F466511

General Info

Members Datasets Scaffolds Average Seq Length
585 509 235 206

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306090|2551724069
Length 184
Sequence SLIETLRYEPEHGFTRLRLHLARLTRSARRLGFTGGASRFGRAGAAARAPHARPRRQHRRDDGTIRAACRRRGHDRLLRMKTTRRSRYEAARSEFSAAEADEVILLNEKGEVCEGTITSVFLDDGSGYLKTPPIACGLLAGVLRTELICQRRARVERLAPADLASGRLYIGNSLRGLIRAELTV

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
16 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
17 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
20 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
24 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
25 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
26 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
27 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
28 2516143018 Ensifer sp. BR816 Isolate Nodule
29 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
30 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
31 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
32 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
33 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
34 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
35 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
36 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
37 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
38 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
39 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
40 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
41 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
42 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
43 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
44 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
45 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
46 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
47 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
48 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
49 2643221557 Ensifer sp. Root558 Isolate Unclassified
50 2643221599 Rhizobium sp. Root708 Isolate Unclassified
51 2643221610 Ensifer sp. Root74 Isolate Unclassified
52 2643221618 Ensifer sp. Root231 Isolate Unclassified
53 2643221626 Ensifer sp. Root31 Isolate Unclassified
54 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
55 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
56 2643221655 Ensifer sp. Root1252 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221698 Ensifer sp. Root142 Isolate Unclassified
61 2643221712 Ensifer sp. Root258 Isolate Unclassified
62 2643221723 Ensifer sp. Root278 Isolate Unclassified
63 2643221726 Ensifer sp. Root954 Isolate Unclassified
64 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
65 2718217927 Rhizobium sp. N324 Isolate Nodule
66 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
67 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
68 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
69 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
70 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
71 2718218423 Rhizobium sp. N941 Isolate Nodule
72 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
73 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
74 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
75 2721755809 Rhizobium sp. N541 Isolate Nodule
76 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
77 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
78 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
79 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
80 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
81 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
82 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
83 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
84 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
85 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
86 2791355256 Rhizobium sp. M10 Isolate Nodule
87 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
88 2791355260 Rhizobium sp. L9 Isolate Nodule
89 2791355261 Rhizobium sp. J15 Isolate Nodule
90 2791355262 Rhizobium sp. M1 Isolate Nodule
91 2791355265 Rhizobium sp. H4 Isolate Nodule
92 2791355267 Rhizobium sp. L18 Isolate Nodule
93 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
94 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
95 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
96 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
97 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
98 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
99 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
100 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
101 2838048938 Rhizobium pisi 27/80 Isolate Nodule
102 2838061910 Rhizobium phaseoli L15 Isolate Nodule
103 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
104 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
105 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
106 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
107 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
108 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
109 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
110 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
111 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
112 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
113 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
114 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
115 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
116 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
117 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
118 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
119 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
120 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
121 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
122 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
123 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
124 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
125 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
126 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
127 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
128 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
129 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
130 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
131 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
132 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
133 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
134 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
135 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
136 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
137 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
138 2844163670 Ensifer sp. 1H6 Isolate Unclassified
139 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
140 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
141 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
142 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
143 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
144 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
145 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
146 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
147 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
148 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
149 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
150 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
151 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
152 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
153 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
154 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
155 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
156 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
157 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
158 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
159 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
160 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
161 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
162 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
163 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
164 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
165 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
166 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
167 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
168 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
169 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
170 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
