613_0024004 3300046689 Bacteria 4543
456 Ga0495613_0518997 3300046689 Bacteria 800
457 Ga0495624_0041463 3300046690 Bacteria 2944
458 Ga0495624_0049416 3300046690 Bacteria 2667
459 Ga0495624_0070702 3300046690 Bacteria 2172
460 Ga0495624_0087328 3300046690 Bacteria 1926
461 Ga0495600_0035912 3300046809 Bacteria 3221
462 Ga0495600_0057232 3300046809 Bacteria 2547
463 Ga0495600_0071427 3300046809 Bacteria 2267
464 Ga0495600_0082247 3300046809 Bacteria 2101
465 Ga0495600_0088054 3300046809 Bacteria 2025
466 Ga0495581_0004048 3300047315 Bacteria 8439
467 Ga0495581_0009258 3300047315 Bacteria 5699
468 Ga0495581_0014868 3300047315 Bacteria 4515
469 Ga0495581_0025586 3300047315 Bacteria 3422
470 Ga0495581_0069824 3300047315 Bacteria 2031
471 Ga0495581_0100533 3300047315 Bacteria 1680
472 Ga0495581_0101066 3300047315 Bacteria 1675
473 Ga0495604_0000087 3300047317 Bacteria 79147
474 Ga0495604_0000362 3300047317 Bacteria 40761
475 Ga0495604_0002625 3300047317 Bacteria 14425
476 Ga0495604_0009434 3300047317 Bacteria 7717
477 Ga0495604_0060625 3300047317 Bacteria 2896
478 Ga0495604_0296876 3300047317 Bacteria 1086
479 Ga0495674_0021474 3300047319 Bacteria 5972
480 Ga0495674_0030238 3300047319 Bacteria 4926
481 Ga0495674_0062638 3300047319 Bacteria 3237
482 Ga0495674_0065891 3300047319 Bacteria 3144
483 Ga0495674_0073360 3300047319 Bacteria 2950
484 Ga0495674_0109683 3300047319 Bacteria 2340
485 Ga0495674_0121164 3300047319 Bacteria 2209
486 Ga0495674_0150826 3300047319 Bacteria 1949
487 Ga0495676_0118295 3300047321 Bacteria 1932
488 Ga0495676_0198245 3300047321 Bacteria 1396
489 Ga0495676_0307175 3300047321 Bacteria 1068
490 Ga0495676_0312199 3300047321 Bacteria 1058
491 Ga0495680_0000225 3300047322 Bacteria 61654
492 Ga0495680_0000586 3300047322 Bacteria 40881
493 Ga0495680_0004355 3300047322 Bacteria 13562
494 Ga0495680_0005836 3300047322 Bacteria 11521
495 Ga0495680_0007634 3300047322 Bacteria 9875
496 Ga0495680_0055501 3300047322 Bacteria 3072
497 Ga0495680_0126534 3300047322 Bacteria 1881
498 Ga0495675_0000157 3300047444 Bacteria 48143
499 Ga0495675_0018764 3300047444 Bacteria 4393
500 Ga0495675_0029895 3300047444 Bacteria 3475
501 Ga0495675_0036640 3300047444 Bacteria 3127
502 Ga0495675_0065939 3300047444 Bacteria 2289
503 Ga0495684_0009953 3300047471 Bacteria 7343
504 Ga0495684_0030546 3300047471 Bacteria 4136
505 Ga0495684_0050811 3300047471 Bacteria 3164
506 Ga0495684_0080618 3300047471 Bacteria 2471
507 Ga0495593_0009108 3300047673 Bacteria 5758
508 Ga0495593_0009666 3300047673 Bacteria 5596
509 Ga0495593_0023929 3300047673 Bacteria 3389
510 Ga0495593_0065359 3300047673 Bacteria 1897
511 Ga0495593_0106588 3300047673 Bacteria 1433
512 Ga0495602_0000287 3300048088 Bacteria 46187
513 Ga0495602_0000419 3300048088 Bacteria 39857
514 Ga0495602_0018684 3300048088 Bacteria 6910
515 Ga0495602_0042451 3300048088 Bacteria 4143
516 Ga0495602_0149167 3300048088 Bacteria 1840
517 Ga0495602_0216653 3300048088 Bacteria 1448
518 Ga0495602_0245660 3300048088 Bacteria 1336