171 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
172 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
173 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
174 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
175 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
176 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
177 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
178 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
179 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
180 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
181 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
182 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
183 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
184 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
185 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
186 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
187 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
188 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
189 2933599457 Rhizobium phaseoli M3 Isolate Nodule
190 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
191 2936381700 Rhizobium chutanense C16 Isolate Unclassified
192 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
193 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
194 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
195 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
196 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
197 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
198 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
199 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
200 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
201 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
202 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
203 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
204 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
205 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
206 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
207 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
208 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
209 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
210 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
211 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
212 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
213 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
214 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
215 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
216 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
217 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
218 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
219 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
220 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
221 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
222 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
223 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
224 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
225 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
226 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
227 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
228 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
229 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
230 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
231 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
232 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
233 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
234 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
235 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
236 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
237 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
238 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
239 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
240 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
241 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
242 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
243 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
244 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
245 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
246 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
247 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
248 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
249 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
250 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
251 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
252 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
253 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
254 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
255 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
256 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
257 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
258 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
259 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
260 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
261 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
262 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
263 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
264 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
265 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
266 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
267 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
268 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
269 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
270 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
271 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
272 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
273 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
274 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
275 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
276 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
277 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
278 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
279 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
280 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
281 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
282 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
283 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
284 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
285 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
286 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
287 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
288 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
289 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
290 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
291 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
292 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
293 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
294 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
295 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
296 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
297 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
298 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
299 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
300 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
301 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
302 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
303 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
304 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
305 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
306 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
307 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
308 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
309 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
310 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
311 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
312 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
313 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
314 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
315 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
316 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
317 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
318 2996887358 Rhizobium sp. R711 Isolate Nodule
319 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
320 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
321 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