519 Ga0495614_0007332 3300048089 Bacteria 4912
520 Ga0495614_0019769 3300048089 Bacteria 2914
521 Ga0496100_0237376 3300048903 Bacteria 1344
522 Ga0496101_0071972 3300048904 Bacteria 2536
523 Ga0496101_0075556 3300048904 Bacteria 2480
524 Ga0496102_0085443 3300048905 Bacteria 2913
525 Ga0496102_0268602 3300048905 Bacteria 1608
526 Ga0496104_0039926 3300048907 Bacteria 4396
527 Ga0496104_0052935 3300048907 Bacteria 3834
528 Ga0496104_0322963 3300048907 Bacteria 1456
529 Ga0496105_0005863 3300048908 Bacteria 9370
530 Ga0496105_0364880 3300048908 Bacteria 1151
531 Ga0496106_0017125 3300048909 Bacteria 5364
532 Ga0496107_0317976 3300048910 Bacteria 1158
533 Ga0496108_0011873 3300048911 Bacteria 7085
534 Ga0496108_0109543 3300048911 Bacteria 2360
535 Ga0496109_0002366 3300048912 Bacteria 15744
536 Ga0496109_0162253 3300048912 Bacteria 2094
537 Ga0496110_0008049 3300048913 Bacteria 8456
538 Ga0496111_0018945 3300048914 Bacteria 4772
539 Ga0496112_0070730 3300048915 Bacteria 3448
540 Ga0496112_0229818 3300048915 Bacteria 1809
541 Ga0496113_0131363 3300048916 Bacteria 1965
542 Ga0496113_0238930 3300048916 Bacteria 1449
543 Ga0496113_0340653 3300048916 Bacteria 1202
544 Ga0496113_0385905 3300048916 Bacteria 1124
545 Ga0496114_0034974 3300048917 Bacteria 4148
546 Ga0496114_0139845 3300048917 Bacteria 2095
547 Ga0496115_0043833 3300048918 Bacteria 3567
548 Ga0496115_0132875 3300048918 Bacteria 2051
549 Ga0496115_0200975 3300048918 Bacteria 1646
550 Ga0496126_0099643 3300048929 Bacteria 2544
551 Ga0496126_0106988 3300048929 Bacteria 2440
552 Ga0496126_0116107 3300048929 Bacteria 2327
553 Ga0501035_0013666 3300049822 Bacteria 7489
554 Ga0501044_0380227 3300049823 Bacteria 1327
555 nmdc:mga05p37_111846_c1 3300050507 Bacteria 3358
556 nmdc:mga05p37_1542_c1 3300050507 Bacteria 26771
557 nmdc:mga05p37_628035_c1 3300050507 Bacteria 1207
558 nmdc:mga0n895_12861_c1 3300050512 Bacteria 7519
559 nmdc:mga0n895_17096_c1 3300050512 Bacteria 6679
560 nmdc:mga0rr50_31763_c1 3300050513 Bacteria 3755
561 nmdc:mga0rr50_480406_c1 3300050513 Bacteria 1055
562 nmdc:mga0a205_515737_c1 3300050515 Bacteria 1052
563 Ga0495601_0020810 3300053077 Bacteria 4010
564 Ga0495601_0043445 3300053077 Bacteria 2822
565 Ga0495601_0066926 3300053077 Bacteria 2287
566 Ga0495601_0143484 3300053077 Bacteria 1558
567 Ga0495601_0164977 3300053077 Bacteria 1448
568 Ga0495601_0204955 3300053077 Bacteria 1288
569 Ga0495612_0001749 3300053078 Bacteria 8900
570 Ga0495612_0033150 3300053078 Bacteria 2089
571 Ga0495595_0001374 3300053084 Bacteria 9441
572 Ga0495595_0005073 3300053084 Bacteria 5319
573 Ga0495595_0015521 3300053084 Bacteria 3249
574 Ga0495595_0099343 3300053084 Bacteria 1403
575 Ga0495619_0003811 3300053085 Bacteria 9701
576 Ga0495619_0013951 3300053085 Bacteria 5070
577 Ga0495619_0014435 3300053085 Bacteria 4989
578 Ga0495619_0238391 3300053085 Bacteria 1260
579 Ga0495619_0300250 3300053085 Bacteria 1112
580 Ga0500560_000164 3300053107 Bacteria 7591
581 Ga0500614_044826 3300053123 Bacteria 1139