322 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
323 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
324 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
325 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
326 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
327 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
328 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
329 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
330 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
331 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
332 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
333 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
334 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
335 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
336 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
337 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
338 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
339 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
340 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
341 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
342 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
343 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
344 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
345 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
346 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
347 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
348 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
349 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
350 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
351 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
352 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
353 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
354 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
356 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
358 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
359 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
360 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
362 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
363 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
370 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
373 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
374 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
375 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
376 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
377 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
378 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
379 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
380 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
381 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
382 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
383 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
384 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
385 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
386 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
387 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
388 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
389 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
390 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
391 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
392 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
393 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
394 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
395 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
396 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
397 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
398 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
401 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
402 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
403 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
404 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
405 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
406 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
407 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
408 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
409 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
410 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
411 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
412 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
413 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
414 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
415 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
416 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
417 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
418 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
419 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
420 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
421 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
422 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
423 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
424 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
425 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
426 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
427 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
428 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
429 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
430 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
431 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
432 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
433 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
434 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
435 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
436 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
437 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
438 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
444 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
445 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
446 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
447 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
448 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
449 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
450 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
451 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
452 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
453 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
454 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
458 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
459 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
460 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
461 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
466 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
467 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
470 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
471 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
472 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
473 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
474 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
475 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
478 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
479 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
480 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
481 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
482 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
483 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
484 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
485 8005258706 Rhizobium sp. R693 Isolate Nodule
486 8005275841 Rhizobium sp. N4311 Isolate Nodule
487 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
488 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
489 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
490 8005321885 Rhizobium sp. R72 Isolate Nodule
491 8005382845 Rhizobium sp. R634 Isolate Nodule
492 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
493 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
494 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
495 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
496 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
497 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
498 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
499 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
500 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
501 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
502 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