582 Ga0500573_0054027 3300053140 Bacteria 2307
583 8025414652 8025413630 Bacteria 7014048
584 2515851480 2515154155 Bacteria 7985436
585 2804847833 2802429296 Bacteria 7227771
586 3002998943 3002998708 Bacteria 11715108
587 8055069216 8055066027 Bacteria 9479577
588 JGI25404J52841_10022211
589 Ga0070658_10076078
590 Ga0070683_100055222
591 Ga0070683_100113089
592 Ga0070680_100047352
593 Ga0070680_100357548
594 Ga0070691_10233328
595 Ga0070692_10115176
596 Ga0070709_10000169
597 Ga0070709_10001132
598 Ga0070709_10051682
599 Ga0070709_10085902
600 Ga0070714_100000248
601 Ga0070714_100002950
602 Ga0070714_100003100
603 Ga0070714_100016797
604 Ga0070714_100031930
605 Ga0070714_100041171
606 Ga0070714_100086214
607 Ga0070714_100237213
608 Ga0070714_100265667
609 Ga0070713_100004888
610 Ga0070713_100053779
611 Ga0070713_100106985
612 Ga0070713_100148962
613 Ga0070713_100163364
614 Ga0070710_10001626
615 Ga0070710_10008512
616 Ga0070710_10017429
617 Ga0070710_10095897
618 Ga0070710_10109377
619 Ga0070711_100019804
620 Ga0070711_100026762
621 Ga0070711_100229659
622 Ga0070708_100004516
623 Ga0070708_100009003
624 Ga0070708_100010798
625 Ga0070708_100030949
626 Ga0070708_100175435
627 Ga0070708_100179095
628 Ga0070708_100249438
629 Ga0070681_10042209
630 Ga0070681_10382986
631 Ga0070706_100005913
632 Ga0070706_100007912
633 Ga0070706_100008434
634 Ga0070706_100011354
635 Ga0070706_100024777
636 Ga0070706_100207065
637 Ga0070706_100370169
638 Ga0070707_100000524
639 Ga0070707_100026532
640 Ga0070707_100030252
641 Ga0070707_100052037
642 Ga0070707_100138502
643 Ga0070707_100327481
644 Ga0070698_100001175
645 Ga0070698_100003208
646 Ga0070698_100057071
647 Ga0070698_100081309
648 Ga0070698_100091655
649 Ga0070699_100017806
650 Ga0070699_100058095
651 Ga0070699_100267275
652 Ga0070679_100039363
653 Ga0070679_100710109
654 Ga0070684_100059330
655 Ga0070684_100093119
656 Ga0070697_100016531
657 Ga0070697_100203264
658 Ga0070696_100088341
659 Ga0070704_100419187
660 Ga0068855_100277070
661 Ga0070664_100132797
662 Ga0070664_100135180
663 Ga0068857_100009921
664 Ga0068857_100217920
665 Ga0068856_100248210
666 Ga0068864_100021320
667 Ga0068863_100049864
668 Ga0068863_100089235
669 Ga0081540_1000058
670 Ga0081539_10038756
671 Ga0070717_10017491
672 Ga0070717_10056782
673 Ga0070717_10068657
674 Ga0070717_10171930
675 Ga0070715_10067946
676 Ga0070716_100000322
677 Ga0070716_100013661
678 Ga0070716_100018054
679 Ga0070716_100039677
680 Ga0070712_100005009
681 Ga0070712_100124381
682 Ga0070712_100137390
683 Ga0070712_100194361
684 Ga0070712_100367497
685 Ga0075434_100089743
686 Ga0075436_100447264
687 Ga0075435_100003850
688 Ga0075435_100064687
689 Ga0105250_10027254
690 Ga0114129_10019031
691 Ga0114129_10130036
692 Ga0105243_10129055
693 Ga0105248_10010665
694 Ga0157369_10050108
695 Ga0157378_10168282
696 Ga0157372_10863274
697 Ga0163163_10019356
698 Ga0157379_10130752
699 Ga0157376_10015006
700 Ga0206356_10327652
701 Ga0206354_11008789
702 Ga0213875_10000870
703 Ga0213875_10008766