503 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
504 8018176218 Rhizobium sp. N122 Isolate Nodule
505 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
506 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
507 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
508 8056382006 Rhizobium croatiense 13T Isolate Nodule
509 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.17
Metatranscriptomes 0
Isolates 59.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.04
Nodule 52.99
Rhizoplane 3.59
Rhizosphere 16.24
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000249 3300002739 Bacteria 12392
2 JGI25152J39213_1001857 3300002773 Bacteria 8511
3 JGI25159J45721_1000470 3300002987 Bacteria 18595
4 JGI25151J46595_10042987 3300003187 Bacteria 1622
5 JGI25151J46595_10062140 3300003187 Bacteria 1184
6 JGI25153J46596_10027357 3300003215 Bacteria 1999
7 JGI25153J46596_10031037 3300003215 Bacteria 1806
8 rootH2_10120646 3300003320 Bacteria 1248
9 rootL2_10265622 3300003322 Bacteria 1762
10 JGI25160J50197_1000009 3300003354 Bacteria 282862
11 JGI25160J50197_1015112 3300003354 Bacteria 2548
12 JGI25161J50226_1000114 3300003374 Bacteria 62957
13 JGI25161J50226_1000913 3300003374 Bacteria 10639
14 Ga0055526_1002079 3300003771 Bacteria 13754
15 Ga0055526_1002838 3300003771 Bacteria 11450
16 Ga0055526_1038357 3300003771 Bacteria 1236
17 Ga0055524_1001626 3300003775 Bacteria 12537
18 Ga0055524_1017010 3300003775 Bacteria 2580
19 Ga0055524_1023307 3300003775 Bacteria 1997
20 Ga0055524_1026983 3300003775 Bacteria 1757
21 Ga0055536_1018709 3300003781 Bacteria 2209
22 Ga0055528_1004527 3300003790 Bacteria 6669
23 Ga0055528_1008089 3300003790 Bacteria 4561
24 Ga0055528_1011334 3300003790 Bacteria 3550
25 Ga0055530_10038403 3300003791 Bacteria 1191
26 Ga0055540_1004365 3300003792 Bacteria 6411
27 Ga0055543_1000077 3300004625 Bacteria 86457
28 Ga0055543_1000379 3300004625 Bacteria 29065
29 Ga0065165_1000020 3300005262 Bacteria 265570
30 Ga0070668_100028026 3300005347 Bacteria 4275
31 Ga0070669_100042173 3300005353 Bacteria 3320
32 Ga0070671_100006261 3300005355 Bacteria 9481
33 Ga0070663_100150836 3300005455 Bacteria 1782
34 Ga0075365_10000625 3300006038 Bacteria 13949
35 Ga0075363_100161064 3300006048 Bacteria 1271
36 Ga0075367_10066847 3300006178 Bacteria 2155
37 Ga0075367_10283491 3300006178 Bacteria 1041
38 Ga0075369_10002578 3300006186 Bacteria 6481
39 Ga0075369_10024760 3300006186 Bacteria 2490
40 Ga0075370_10172032 3300006353 Bacteria 1273
41 Ga0099826_10167099 3300006948 Bacteria 1239
42 Ga0105251_10007523 3300009011 Bacteria 6698
43 Ga0105249_10306686 3300009553 Bacteria 1594
44 Ga0228711_1000003 3300022739 Bacteria 258118
45 Ga0228710_1000003 3300022740 Bacteria 262981
46 Ga0209436_100050 3300025208 Bacteria 65942
47 Ga0209436_101900 3300025208 Bacteria 6739
48 Ga0209129_1002207 3300025258 Bacteria 9786
49 Ga0209129_1004928 3300025258 Bacteria 4969
50 Ga0209129_1005630 3300025258 Bacteria 4350
51 Ga0209129_1024234 3300025258 Bacteria 1071
52 Ga0209673_1003294 3300025273 Bacteria 9701
53 Ga0209673_1007964 3300025273 Bacteria 4782
54 Ga0209673_1009471 3300025273 Bacteria 4213
55 Ga0209130_1000030 3300025284 Bacteria 323323
56 Ga0209130_1000037 3300025284 Bacteria 284019
57 Ga0209130_1015104 3300025284 Bacteria 1914
58 Ga0209676_1000239 3300025292 Bacteria 117696
59 Ga0209025_1000196 3300025294 Bacteria 147356
60 Ga0209025_1007724 3300025294 Bacteria 7932
61 Ga0209025_1014510 3300025294 Bacteria 4836
62 Ga0209025_1029461 3300025294 Bacteria 2653
63 Ga0209025_1110162 3300025294 Bacteria 848
64 Ga0209564_1000086 3300025295 Bacteria 251385
65 Ga0209564_1009273 3300025295 Bacteria 4712
66 Ga0209564_1012931 3300025295 Bacteria 3593
67 Ga0209564_1047460 3300025295 Bacteria 1081
68 Ga0209758_1001342 3300025297 Bacteria 29705
69 Ga0209758_1001459 3300025297 Bacteria 27768
70 Ga0209758_1014895 3300025297 Bacteria 4083
71 Ga0209050_1012635 3300025298 Bacteria 3848
72 Ga0209050_1071938 3300025298 Bacteria 768
73 Ga0209256_1000276 3300025299 Bacteria 89888
74 Ga0209256_1002346 3300025299 Bacteria 15767
75 Ga0209256_1004844 3300025299 Bacteria 8141
76 Ga0209256_1007800 3300025299 Bacteria 5152
77 Ga0209256_1008128 3300025299 Bacteria 4941
78 Ga0209256_1050236 3300025299 Bacteria 1012
79 Ga0207426_1000047 3300025302 Bacteria 417011
80 Ga0207426_1000048 3300025302 Bacteria 409127
81 Ga0207426_1000984 3300025302 Bacteria 27966
82 Ga0209051_1000874 3300025303 Bacteria 30458
83 Ga0209051_1008583 3300025303 Bacteria 5390
84 Ga0209051_1011076 3300025303 Bacteria 4486
85 Ga0209051_1013994 3300025303 Bacteria 3774
86 Ga0209257_1001192 3300025304 Bacteria 32713
87 Ga0209257_1005971 3300025304 Bacteria 8165
88 Ga0207713_1047324 3300025735 Bacteria 1741
89 Ga0207644_10338252 3300025931 Bacteria 1220
90 Ga0207712_10215014 3300025961 Bacteria 1533
91 Ga0207668_10041332 3300025972 Bacteria 3116
92 Ga0209281_1000081 3300027111 Bacteria 258084
93 Ga0209281_1000269 3300027111 Bacteria 100505
94 Ga0209282_1000040 3300027666 Bacteria 127969
95 Ga0268266_10050241 3300028379 Bacteria 3578
96 Ga0307413_10480652 3300031824 Bacteria 993
97 Ga0315914_1000002 3300031967 Bacteria 365357
98 Ga0315913_1000016 3300033430 Bacteria 113410
99 Ga0315915_1000005 3300033464 Bacteria 397591
100 Ga0439436_0013781 3300041404 Bacteria 2445
101 Ga0439439_0074617 3300041406 Bacteria 911
102 Ga0439465_0038579 3300041413 Bacteria 1539
103 Ga0439465_0195461 3300041413 Bacteria 735
104 Ga0451787_108328 3300041441 Bacteria 1938
105 Ga0451793_1249231 3300041452 Bacteria 1977
106 Ga0451795_0450740 3300041456 Bacteria 2304
107 Ga0451798_0128064 3300041458 Bacteria 1733
108 Ga0451804_0996814 3300041463 Bacteria 1173
109 Ga0451833_0943957 3300041491 Bacteria 1738
110 Ga0451835_0046067 3300041492 Bacteria 3445
111 Ga0451837_0528640 3300041494 Bacteria 983
112 Ga0451837_0531546 3300041494 Bacteria 1634
113 Ga0451839_0378789 3300041496 Bacteria 2992
114 Ga0451841_1372321 3300041498 Bacteria 1023
115 Ga0451845_0691553 3300041501 Bacteria 3560
116 Ga0451847_0787006 3300041503 Bacteria 5398
117 Ga0451849_0339959 3300041505 Bacteria 2297
118 Ga0451849_0360680 3300041505 Bacteria 2147
119 Ga0451851_0889251 3300041507 Bacteria 2157
120 Ga0451843_0588359 3300041509 Bacteria 1080
121 Ga0451855_0465113 3300041511 Bacteria 3656
122 Ga0451853_1787960 3300041512 Bacteria 2720
123 Ga0439449_0009512 3300042007 Bacteria 3683
124 Ga0439449_0071369 3300042007 Bacteria 1279
125 Ga0439462_0021448 3300042015 Bacteria 1688
126 Ga0439462_0092693 3300042015 Bacteria 830
127 Ga0495590_0054786 3300046457 Bacteria 1393
128 Ga0495590_0097425 3300046457 Bacteria 1044
129 Ga0495638_0084568 3300046460 Bacteria 1920
130 Ga0495651_0186078 3300046462 Bacteria 1465
131 Ga0495650_0040659 3300046471 Bacteria 1994
132 Ga0495650_0058521 3300046471 Bacteria 1555
133 Ga0495605_0135514 3300046474 Bacteria 1108
134 Ga0495662_0003065 3300046476 Bacteria 8427
135 Ga0495585_0018134 3300046492 Bacteria 4062
136 Ga0495585_0094153 3300046492 Bacteria 1610
137 Ga0495596_0060775 3300046500 Bacteria 1472
138 Ga0495607_0153199 3300046501 Bacteria 1178
139 Ga0495607_0242293 3300046501 Bacteria 872
140 Ga0495583_0001777 3300046506 Bacteria 20545
141 Ga0495606_0351813 3300046507 Bacteria 782
142 Ga0495606_0375579 3300046507 Bacteria 747
143 Ga0495610_0010166 3300046512 Bacteria 5871
144 Ga0495610_0049840 3300046512 Bacteria 2047
145 Ga0495610_0096274 3300046512 Bacteria 1333
146 Ga0495610_0127528 3300046512 Bacteria 1108
147 Ga0495616_0043443 3300046513 Bacteria 2283
148 Ga0495616_0082893 3300046513 Bacteria 1531
149 Ga0495620_0020624 3300046515 Bacteria 3217
150 Ga0495620_0023060 3300046515 Bacteria 2984
151 Ga0495620_0057355 3300046515 Bacteria 1635
152 Ga0495620_0145447 3300046515 Bacteria 926
153 Ga0495631_0144826 3300046518 Bacteria 1020
154 Ga0495632_0037703 3300046519 Bacteria 2451
155 Ga0495632_0155815 3300046519 Bacteria 1054
156 Ga0495643_0029251 3300046522 Bacteria 3083
157 Ga0495643_0128100 3300046522 Bacteria 1276
158 Ga0495648_0060843 3300046524 Bacteria 2245
159 Ga0495663_0181156 3300046525 Bacteria 730
160 Ga0495587_0034258 3300046536 Bacteria 3063
161 Ga0495597_0030255 3300046542 Bacteria 2468
162 Ga0495633_0016839 3300046558 Bacteria 3753
163 Ga0495633_0057854 3300046558 Bacteria 1820
164 Ga0495656_0014119 3300046615 Bacteria 2988
165 Ga0495668_0159079 3300046616 Bacteria 1237
166 Ga0495634_0153240 3300046642 Bacteria 1456
167 Ga0495625_0093591 3300046660 Bacteria 2074
168 Ga0495635_0249717 3300046663 Bacteria 1196
169 Ga0495661_0064751 3300046665 Bacteria 2156
170 Ga0495588_0063913 3300046674 Bacteria 1909
171 Ga0495670_0114701 3300046691 Bacteria 1396
172 Ga0495671_0130021 3300046692 Bacteria 1228
173 Ga0495649_0030423 3300046694 Bacteria 2982
174 Ga0495660_0194465 3300046810 Bacteria 972
175 Ga0495604_0021754 3300047317 Bacteria 5120
176 Ga0495636_0013155 3300047318 Bacteria 3283
177 Ga0495674_0399308 3300047319 Bacteria 1110
178 Ga0495687_063927 3300047443 Bacteria 1505
179 Ga0495673_0019458 3300047469 Bacteria 3401
180 Ga0495681_0101382 3300047470 Bacteria 1258
181 Ga0495686_0012528 3300047472 Bacteria 5929
182 Ga0495686_0039993 3300047472 Bacteria 2993
183 Ga0495686_0101807 3300047472 Bacteria 1731
184 Ga0495615_0012953 3300048090 Bacteria 1732
185 Ga0496100_0238202 3300048903 Bacteria 1342
186 Ga0496101_0512856 3300048904 Bacteria 947
187 Ga0496102_0085384 3300048905 Bacteria 2914
188 Ga0496103_0229775 3300048906 Bacteria 1193
189 Ga0496104_0046823 3300048907 Bacteria 4074
190 Ga0496105_0046290 3300048908 Bacteria 3590
191 Ga0496106_0012003 3300048909 Bacteria 6394
192 Ga0496108_0726220 3300048911 Bacteria 860
193 Ga0496109_0419415 3300048912 Bacteria 1264
194 Ga0496110_0387585 3300048913 Bacteria 1273
195 Ga0496110_0540641 3300048913 Bacteria 1059
196 Ga0496111_0383373 3300048914 Bacteria 1039
197 Ga0496112_0355135 3300048915 Bacteria 1408
198 Ga0496114_0182308 3300048917 Bacteria 1834
199 Ga0496114_0366749 3300048917 Bacteria 1274
200 Ga0496116_0020895 3300048919 Bacteria 4954
201 Ga0496116_0028699 3300048919 Bacteria 4025
202 Ga0496117_0187567 3300048920 Bacteria 1182
203 Ga0496118_0025577 3300048921 Bacteria 5055
204 Ga0496118_0174705 3300048921 Bacteria 1307
205 Ga0496119_0011371 3300048922 Bacteria 7382
206 Ga0496121_0021259 3300048924 Bacteria 6367
207 Ga0496121_0273286 3300048924 Bacteria 1160
208 Ga0496121_0483969 3300048924 Bacteria 790
209 Ga0496122_0033828 3300048925 Bacteria 4196
210 Ga0496122_0046622 3300048925 Bacteria 3354
211 Ga0496124_0032086 3300048927 Bacteria 4644
212 Ga0496124_0036431 3300048927 Bacteria 4291
213 Ga0496124_0274225 3300048927 Bacteria 1233
214 Ga0496126_0136251 3300048929 Bacteria 2118
215 Ga0495678_056243 3300049459 Bacteria 1497
216 Ga0501032_0242286 3300049569 Bacteria 1171
217 Ga0501036_0116364 3300049572 Bacteria 2258
218 Ga0501038_0076815 3300049574 Bacteria 2821
219 Ga0501039_0195066 3300049575 Bacteria 1592
220 Ga0501073_0215465 3300049589 Bacteria 1327
221 Ga0501080_0301944 3300049742 Bacteria 1452
222 Ga0501083_0181934 3300049744 Bacteria 1372
223 Ga0501035_0619570 3300049822 Bacteria 880
224 nmdc:mga03n38_243955_c1 3300050490 Bacteria 946
225 nmdc:mga03n38_53691_c1 3300050490 Bacteria 1808
226 nmdc:mga07m45_192541_c1 3300050496 Bacteria 1186
227 nmdc:mga0sz30_210516_c1 3300050516 Bacteria 864
228 Ga0500651_0259533 3300053093 Bacteria 1008
229 Ga0500658_0000067 3300053134 Bacteria 48662
230 Ga0500568_0027939 3300053139 Bacteria 2356
231 Ga0500616_0024713 3300053153 Bacteria 3335
232 Ga0500622_0007156 3300053156 Bacteria 6363
233 Ga0500627_0122445 3300053158 Bacteria 1174
234 Ga0500633_0001334 3300053160 Bacteria 4580
235 Ga0500645_053412 3300053730 Bacteria 1176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0013781 Ga0439436_0013781_53_598 181
2 3300042015 Ga0439462_0092693 Ga0439462_0092693_264_809 181
3 iso_pu_bacteria 2551306090 2551724069 182
4 iso_pu_bacteria 2937049772 2937052394 186
5 iso_pu_bacteria 2964712639 2964713333 187
6 iso_pu_bacteria 2964670856 2964675036 189
7 3300003775 Ga0055524_1001626 Ga0055524_10016265 198
8 3300025294 Ga0209025_1110162 Ga0209025_11101622 198
9 3300025299 Ga0209256_1000276 Ga0209256_10002767 198
10 3300046512 Ga0495610_0096274 Ga0495610_0096274_115_741 201
11 iso_pu_bacteria 2510065057 2510303635 204
12 iso_pu_bacteria 2512875026 2512973979 204
13 iso_pu_bacteria 2513237086 2513585269 204
14 iso_pu_bacteria 2513237088 2513597119 204
15 iso_pu_bacteria 2513237089 2513602303 204
16 iso_pu_bacteria 2513237091 2513620105 204
17 iso_pu_bacteria 2513237138 2513870855 204
18 iso_pu_bacteria 2513237140 2513885854 204
19 iso_pu_bacteria 2513237143 2513902870 204
20 iso_pu_bacteria 2513237144 2513908244 204
21 iso_pu_bacteria 2513237156 2513985966 204
22 iso_pu_bacteria 2513237160 2514003946 204
23 iso_pu_bacteria 2515154107 2515610397 204
24 iso_pu_bacteria 2516143018 2516205187 204
25 iso_pu_bacteria 2516653046 2516894347 204
26 iso_pu_bacteria 2517487022 2517570957 204
27 iso_pu_bacteria 2524023207 2524451814 204
28 iso_pu_bacteria 2534681796 2535519499 204
29 iso_pu_bacteria 2551306084 2551676481 204
30 iso_pu_bacteria 2551306085 2551685994 204
31 iso_pu_bacteria 2582581294 2585202530 204
32 iso_pu_bacteria 2582581299 2585227752 204
33 iso_pu_bacteria 2582581304 2585257752 204
34 iso_pu_bacteria 2582581867 2585402159 204
35 iso_pu_bacteria 2585427590 2585822541 204
36 iso_pu_bacteria 2599185352 2600194596 204
37 iso_pu_bacteria 2643221557 2643804126 204
38 iso_pu_bacteria 2643221599 2644006344 204
39 iso_pu_bacteria 2643221610 2644064926 204
40 iso_pu_bacteria 2643221618 2644108531 204
41 iso_pu_bacteria 2643221626 2644145577 204
42 iso_pu_bacteria 2643221634 2644195822 204
43 iso_pu_bacteria 2643221643 2644241805 204
44 iso_pu_bacteria 2643221655 2644312346 204
45 iso_pu_bacteria 2643221668 2644376132 204
46 iso_pu_bacteria 2643221675 2644416599 204
47 iso_pu_bacteria 2643221680 2644449639 204
48 iso_pu_bacteria 2643221698 2644546831 204
49 iso_pu_bacteria 2643221712 2644618029 204
50 iso_pu_bacteria 2643221723 2644676794 204
51 iso_pu_bacteria 2643221726 2644688214 204
52 iso_pu_bacteria 2690316117 2692314555 204
53 iso_pu_bacteria 2751185821 2753458661 204
54 iso_pu_bacteria 2791355091 2792622949 204
55 iso_pu_bacteria 2791355092 2792629203 204
56 iso_pu_bacteria 2791355094 2792640445 204
57 iso_pu_bacteria 2802428858 2802717953 204
58 iso_pu_bacteria 2802428859 2802725196 204
59 iso_pu_bacteria 2802428860 2802730680 204
60 iso_pu_bacteria 2802428861 2802738027 204
61 iso_pu_bacteria 2802428862 2802744103 204
62 iso_pu_bacteria 2802428863 2802750982 204
63 iso_pu_bacteria 2802429268 2804753280 204
64 iso_pu_bacteria 2838074704 2838077388 204
65 iso_pu_bacteria 2844163670 2844169198 204
66 iso_pu_bacteria 2847417321 2847420393 204
67 iso_pu_bacteria 2848992105 2848995199 204
68 iso_pu_bacteria 2855825444 2855826982 204
69 iso_pu_bacteria 2855839649 2855842378 204
70 iso_pu_bacteria 2855872281 2855878480 204
71 iso_pu_bacteria 2858800743 2858803194 204
72 iso_pu_bacteria 2896384573 2896386401 204
73 iso_pu_bacteria 2915980308 2915980503 204
74 iso_pu_bacteria 2915986958 2915987423 204
75 iso_pu_bacteria 2915993759 2915996701 204
76 iso_pu_bacteria 2916000859 2916005111 204
77 iso_pu_bacteria 2916007675 2916014094 204
78 iso_pu_bacteria 2916014648 2916016967 204
79 iso_pu_bacteria 2916021584 2916026429 204
80 iso_pu_bacteria 2916028427 2916029261 204
81 iso_pu_bacteria 2916035215 2916038363 204
82 iso_pu_bacteria 2916041962 2916044879 204
83 iso_pu_bacteria 2916048683 2916049233 204
84 iso_pu_bacteria 2916055098 2916058198 204
85 iso_pu_bacteria 2916061851 2916067081 204
86 iso_pu_bacteria 2916076590 2916080366 204
87 iso_pu_bacteria 2920760137 2920760823 204
88 iso_pu_bacteria 2921201388 2921202249 204
89 iso_pu_bacteria 2921208531 2921213335 204
90 iso_pu_bacteria 2921237296 2921242336 204
91 iso_pu_bacteria 2921244191 2921247760 204
92 iso_pu_bacteria 2921250672 2921255337 204
93 iso_pu_bacteria 2921257292 2921260140 204
94 iso_pu_bacteria 2921263974 2921266135 204
95 iso_pu_bacteria 2921289301 2921294713 204
96 iso_pu_bacteria 2921296804 2921298723 204
97 iso_pu_bacteria 2923556063 2923558804 204
98 iso_pu_bacteria 2924144063 2924148249 204
99 iso_pu_bacteria 2924150972 2924152277 204
100 iso_pu_bacteria 2924158325 2924164025 204
101 iso_pu_bacteria 2924165586 2924168663 204
102 iso_pu_bacteria 2924172951 2924176930 204
103 iso_pu_bacteria 2924179722 2924183813 204
104 iso_pu_bacteria 2924186466 2924189986 204
105 iso_pu_bacteria 2924193448 2924193725 204
106 iso_pu_bacteria 2924200457 2924202683 204
107 iso_pu_bacteria 2924207177 2924213453 204
108 iso_pu_bacteria 2924214083 2924220312 204
109 iso_pu_bacteria 2924221636 2924221816 204
110 iso_pu_bacteria 2924228884 2924232448 204
111 iso_pu_bacteria 2936996657 2936999990 204
112 iso_pu_bacteria 2937002841 2937007038 204
113 iso_pu_bacteria 2937009748 2937015507 204
114 iso_pu_bacteria 2937016420 2937018227 204
115 iso_pu_bacteria 2937023124 2937026756 204
116 iso_pu_bacteria 2937029754 2937033055 204
117 iso_pu_bacteria 2937036028 2937042163 204
118 iso_pu_bacteria 2937042894 2937047863 204
119 iso_pu_bacteria 2937056579 2937062186 204
120 iso_pu_bacteria 2937063883 2937069410 204
121 iso_pu_bacteria 2937071275 2937078277 204
122 iso_pu_bacteria 2937078374 2937078570 204
123 iso_pu_bacteria 2937084907 2937087247 204
124 iso_pu_bacteria 2937091812 2937093446 204
125 iso_pu_bacteria 2937098957 2937102262 204
126 iso_pu_bacteria 2937106411 2937111360 204
127 iso_pu_bacteria 2937113482 2937114892 204
128 iso_pu_bacteria 2937119839 2937123647 204