704 Ga0224712_10012697
705 Ga0224712_10148584
706 Ga0224572_1000848
707 Ga0224572_1003225
708 Ga0207692_10001114
709 Ga0207692_10006577
710 Ga0207692_10021898
711 Ga0207692_10056455
712 Ga0207692_10110367
713 Ga0207688_10008057
714 Ga0207685_10001214
715 Ga0207685_10007308
716 Ga0207685_10027659
717 Ga0207685_10035050
718 Ga0207685_10128083
719 Ga0207699_10000201
720 Ga0207699_10001064
721 Ga0207699_10031159
722 Ga0207699_10036494
723 Ga0207699_10037080
724 Ga0207699_10066467
725 Ga0207699_10251592
726 Ga0207705_10106679
727 Ga0207684_10006667
728 Ga0207684_10016082
729 Ga0207684_10044702
730 Ga0207684_10066150
731 Ga0207684_10066188
732 Ga0207684_10067517
733 Ga0207684_10234533
734 Ga0207684_10256030
735 Ga0207654_10318244
736 Ga0207707_10175105
737 Ga0207707_10239383
738 Ga0207693_10020950
739 Ga0207693_10183076
740 Ga0207693_10265232
741 Ga0207693_10382838
742 Ga0207663_10011651
743 Ga0207663_10039599
744 Ga0207646_10000065
745 Ga0207646_10012147
746 Ga0207646_10029326
747 Ga0207646_10039254
748 Ga0207646_10058533
749 Ga0207646_10110000
750 Ga0207646_10128566
751 Ga0207646_10392563
752 Ga0207646_10718433
753 Ga0207700_10000229
754 Ga0207700_10002334
755 Ga0207700_10003787
756 Ga0207700_10055210
757 Ga0207700_10063995
758 Ga0207700_10092031
759 Ga0207700_10322581
760 Ga0207664_10000991
761 Ga0207664_10001429
762 Ga0207664_10003308
763 Ga0207664_10007535
764 Ga0207664_10026474
765 Ga0207664_10037601
766 Ga0207664_10041648
767 Ga0207664_10055236
768 Ga0207664_10067729
769 Ga0207664_10085017
770 Ga0207664_10102988
771 Ga0207664_10153825
772 Ga0207665_10003623
773 Ga0207665_10022924
774 Ga0207665_10024184
775 Ga0207665_10025720
776 Ga0207665_10213710
777 Ga0207665_10228622
778 Ga0207711_10044604
779 Ga0207711_10177434
780 Ga0207661_10031985
781 Ga0207667_10134489
782 Ga0207703_10272313
783 Ga0207702_10126046
784 Ga0207702_10271031
785 Ga0207702_10364799
786 Ga0207641_10177324
787 Ga0207641_10203753
788 Ga0207641_10264471
789 Ga0207676_10052365
790 Ga0207674_10101830
791 Ga0307512_10004906
792 Ga0265316_10382926
793 Ga0307513_10342951
794 Ga0307516_10028339
795 Ga0307406_10080957
796 Ga0307407_10218959
797 Ga0307412_10715768
798 Ga0307416_100045692
799 Ga0307507_10138564
800 Ga0373958_0019851
801 Ga0373938_0008049
802 Ga0373934_0000023
803 Ga0373934_0000154
804 Ga0373934_0021112
805 Ga0373934_0045924
806 Ga0373934_0079020
807 Ga0373940_0014396
808 Ga0373949_0017673
809 Ga0373923_0003399
810 Ga0373923_0004181
811 Ga0373923_0018323
812 Ga0373923_0133214
813 Ga0373936_0001459
814 Ga0373939_0019201
815 Ga0373941_0061518
816 Ga0373945_0009453
817 Ga0373953_0000008
818 Ga0373953_0030223
819 Ga0373953_0040390
820 Ga0373954_0000628
821 Ga0373954_0012902
822 Ga0373954_0013336
823 Ga0373956_0000126
824 Ga0373956_0001007
825 Ga0373956_0004478
826 Ga0373956_0028741
827 Ga0373956_0035682
828 Ga0373957_0000300
829 Ga0373957_0034167
830 Ga0373957_0052340
831 Ga0373946_0076237
832 Ga0373955_0000005
833 Ga0373955_0000074
834 Ga0373955_0009927
835 Ga0373955_0013706