129 iso_pu_bacteria 2937126314 2937129375 204
130 iso_pu_bacteria 2957375807 2957377499 204
131 iso_pu_bacteria 2957382221 2957386136 204
132 iso_pu_bacteria 2957388812 2957392115 204
133 iso_pu_bacteria 2957395598 2957398451 204
134 iso_pu_bacteria 2957402308 2957406317 204
135 iso_pu_bacteria 2957408893 2957409070 204
136 iso_pu_bacteria 2957415311 2957419925 204
137 iso_pu_bacteria 2957422303 2957429406 204
138 iso_pu_bacteria 2957430029 2957435008 204
139 iso_pu_bacteria 2957437181 2957437328 204
140 iso_pu_bacteria 2957443900 2957449496 204
141 iso_pu_bacteria 2957450854 2957456289 204
142 iso_pu_bacteria 2957457609 2957459052 204
143 iso_pu_bacteria 2957464669 2957468353 204
144 iso_pu_bacteria 2957471148 2957475153 204
145 iso_pu_bacteria 2957478035 2957481153 204
146 iso_pu_bacteria 2957484790 2957487558 204
147 iso_pu_bacteria 2957491536 2957495325 204
148 iso_pu_bacteria 2957498199 2957503536 204
149 iso_pu_bacteria 2957505466 2957508705 204
150 iso_pu_bacteria 2960584000 2960589194 204
151 iso_pu_bacteria 2960591022 2960591218 204
152 iso_pu_bacteria 2960597568 2960601290 204
153 iso_pu_bacteria 2960603979 2960608320 204
154 iso_pu_bacteria 2960610863 2960616650 204
155 iso_pu_bacteria 2960617483 2960623495 204
156 iso_pu_bacteria 2960624210 2960626581 204
157 iso_pu_bacteria 2960631154 2960635071 204
158 iso_pu_bacteria 2960645483 2960650104 204
159 iso_pu_bacteria 2960652885 2960656716 204
160 iso_pu_bacteria 2960660292 2960665327 204
161 iso_pu_bacteria 2960667422 2960671549 204
162 iso_pu_bacteria 2960674078 2960678303 204
163 iso_pu_bacteria 2960680706 2960681299 204
164 iso_pu_bacteria 2960687367 2960692408 204
165 iso_pu_bacteria 2960693952 2960696405 204
166 iso_pu_bacteria 2964607997 2964612958 204
167 iso_pu_bacteria 2964615318 2964620454 204
168 iso_pu_bacteria 2964621998 2964628506 204
169 iso_pu_bacteria 2964628898 2964633552 204
170 iso_pu_bacteria 2964636051 2964641264 204
171 iso_pu_bacteria 2964643177 2964647294 204
172 iso_pu_bacteria 2964649959 2964652318 204
173 iso_pu_bacteria 2964656573 2964657747 204
174 iso_pu_bacteria 2964663802 2964670054 204
175 iso_pu_bacteria 2964678106 2964681844 204
176 iso_pu_bacteria 2964685014 2964688179 204
177 iso_pu_bacteria 2964691889 2964697852 204
178 iso_pu_bacteria 2964698721 2964703011 204
179 iso_pu_bacteria 2964705432 2964712101 204
180 iso_pu_bacteria 2964719344 2964720498 204
181 iso_pu_bacteria 2967664464 2967665321 204
182 iso_pu_bacteria 2967671571 2967674397 204
183 iso_pu_bacteria 2967678726 2967684100 204
184 iso_pu_bacteria 2967686174 2967689359 204
185 iso_pu_bacteria 2967693043 2967696212 204
186 iso_pu_bacteria 2967699805 2967700958 204
187 iso_pu_bacteria 2967706974 2967710052 204
188 iso_pu_bacteria 2967714385 2967720026 204
189 iso_pu_bacteria 2967721400 2967724840 204
190 iso_pu_bacteria 2967728569 2967732547 204
191 iso_pu_bacteria 2967735183 2967735334 204
192 iso_pu_bacteria 2967742019 2967747252 204
193 iso_pu_bacteria 2967748971 2967752389 204
194 iso_pu_bacteria 2967755722 2967758891 204
195 iso_pu_bacteria 2967762386 2967768526 204
196 iso_pu_bacteria 2967769361 2967772788 204
197 iso_pu_bacteria 2967775926 2967776410 204
198 iso_pu_bacteria 2970019648 2970022231 204
199 iso_pu_bacteria 2970026789 2970028244 204
200 iso_pu_bacteria 2970033650 2970039592 204
201 iso_pu_bacteria 2970040964 2970043448 204
202 iso_pu_bacteria 2970047711 2970050594 204
203 iso_pu_bacteria 2970054988 2970058422 204
204 iso_pu_bacteria 2970061556 2970066853 204
205 iso_pu_bacteria 2970068827 2970073987 204
206 iso_pu_bacteria 2970076120 2970079170 204
207 iso_pu_bacteria 2970082768 2970083477 204
208 iso_pu_bacteria 2970088815 2970090087 204
209 iso_pu_bacteria 2970095765 2970100406 204
210 iso_pu_bacteria 2970102677 2970108917 204
211 iso_pu_bacteria 2970109326 2970112746 204
212 iso_pu_bacteria 2970116247 2970121295 204
213 iso_pu_bacteria 2970122695 2970126524 204
214 iso_pu_bacteria 2970129317 2970134387 204
215 iso_pu_bacteria 2970136068 2970141258 204
216 iso_pu_bacteria 2970143518 2970146572 204
217 iso_pu_bacteria 2970149975 2970152769 204
218 iso_pu_bacteria 2970156795 2970163623 204
219 iso_pu_bacteria 2970164137 2970166776 204
220 iso_pu_bacteria 2970170962 2970173435 204
221 iso_pu_bacteria 2970177841 2970180725 204
222 iso_pu_bacteria 2970184632 2970187703 204
223 iso_pu_bacteria 2970191845 2970195116 204
224 iso_pu_bacteria 2977516862 2977523703 204
225 iso_pu_bacteria 2977523885 2977528065 204
226 iso_pu_bacteria 2977530762 2977534295 204
227 iso_pu_bacteria 2977537788 2977541057 204
228 iso_pu_bacteria 2977544691 2977548041 204
229 iso_pu_bacteria 2977551784 2977556937 204
230 iso_pu_bacteria 2977558990 2977563987 204
231 iso_pu_bacteria 2977565890 2977567215 204
232 iso_pu_bacteria 2977572785 2977576065 204
233 iso_pu_bacteria 2977579622 2977579800 204
234 iso_pu_bacteria 2996887358 2996890601 204
235 iso_pu_bacteria 3005452660 3005455488 204
236 iso_pu_bacteria 643692032 643827036 204
237 iso_pu_bacteria 648276728 648735892 204
238 iso_pu_bacteria 8003992118 8003994918 204
239 iso_pu_bacteria 8003999396 8004002672 204
240 iso_pu_bacteria 8005258706 8005264280 204
241 iso_pu_bacteria 8005321885 8005325128 204
242 iso_pu_bacteria 8005542996 8005547192 204
243 iso_pu_bacteria 2509276021 2509389895 205
244 iso_pu_bacteria 2509276033 2509447859 205
245 iso_pu_bacteria 2510065019 2510134791 205
246 iso_pu_bacteria 2510461076 2510896197 205
247 iso_pu_bacteria 2510917030 2511198458 205
248 iso_pu_bacteria 2513237084 2513572556 205
249 iso_pu_bacteria 2513237085 2513581271 205
250 iso_pu_bacteria 2513237093 2513631370 205
251 iso_pu_bacteria 2513237162 2514022386 205
252 iso_pu_bacteria 2515075009 2515113876 205
253 iso_pu_bacteria 2515154113 2515634749 205
254 iso_pu_bacteria 2515154114 2515645949 205
255 iso_pu_bacteria 2515154116 2515656830 205
256 iso_pu_bacteria 2515154134 2515743603 205
257 iso_pu_bacteria 2516653077 2517037492 205
258 iso_pu_bacteria 2516653085 2517077791 205
259 iso_pu_bacteria 2517093000 2517096590 205
260 iso_pu_bacteria 2517287029 2517410307 205
261 iso_pu_bacteria 2529292951 2530646902 205
262 iso_pu_bacteria 2585427526 2585530220 205
263 iso_pu_bacteria 2615840624 2616295506 205
264 iso_pu_bacteria 2718217927 2719387219 205
265 iso_pu_bacteria 2718218199 2720493279 205
266 iso_pu_bacteria 2718218232 2720614754 205
267 iso_pu_bacteria 2718218233 2720621527 205
268 iso_pu_bacteria 2718218235 2720632855 205
269 iso_pu_bacteria 2718218269 2720776579 205
270 iso_pu_bacteria 2718218423 2721400854 205
271 iso_pu_bacteria 2721755556 2723028167 205
272 iso_pu_bacteria 2721755684 2723561798 205
273 iso_pu_bacteria 2721755685 2723568427 205
274 iso_pu_bacteria 2721755809 2724039667 205
275 iso_pu_bacteria 2721755819 2724091186 205
276 iso_pu_bacteria 2721755822 2724105692 205
277 iso_pu_bacteria 2721755823 2724111521 205
278 iso_pu_bacteria 2724679232 2725947778 205
279 iso_pu_bacteria 2728369352 2730109103 205
280 iso_pu_bacteria 2765235942 2766065373 205
281 iso_pu_bacteria 2791355256 2793293699 205
282 iso_pu_bacteria 2791355259 2793313122 205
283 iso_pu_bacteria 2791355260 2793319770 205
284 iso_pu_bacteria 2791355261 2793327723 205
285 iso_pu_bacteria 2791355262 2793333316 205
286 iso_pu_bacteria 2791355265 2793353646 205
287 iso_pu_bacteria 2791355267 2793369503 205
288 iso_pu_bacteria 2838016132 2838019055 205
289 iso_pu_bacteria 2838048938 2838051227 205
290 iso_pu_bacteria 2838061910 2838063797 205
291 iso_pu_bacteria 2838068647 2838073280 205
292 iso_pu_bacteria 2838686498 2838691375 205
293 iso_pu_bacteria 2838729681 2838733334 205
294 iso_pu_bacteria 2838742623 2838746094 205
295 iso_pu_bacteria 2841851746 2841853806 205
296 iso_pu_bacteria 2841864319 2841868224 205
297 iso_pu_bacteria 2842110456 2842113489 205
298 iso_pu_bacteria 2842156927 2842162187 205
299 iso_pu_bacteria 2842163707 2842169742 205
300 iso_pu_bacteria 2842180545 2842185113 205
301 iso_pu_bacteria 2842205361 2842208249 205
302 iso_pu_bacteria 2842229732 2842233551 205
303 iso_pu_bacteria 2842243621 2842247644 205
304 iso_pu_bacteria 2842257432 2842262088 205
305 iso_pu_bacteria 2842264693 2842266560 205
306 iso_pu_bacteria 2842271015 2842275849 205
307 iso_pu_bacteria 2842278818 2842281742 205
308 iso_pu_bacteria 2842285085 2842288849 205
309 iso_pu_bacteria 2842304105 2842308167 205
310 iso_pu_bacteria 2842311132 2842315545 205
311 iso_pu_bacteria 2842341865 2842344946 205
312 iso_pu_bacteria 2842363717 2842369994 205
313 iso_pu_bacteria 2842395702 2842398572 205
314 iso_pu_bacteria 2842402390 2842406484 205
315 iso_pu_bacteria 2842409023 2842413089 205
316 iso_pu_bacteria 2842415677 2842419732 205
317 iso_pu_bacteria 2842422224 2842426914 205
318 iso_pu_bacteria 2842428310 2842429879 205
319 iso_pu_bacteria 2842434925 2842436461 205
320 iso_pu_bacteria 2842441272 2842444164 205
321 iso_pu_bacteria 2842447887 2842450978 205
322 iso_pu_bacteria 2842462802 2842464300 205
323 iso_pu_bacteria 2842469257 2842470790 205
324 iso_pu_bacteria 2842922631 2842925910 205
325 iso_pu_bacteria 2844454524 2844457549 205
326 iso_pu_bacteria 2857516855 2857518956 205
327 iso_pu_bacteria 2919100787 2919104509 205
328 iso_pu_bacteria 2933570622 2933574616 205
329 iso_pu_bacteria 2933586486 2933589221 205
330 iso_pu_bacteria 2933599457 2933603590 205
331 iso_pu_bacteria 2935901341 2935906951 205
332 iso_pu_bacteria 2936381700 2936382211 205
333 iso_pu_bacteria 3005445848 3005449224 205
334 iso_pu_bacteria 639633055 640732946 205
335 iso_pu_bacteria 8005275841 8005281948 205
336 iso_pu_bacteria 8005282627 8005288936 205
337 iso_pu_bacteria 8005289223 8005294322 205
338 iso_pu_bacteria 8005307578 8005311220 205
339 iso_pu_bacteria 8005382845 8005383894 205
340 iso_pu_bacteria 8005430974 8005434172 205
341 iso_pu_bacteria 8005460587 8005464563 205
342 iso_pu_bacteria 8005497431 8005501610 205
343 iso_pu_bacteria 8005556819 8005558436 205
344 iso_pu_bacteria 8005563573 8005566720 205
345 iso_pu_bacteria 8005619151 8005622967 205
346 iso_pu_bacteria 8005626139 8005631730 205
347 iso_pu_bacteria 8005668836 8005673031 205
348 iso_pu_bacteria 8005695170 8005700804 205
349 iso_pu_bacteria 8018127388 8018133666 205
350 iso_pu_bacteria 8018163183 8018170164 205
351 iso_pu_bacteria 8018176218 8018178518 205
352 iso_pu_bacteria 8023680758 8023687604 205
353 iso_pu_bacteria 8024479707 8024481726 205
354 iso_pu_bacteria 8056375014 8056381531 205
355 iso_pu_bacteria 8056382006 8056386964 205
356 iso_pu_bacteria 8057874678 8057876771 205
357 3300002773 JGI25152J39213_1001857 JGI25152J39213_10018572 208
358 3300003187 JGI25151J46595_10042987 JGI25151J46595_100429872 208
359 3300003354 JGI25160J50197_1000009 JGI25160J50197_1000009107 208
360 3300003354 JGI25160J50197_1015112 JGI25160J50197_10151124 208
361 3300003374 JGI25161J50226_1000913 JGI25161J50226_10009133 208
362 3300003771 Ga0055526_1002838 Ga0055526_10028382 208
363 3300003775 Ga0055524_1017010 Ga0055524_10170102 208
364 3300003775 Ga0055524_1023307 Ga0055524_10233072 208
365 3300003781 Ga0055536_1018709 Ga0055536_10187092 208
366 3300003790 Ga0055528_1011334 Ga0055528_10113342 208
367 3300003791 Ga0055530_10038403 Ga0055530_100384032 208
368 3300004625 Ga0055543_1000379 Ga0055543_10003795 208
369 3300005262 Ga0065165_1000020 Ga0065165_1000020163 208
370 3300005347 Ga0070668_100028026 Ga0070668_1000280263 208
371 3300005355 Ga0070671_100006261 Ga0070671_1000062618 208
372 3300005455 Ga0070663_100150836 Ga0070663_1001508362 208
373 3300006038 Ga0075365_10000625 Ga0075365_1000062510 208
374 3300006178 Ga0075367_10066847 Ga0075367_100668472 208
375 3300006186 Ga0075369_10002578 Ga0075369_100025783 208
376 3300006948 Ga0099826_10167099 Ga0099826_101670992 208
377 3300009011 Ga0105251_10007523 Ga0105251_100075236 208
378 3300009553 Ga0105249_10306686 Ga0105249_103066862 208
379 3300022739 Ga0228711_1000003 Ga0228711_100000389 208
380 3300022740 Ga0228710_1000003 Ga0228710_100000395 208
381 3300025208 Ga0209436_101900 Ga0209436_1019003 208
382 3300025258 Ga0209129_1002207 Ga0209129_10022075 208
383 3300025273 Ga0209673_1003294 Ga0209673_10032944 208
384 3300025273 Ga0209673_1007964 Ga0209673_10079644 208
385 3300025284 Ga0209130_1000037 Ga0209130_1000037163 208
386 3300025284 Ga0209130_1015104 Ga0209130_10151042 208
387 3300025292 Ga0209676_1000239 Ga0209676_10002396 208
388 3300025294 Ga0209025_1000196 Ga0209025_100019644 208
389 3300025294 Ga0209025_1007724 Ga0209025_10077243 208
390 3300025294 Ga0209025_1029461 Ga0209025_10294612 208
391 3300025295 Ga0209564_1000086 Ga0209564_1000086107 208
392 3300025295 Ga0209564_1009273 Ga0209564_10092732 208
393 3300025295 Ga0209564_1012931 Ga0209564_10129313 208
394 3300025298 Ga0209050_1071938 Ga0209050_10719381 208
395 3300025299 Ga0209256_1002346 Ga0209256_100234616 208
396 3300025299 Ga0209256_1004844 Ga0209256_10048445 208
397 3300025299 Ga0209256_1007800 Ga0209256_10078002 208
398 3300025302 Ga0207426_1000048 Ga0207426_1000048203 208
399 3300025302 Ga0207426_1000984 Ga0207426_10009842 208
400 3300025303 Ga0209051_1008583 Ga0209051_10085833 208
401 3300025303 Ga0209051_1011076 Ga0209051_10110762 208
402 3300025304 Ga0209257_1001192 Ga0209257_100119230 208
403 3300025735 Ga0207713_1047324 Ga0207713_10473242 208
404 3300025931 Ga0207644_10338252 Ga0207644_103382522 208
405 3300025961 Ga0207712_10215014 Ga0207712_102150142 208
406 3300025972 Ga0207668_10041332 Ga0207668_100413323 208
407 3300027111 Ga0209281_1000081 Ga0209281_100008189 208
408 3300027111 Ga0209281_1000269 Ga0209281_10002696 208
409 3300027666 Ga0209282_1000040 Ga0209282_100004027 208
410 3300031824 Ga0307413_10480652 Ga0307413_104806522 208
411 3300031967 Ga0315914_1000002 Ga0315914_1000002195 208
412 3300033430 Ga0315913_1000016 Ga0315913_100001614 208
413 3300033464 Ga0315915_1000005 Ga0315915_1000005195 208
414 3300041413 Ga0439465_0038579 Ga0439465_0038579_624_1250 208
415 3300042007 Ga0439449_0009512 Ga0439449_0009512_373_999 208
416 3300042007 Ga0439449_0071369 Ga0439449_0071369_511_1137 208
417 3300046471 Ga0495650_0058521 Ga0495650_0058521_582_1208 208
418 3300046474 Ga0495605_0135514 Ga0495605_0135514_88_714 208
419 3300046492 Ga0495585_0018134 Ga0495585_0018134_3033_3659 208
420 3300046501 Ga0495607_0153199 Ga0495607_0153199_363_989 208
421 3300046501 Ga0495607_0242293 Ga0495607_0242293_37_663 208
422 3300046506 Ga0495583_0001777 Ga0495583_0001777_15395_16021 208
423 3300046507 Ga0495606_0375579 Ga0495606_0375579_86_733 208
424 3300046512 Ga0495610_0010166 Ga0495610_0010166_2428_3054 208
425 3300046513 Ga0495616_0082893 Ga0495616_0082893_525_1151 208
426 3300046515 Ga0495620_0023060 Ga0495620_0023060_2196_2822 208
427 3300046515 Ga0495620_0057355 Ga0495620_0057355_807_1433 208
428 3300046518 Ga0495631_0144826 Ga0495631_0144826_344_991 208
429 3300046519 Ga0495632_0037703 Ga0495632_0037703_378_1004 208
430 3300046558 Ga0495633_0016839 Ga0495633_0016839_2077_2703 208
431 3300046615 Ga0495656_0014119 Ga0495656_0014119_1088_1714 208
432 3300046674 Ga0495588_0063913 Ga0495588_0063913_232_858 208
433 3300046692 Ga0495671_0130021 Ga0495671_0130021_182_808 208
434 3300047469 Ga0495673_0019458 Ga0495673_0019458_428_1054 208
435 3300047472 Ga0495686_0012528 Ga0495686_0012528_2916_3542 208
436 3300047472 Ga0495686_0039993 Ga0495686_0039993_1077_1703 208
437 3300048903 Ga0496100_0238202 Ga0496100_0238202_228_854 208
438 3300048904 Ga0496101_0512856 Ga0496101_0512856_166_792 208
439 3300048905 Ga0496102_0085384 Ga0496102_0085384_1601_2227 208
440 3300048906 Ga0496103_0229775 Ga0496103_0229775_310_936 208
441 3300048907 Ga0496104_0046823 Ga0496104_0046823_1643_2269 208
442 3300048908 Ga0496105_0046290 Ga0496105_0046290_1930_2556 208
443 3300048911 Ga0496108_0726220 Ga0496108_0726220_221_847 208
444 3300048912 Ga0496109_0419415 Ga0496109_0419415_41_667 208
445 3300048913 Ga0496110_0387585 Ga0496110_0387585_319_945 208
446 3300048914 Ga0496111_0383373 Ga0496111_0383373_242_868 208
447 3300048915 Ga0496112_0355135 Ga0496112_0355135_452_1078 208
448 3300048917 Ga0496114_0366749 Ga0496114_0366749_293_919 208
449 3300048919 Ga0496116_0028699 Ga0496116_0028699_369_995 208
450 3300048921 Ga0496118_0174705 Ga0496118_0174705_181_807 208
451 3300048922 Ga0496119_0011371 Ga0496119_0011371_3849_4475 208
452 3300048925 Ga0496122_0033828 Ga0496122_0033828_2998_3624 208
453 3300048927 Ga0496124_0032086 Ga0496124_0032086_3029_3655 208
454 3300048927 Ga0496124_0036431 Ga0496124_0036431_1315_1941 208
455 3300048927 Ga0496124_0274225 Ga0496124_0274225_208_834 208
456 3300048929 Ga0496126_0136251 Ga0496126_0136251_1288_1914 208
457 3300049459 Ga0495678_056243 Ga0495678_056243_586_1212 208
458 3300050490 nmdc:mga03n38_243955_c1 nmdc:mga03n38_243955_c1_98_724 208
459 3300002739 JGI25158J39367_1000249 JGI25158J39367_10002496 209
460 3300002987 JGI25159J45721_1000470 JGI25159J45721_10004703 209
461 3300003187 JGI25151J46595_10062140 JGI25151J46595_100621402 209
462 3300003215 JGI25153J46596_10027357 JGI25153J46596_100273572 209
463 3300003215 JGI25153J46596_10031037 JGI25153J46596_100310372 209
464 3300003320 rootH2_10120646 rootH2_101206461 209
465 3300003322 rootL2_10265622 rootL2_102656221 209
466 3300003374 JGI25161J50226_1000114 JGI25161J50226_100011445 209
467 3300003771 Ga0055526_1002079 Ga0055526_10020793 209
468 3300003771 Ga0055526_1038357 Ga0055526_10383572 209
469 3300003775 Ga0055524_1026983 Ga0055524_10269832 209
470 3300003790 Ga0055528_1004527 Ga0055528_10045273 209
471 3300003790 Ga0055528_1008089 Ga0055528_10080893 209
472 3300003792 Ga0055540_1004365 Ga0055540_10043652 209