836 Ga0373955_0022467
837 Ga0373942_0043635
838 Ga0373942_0047755
839 Ga0373924_0001962
840 Ga0373924_0019271
841 Ga0373924_0020366
842 Ga0373924_0021438
843 Ga0373924_0049520
844 Ga0373924_0270298
845 Ga0373935_0018404
846 Ga0373935_0034285
847 Ga0373935_0041809
848 Ga0373935_0365459
849 Ga0373927_0043458
850 Ga0373933_0000043
851 Ga0373933_0000050
852 Ga0373933_0000337
853 Ga0373933_0043680
854 Ga0373933_0141053
855 Ga0373947_0096590
856 Ga0373947_0122592
857 Ga0373947_0125117
858 Ga0373947_0176833
859 Ga0373947_0351366
860 Ga0373937_0000245
861 Ga0373937_0000314
862 Ga0373937_0001672
863 Ga0373937_0006134
864 Ga0373937_0219085
865 Ga0373937_1104758
866 Ga0373925_0000338
867 Ga0373925_0000356
868 Ga0373925_0018059
869 Ga0373925_0085318
870 Ga0373925_0110536
871 Ga0373925_0268259
872 Ga0436364_0646689
873 Ga0436364_0658848
874 Ga0436363_0363212
875 Ga0466969_0108825
876 Ga0466966_0049230
877 Ga0466961_0026303
878 Ga0466963_0324905
879 Ga0466959_0069610
880 Ga0466958_0073254
881 Ga0466967_0495796
882 Ga0495592_0000092
883 Ga0495592_0000251
884 Ga0495592_0004954
885 Ga0495592_0010673
886 Ga0495592_0040563
887 Ga0495592_0059115
888 Ga0495603_0074294
889 Ga0495629_0004925
890 Ga0495629_0015538
891 Ga0495629_0025170
892 Ga0495629_0142343
893 Ga0495629_0171132
894 Ga0495629_0320006
895 Ga0495651_0000066
896 Ga0495651_0000194
897 Ga0495651_0006216
898 Ga0495651_0013362
899 Ga0495651_0062829
900 Ga0495651_0079149
901 Ga0495651_0250401
902 Ga0495651_0292197
903 Ga0495653_0004097
904 Ga0495653_0005027
905 Ga0495653_0005849
906 Ga0495653_0014016
907 Ga0495653_0016024
908 Ga0495653_0020637
909 Ga0495653_0037618
910 Ga0495653_0044709
911 Ga0495580_0025329
912 Ga0495580_0194793
913 Ga0495580_0408023
914 Ga0495582_0013316
915 Ga0495582_0014138
916 Ga0495582_0014688
917 Ga0495639_0007314
918 Ga0495639_0037175
919 Ga0495639_0073239
920 Ga0495639_0103509
921 Ga0495662_0000815
922 Ga0495662_0004835
923 Ga0495662_0012577
924 Ga0495662_0015998
925 Ga0495662_0021623
926 Ga0495662_0178026
927 Ga0495662_0196456
928 Ga0495664_0001742
929 Ga0495664_0016190
930 Ga0495664_0022388
931 Ga0495664_0026341
932 Ga0495664_0108067
933 Ga0495664_0130992
934 Ga0495608_0000070
935 Ga0495608_0000172
936 Ga0495608_0006176
937 Ga0495608_0047887
938 Ga0495608_0054814
939 Ga0495618_0006205
940 Ga0495618_0017789
941 Ga0495618_0023687
942 Ga0495618_0029451
943 Ga0495618_0046304
944 Ga0495618_0078317
945 Ga0495618_0139584
946 Ga0495628_0002286
947 Ga0495628_0003161
948 Ga0495628_0009644
949 Ga0495628_0027304
950 Ga0495628_0027968
951 Ga0495628_0077657
952 Ga0495630_0094141
953 Ga0495630_0142933
954 Ga0495630_0180740
955 Ga0495630_0187378
956 Ga0495630_0201896
957 Ga0495666_0012825
958 Ga0495652_0000232
959 Ga0495652_0001412
960 Ga0495652_0001678
961 Ga0495652_0004890
962 Ga0495652_0022659
963 Ga0495652_0073706
964 Ga0495652_0095564
965 Ga0495652_0105690
966 Ga0495652_0132401
967 Ga0495652_0147573
968 Ga0495652_0166431
969 Ga0495652_0274199
970 Ga0495665_0004965
971 Ga0495665_0007717
972 Ga0495665_0011035