473 3300004625 Ga0055543_1000077 Ga0055543_100007740 209
474 3300005353 Ga0070669_100042173 Ga0070669_1000421733 209
475 3300006048 Ga0075363_100161064 Ga0075363_1001610642 209
476 3300006178 Ga0075367_10283491 Ga0075367_102834911 209
477 3300006186 Ga0075369_10024760 Ga0075369_100247602 209
478 3300006353 Ga0075370_10172032 Ga0075370_101720321 209
479 3300025208 Ga0209436_100050 Ga0209436_10005045 209
480 3300025258 Ga0209129_1004928 Ga0209129_10049283 209
481 3300025258 Ga0209129_1005630 Ga0209129_10056303 209
482 3300025258 Ga0209129_1024234 Ga0209129_10242342 209
483 3300025273 Ga0209673_1009471 Ga0209673_10094713 209
484 3300025284 Ga0209130_1000030 Ga0209130_1000030221 209
485 3300025294 Ga0209025_1014510 Ga0209025_10145104 209
486 3300025295 Ga0209564_1047460 Ga0209564_10474602 209
487 3300025297 Ga0209758_1001342 Ga0209758_10013423 209
488 3300025297 Ga0209758_1001459 Ga0209758_100145913 209
489 3300025297 Ga0209758_1014895 Ga0209758_10148954 209
490 3300025298 Ga0209050_1012635 Ga0209050_10126353 209
491 3300025299 Ga0209256_1008128 Ga0209256_10081284 209
492 3300025299 Ga0209256_1050236 Ga0209256_10502362 209
493 3300025302 Ga0207426_1000047 Ga0207426_1000047180 209
494 3300025303 Ga0209051_1000874 Ga0209051_10008749 209
495 3300025303 Ga0209051_1013994 Ga0209051_10139944 209
496 3300025304 Ga0209257_1005971 Ga0209257_10059713 209
497 3300028379 Ga0268266_10050241 Ga0268266_100502414 209
498 3300041406 Ga0439439_0074617 Ga0439439_0074617_160_801 209
499 3300041413 Ga0439465_0195461 Ga0439465_0195461_40_681 209
500 3300041441 Ga0451787_108328 Ga0451787_108328_563_1204 209
501 3300041452 Ga0451793_1249231 Ga0451793_1249231_368_1009 209
502 3300041456 Ga0451795_0450740 Ga0451795_0450740_1152_1793 209
503 3300041458 Ga0451798_0128064 Ga0451798_0128064_202_843 209
504 3300041463 Ga0451804_0996814 Ga0451804_0996814_317_958 209
505 3300041491 Ga0451833_0943957 Ga0451833_0943957_94_735 209
506 3300041492 Ga0451835_0046067 Ga0451835_0046067_735_1376 209
507 3300041494 Ga0451837_0528640 Ga0451837_0528640_89_730 209
508 3300041494 Ga0451837_0531546 Ga0451837_0531546_89_730 209
509 3300041496 Ga0451839_0378789 Ga0451839_0378789_447_1088 209
510 3300041498 Ga0451841_1372321 Ga0451841_1372321_317_958 209
511 3300041501 Ga0451845_0691553 Ga0451845_0691553_827_1468 209
512 3300041503 Ga0451847_0787006 Ga0451847_0787006_1411_2052 209
513 3300041505 Ga0451849_0339959 Ga0451849_0339959_1421_2050 209
514 3300041505 Ga0451849_0360680 Ga0451849_0360680_455_1096 209
515 3300041507 Ga0451851_0889251 Ga0451851_0889251_925_1566 209
516 3300041509 Ga0451843_0588359 Ga0451843_0588359_421_1062 209
517 3300041511 Ga0451855_0465113 Ga0451855_0465113_1605_2246 209
518 3300041512 Ga0451853_1787960 Ga0451853_1787960_671_1312 209
519 3300042015 Ga0439462_0021448 Ga0439462_0021448_317_958 209
520 3300046457 Ga0495590_0054786 Ga0495590_0054786_11_640 209
521 3300046457 Ga0495590_0097425 Ga0495590_0097425_377_1018 209
522 3300046460 Ga0495638_0084568 Ga0495638_0084568_434_1075 209
523 3300046462 Ga0495651_0186078 Ga0495651_0186078_350_991 209
524 3300046471 Ga0495650_0040659 Ga0495650_0040659_538_1179 209
525 3300046476 Ga0495662_0003065 Ga0495662_0003065_1013_1654 209
526 3300046492 Ga0495585_0094153 Ga0495585_0094153_229_870 209
527 3300046500 Ga0495596_0060775 Ga0495596_0060775_47_688 209
528 3300046507 Ga0495606_0351813 Ga0495606_0351813_95_736 209
529 3300046512 Ga0495610_0049840 Ga0495610_0049840_1132_1773 209
530 3300046512 Ga0495610_0127528 Ga0495610_0127528_39_680 209
531 3300046513 Ga0495616_0043443 Ga0495616_0043443_1386_2027 209
532 3300046515 Ga0495620_0020624 Ga0495620_0020624_704_1345 209
533 3300046515 Ga0495620_0145447 Ga0495620_0145447_108_749 209
534 3300046519 Ga0495632_0155815 Ga0495632_0155815_216_857 209
535 3300046522 Ga0495643_0029251 Ga0495643_0029251_166_807 209
536 3300046522 Ga0495643_0128100 Ga0495643_0128100_36_677 209
537 3300046524 Ga0495648_0060843 Ga0495648_0060843_1588_2229 209
538 3300046525 Ga0495663_0181156 Ga0495663_0181156_39_680 209
539 3300046536 Ga0495587_0034258 Ga0495587_0034258_1110_1751 209
540 3300046542 Ga0495597_0030255 Ga0495597_0030255_623_1264 209
541 3300046558 Ga0495633_0057854 Ga0495633_0057854_234_875 209
542 3300046616 Ga0495668_0159079 Ga0495668_0159079_53_694 209
543 3300046642 Ga0495634_0153240 Ga0495634_0153240_763_1404 209
544 3300046660 Ga0495625_0093591 Ga0495625_0093591_520_1161 209
545 3300046663 Ga0495635_0249717 Ga0495635_0249717_500_1141 209
546 3300046665 Ga0495661_0064751 Ga0495661_0064751_205_846 209
547 3300046691 Ga0495670_0114701 Ga0495670_0114701_683_1324 209
548 3300046694 Ga0495649_0030423 Ga0495649_0030423_274_915 209
549 3300046810 Ga0495660_0194465 Ga0495660_0194465_187_828 209
550 3300047317 Ga0495604_0021754 Ga0495604_0021754_2948_3589 209
551 3300047318 Ga0495636_0013155 Ga0495636_0013155_1459_2100 209
552 3300047319 Ga0495674_0399308 Ga0495674_0399308_182_823 209
553 3300047443 Ga0495687_063927 Ga0495687_063927_106_747 209
554 3300047470 Ga0495681_0101382 Ga0495681_0101382_274_915 209
555 3300047472 Ga0495686_0101807 Ga0495686_0101807_19_660 209
556 3300048090 Ga0495615_0012953 Ga0495615_0012953_922_1563 209
557 3300048909 Ga0496106_0012003 Ga0496106_0012003_2040_2681 209
558 3300048913 Ga0496110_0540641 Ga0496110_0540641_224_865 209
559 3300048917 Ga0496114_0182308 Ga0496114_0182308_376_1017 209
560 3300048919 Ga0496116_0020895 Ga0496116_0020895_2107_2748 209
561 3300048920 Ga0496117_0187567 Ga0496117_0187567_311_952 209
562 3300048921 Ga0496118_0025577 Ga0496118_0025577_887_1516 209
563 3300048924 Ga0496121_0021259 Ga0496121_0021259_1572_2213 209
564 3300048924 Ga0496121_0273286 Ga0496121_0273286_205_846 209
565 3300048924 Ga0496121_0483969 Ga0496121_0483969_44_685 209
566 3300048925 Ga0496122_0046622 Ga0496122_0046622_674_1315 209
567 3300049569 Ga0501032_0242286 Ga0501032_0242286_488_1117 209
568 3300049572 Ga0501036_0116364 Ga0501036_0116364_422_1051 209
569 3300049574 Ga0501038_0076815 Ga0501038_0076815_1289_1918 209
570 3300049575 Ga0501039_0195066 Ga0501039_0195066_890_1519 209
571 3300049589 Ga0501073_0215465 Ga0501073_0215465_113_742 209
572 3300049742 Ga0501080_0301944 Ga0501080_0301944_463_1092 209
573 3300049744 Ga0501083_0181934 Ga0501083_0181934_667_1296 209
574 3300049822 Ga0501035_0619570 Ga0501035_0619570_54_683 209
575 3300050490 nmdc:mga03n38_53691_c1 nmdc:mga03n38_53691_c1_1072_1701 209
576 3300050496 nmdc:mga07m45_192541_c1 nmdc:mga07m45_192541_c1_23_652 209
577 3300050516 nmdc:mga0sz30_210516_c1 nmdc:mga0sz30_210516_c1_17_658 209
578 3300053093 Ga0500651_0259533 Ga0500651_0259533_32_673 209
579 3300053134 Ga0500658_0000067 Ga0500658_0000067_8707_9348 209
580 3300053139 Ga0500568_0027939 Ga0500568_0027939_497_1138 209
581 3300053153 Ga0500616_0024713 Ga0500616_0024713_36_677 209
582 3300053156 Ga0500622_0007156 Ga0500622_0007156_1882_2523 209
583 3300053158 Ga0500627_0122445 Ga0500627_0122445_286_927 209
584 3300053160 Ga0500633_0001334 Ga0500633_0001334_2466_3107 209
585 3300053730 Ga0500645_053412 Ga0500645_053412_393_1022 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

34

182

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qqm-assembly5.cif.gz_E crystal structure of a putative amino-acid aminotransferase (np_104211.1) from mesorhizobium loti at 2.30 a resolution 0.9752 3 207
3qqm-assembly5.cif.gz_E crystal structure of a putative amino-acid aminotransferase (np_104211.1) from mesorhizobium loti at 2.30 a resolution 0.9614 3 207
3csw-assembly2.cif.gz_C crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution 0.8819 4 206
1bqg-assembly1.cif.gz_A the structure of the d-glucarate dehydratase protein from pseudomonas putida 0.8747 57 78
3p0w-assembly1.cif.gz_A crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate 0.8692 57 78
ID Description Score Start End Superfamily
3qqmH02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9812 76 207 3.20.10.10
3qqmH02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9739 76 207 3.20.10.10
3qqmA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9041 2 73 3.30.470.10
af_Q5A0H4_165_296_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.8939 82 207 3.20.10.10
2xpfB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.8887 87 206 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A7W5YLK8-F1-model_v4 Probable branched-chain-amino-acid aminotransferase 0.9958 1 208 GO:0008696
AF-A0A7W7YVB2-F1-model_v4 4-amino-4-deoxychorismate lyase (EC 4.1.3.38) 0.9937 58 207 GO:0008696
AF-A0A0T1WPI7-F1-model_v4 Branched-chain-amino-acid aminotransferase 0.9931 58 209 GO:0003824
AF-A0A530MBC1-F1-model_v4 deleted 0.9923 112 207
AF-A0A659UFR9-F1-model_v4 Uncharacterized protein 0.992 93 207 GO:0003824

Feature Viewer

pLDDT pTM Quality
92.87 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map