973 Ga0495665_0024583
974 Ga0495665_0059916
975 Ga0495640_0003431
976 Ga0495640_0004263
977 Ga0495640_0005105
978 Ga0495640_0018371
979 Ga0495640_0058649
980 Ga0495640_0185254
981 Ga0495586_0027343
982 Ga0495586_0027932
983 Ga0495586_0052799
984 Ga0495587_0000077
985 Ga0495587_0000148
986 Ga0495587_0003079
987 Ga0495587_0006336
988 Ga0495587_0014996
989 Ga0495587_0027708
990 Ga0495587_0064313
991 Ga0495645_0003078
992 Ga0495645_0003719
993 Ga0495645_0028779
994 Ga0495645_0093284
995 Ga0495645_0131392
996 Ga0495645_0199289
997 Ga0495645_0227680
998 Ga0495667_0000071
999 Ga0495667_0000196
1000 Ga0495667_0003378
1001 Ga0495667_0013506
1002 Ga0495667_0027045
1003 Ga0495667_0066187
1004 Ga0495667_0076913
1005 Ga0495667_0276892
1006 Ga0495634_0007289
1007 Ga0495634_0017638
1008 Ga0495634_0039899
1009 Ga0495634_0094725
1010 Ga0495634_0096460
1011 Ga0495634_0105181
1012 Ga0495635_0023771
1013 Ga0495635_0045999
1014 Ga0495635_0046149
1015 Ga0495635_0063531
1016 Ga0495657_0000095
1017 Ga0495657_0000287
1018 Ga0495657_0030088
1019 Ga0495657_0056349
1020 Ga0495657_0060319
1021 Ga0495657_0096347
1022 Ga0495599_0000145
1023 Ga0495599_0008828
1024 Ga0495599_0010868
1025 Ga0495599_0016158
1026 Ga0495599_0120183
1027 Ga0495623_0000117
1028 Ga0495623_0002521
1029 Ga0495623_0010376
1030 Ga0495623_0041666
1031 Ga0495623_0095557
1032 Ga0495623_0185747
1033 Ga0495646_0006841
1034 Ga0495646_0026270
1035 Ga0495646_0044367
1036 Ga0495646_0079947
1037 Ga0495647_0064231
1038 Ga0495658_0046836
1039 Ga0495658_0070550
1040 Ga0495658_0119698
1041 Ga0495613_0018087
1042 Ga0495613_0024004
1043 Ga0495613_0518997
1044 Ga0495624_0041463
1045 Ga0495624_0049416
1046 Ga0495624_0070702
1047 Ga0495624_0087328
1048 Ga0495600_0035912
1049 Ga0495600_0057232
1050 Ga0495600_0071427
1051 Ga0495600_0082247
1052 Ga0495600_0088054
1053 Ga0495581_0004048
1054 Ga0495581_0009258
1055 Ga0495581_0014868
1056 Ga0495581_0025586
1057 Ga0495581_0069824
1058 Ga0495581_0100533
1059 Ga0495581_0101066
1060 Ga0495604_0000087
1061 Ga0495604_0000362
1062 Ga0495604_0002625
1063 Ga0495604_0009434
1064 Ga0495604_0060625
1065 Ga0495604_0296876
1066 Ga0495674_0021474
1067 Ga0495674_0030238
1068 Ga0495674_0062638
1069 Ga0495674_0065891
1070 Ga0495674_0073360
1071 Ga0495674_0109683
1072 Ga0495674_0121164
1073 Ga0495674_0150826
1074 Ga0495676_0118295
1075 Ga0495676_0198245
1076 Ga0495676_0307175
1077 Ga0495676_0312199
1078 Ga0495680_0000225
1079 Ga0495680_0000586
1080 Ga0495680_0004355
1081 Ga0495680_0005836
1082 Ga0495680_0007634
1083 Ga0495680_0055501
1084 Ga0495680_0126534
1085 Ga0495675_0000157
1086 Ga0495675_0018764
1087 Ga0495675_0029895
1088 Ga0495675_0036640
1089 Ga0495675_0065939
1090 Ga0495684_0009953
1091 Ga0495684_0030546
1092 Ga0495684_0050811
1093 Ga0495684_0080618
1094 Ga0495593_0009108
1095 Ga0495593_0009666
1096 Ga0495593_0023929
1097 Ga0495593_0065359
1098 Ga0495593_0106588
1099 Ga0495602_0000287
1100 Ga0495602_0000419
1101 Ga0495602_0018684
1102 Ga0495602_0042451
1103 Ga0495602_0149167
1104 Ga0495602_0216653
1105 Ga0495602_0245660
1106 Ga0495614_0007332
1107 Ga0495614_0019769
1108 Ga0496100_0237376
1109 Ga0496101_0071972
1110 Ga0496101_0075556
1111 Ga0496102_0085443
1112 Ga0496102_0268602
1113 Ga0496104_0039926
1114 Ga0496104_0052935
1115 Ga0496104_0322963
1116 Ga0496105_0005863
1117 Ga0496105_0364880
1118 Ga0496106_0017125
1119 Ga0496107_0317976
1120 Ga0496108_0011873
1121 Ga0496108_0109543
1122 Ga0496109_0002366
1123 Ga0496109_0162253
1124 Ga0496110_0008049
1125 Ga0496111_0018945
1126 Ga0496112_0070730
1127 Ga0496112_0229818
1128 Ga0496113_0131363
1129 Ga0496113_0238930
1130 Ga0496113_0340653
1131 Ga0496113_0385905
1132 Ga0496114_0034974
1133 Ga0496114_0139845
1134 Ga0496115_0043833
1135 Ga0496115_0132875
1136 Ga0496115_0200975
1137 Ga0496126_0099643
1138 Ga0496126_0106988
1139 Ga0496126_0116107
1140 Ga0501035_0013666
1141 Ga0501044_0380227
1142 nmdc:mga05p37_111846_c1
1143 nmdc:mga05p37_1542_c1
1144 nmdc:mga05p37_628035_c1
1145 nmdc:mga0n895_12861_c1
1146 nmdc:mga0n895_17096_c1
1147 nmdc:mga0rr50_31763_c1
1148 nmdc:mga0rr50_480406_c1
1149 nmdc:mga0a205_515737_c1
1150 Ga0495601_0020810
1151 Ga0495601_0043445
1152 Ga0495601_0066926
1153 Ga0495601_0143484
1154 Ga0495601_0164977
1155 Ga0495601_0204955
1156 Ga0495612_0001749
1157 Ga0495612_0033150
1158 Ga0495595_0001374
1159 Ga0495595_0005073
1160 Ga0495595_0015521
1161 Ga0495595_0099343
1162 Ga0495619_0003811
1163 Ga0495619_0013951
1164 Ga0495619_0014435
1165 Ga0495619_0238391
1166 Ga0495619_0300250
1167 Ga0500560_000164
1168 Ga0500614_044826
1169 Ga0500573_0054027
1170 8025414652
1171 2515851480
1172 2804847833
1173 3002998943
1174 8055069216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

162

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.8996 2 221
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.892 3 222
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.8884 1 219
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.8846 2 221
8bms-assembly1.cif.gz_B cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation 0.8838 3 221
ID Description Score Start End Superfamily
af_A0A1D6H744_679_834_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9145 118 222 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9098 2 215 3.40.50.300
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9035 2 222 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8981 3 210 3.40.50.300
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8955 1 206 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A534WQU7-F1-model_v4 ABC transporter ATP-binding protein 0.9339 72 222 GO:0005524
GO:0016887
AF-A0A7Y4SRE5-F1-model_v4 ABC transporter ATP-binding protein 0.9267 2 220 GO:0005524
GO:0016887
AF-A0A2G6CMC3-F1-model_v4 ABC transporter domain-containing protein 0.9265 2 221 GO:0005524
GO:0016887
AF-A0A7C4CS79-F1-model_v4 ABC transporter ATP-binding protein 0.9217 2 222 GO:0005524
GO:0016887
AF-A0A2S3QJB3-F1-model_v4 ABC transporter domain-containing protein 0.9207 3 225 GO:0005524
GO:0016887

Map