F465816

General Info

Members Datasets Scaffolds Average Seq Length
579 187 1158 186

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10006594|Ga0070717_100065942
Length 208
Sequence VYNVKSLQKLPPLASQGTLELCVPKCEKGLGSLIHFPDSADLIDGVRLQLQPLWPDDRGYFLEVQRYGHGLVAEFPAPSTQVSAVFNYPDTIKAFHYHQEHTDCWTPATGLLQVVLVDLRAASRTFGRRNTMFVGALRPWHILIPPGVAHGYKVIGPESAVLVYLTDRFYDPKDEGRIAYDDPGINYDWEKQRHGGWEFPVVNGEPSI

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.86
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10006594 3300006028 Bacteria 8551
2 Ga0070658_10057173 3300005327 Bacteria 3172
3 Ga0070658_10874798 3300005327 Unclassified 781
4 Ga0070676_10278097 3300005328 Bacteria 1127
5 Ga0070683_100005281 3300005329 Bacteria 10755
6 Ga0070683_100049278 3300005329 Bacteria 3895
7 Ga0070683_100526910 3300005329 Archaea 1129
8 Ga0070677_10397773 3300005333 Bacteria 725
9 Ga0068869_100270484 3300005334 Bacteria 1363
10 Ga0068869_100427228 3300005334 Bacteria 1094
11 Ga0070666_10028206 3300005335 Bacteria 3682
12 Ga0070666_10347579 3300005335 Bacteria 1061
13 Ga0070666_10586576 3300005335 Bacteria 813
14 Ga0070680_100140939 3300005336 Bacteria 2022
15 Ga0070680_100716052 3300005336 Bacteria 861
16 Ga0068868_100029326 3300005338 Bacteria 4213
17 Ga0068868_100279973 3300005338 Unclassified 1411
18 Ga0070660_100033705 3300005339 Bacteria 3862
19 Ga0070660_100034660 3300005339 Bacteria 3815
20 Ga0070660_100107772 3300005339 Bacteria 2214
21 Ga0070660_100314274 3300005339 Bacteria 1286
22 Ga0070689_100299141 3300005340 Bacteria 1339
23 Ga0070661_100040562 3300005344 Bacteria 3397
24 Ga0070671_100017534 3300005355 Bacteria 5802
25 Ga0070671_100026304 3300005355 Bacteria 4781
26 Ga0070673_100028501 3300005364 Bacteria 4153
27 Ga0070673_100819919 3300005364 Unclassified 860
28 Ga0070659_100879778 3300005366 Bacteria 782
29 Ga0070667_100177652 3300005367 Bacteria 1882
30 Ga0070667_100714548 3300005367 Bacteria 928
31 Ga0070709_10059553 3300005434 Bacteria 2425
32 Ga0070714_100000715 3300005435 Bacteria 23534
33 Ga0070714_100056472 3300005435 Bacteria 3358
34 Ga0070714_100334766 3300005435 Bacteria 1418
35 Ga0070713_100000906 3300005436 Bacteria 18934
36 Ga0070713_100017013 3300005436 Bacteria 5484
37 Ga0070713_100626292 3300005436 Bacteria 1023
38 Ga0070713_100817682 3300005436 Bacteria 894
39 Ga0070711_100007658 3300005439 Bacteria 6577
40 Ga0070711_100100018 3300005439 Bacteria 2108
41 Ga0070678_100319649 3300005456 Bacteria 1325
42 Ga0070662_100013546 3300005457 Bacteria 5428
43 Ga0070681_10048406 3300005458 Bacteria 4248
44 Ga0070681_10083737 3300005458 Bacteria 3142
45 Ga0070681_10149977 3300005458 Bacteria 2258
46 Ga0070681_10155838 3300005458 Bacteria 2209
47 Ga0070681_10308265 3300005458 Bacteria 1492
48 Ga0070681_10832181 3300005458 Bacteria 840
49 Ga0068867_100031040 3300005459 Bacteria 3856
50 Ga0068867_100045080 3300005459 Bacteria 3232
51 Ga0068867_100457733 3300005459 Bacteria 1089
52 Ga0068867_100782407 3300005459 Bacteria 849
53 Ga0070699_100199011 3300005518 Bacteria 1781
54 Ga0070679_100016018 3300005530 Bacteria 7220
55 Ga0070679_100019809 3300005530 Bacteria 6550
56 Ga0070679_100053121 3300005530 Bacteria 4034
57 Ga0070684_100006884 3300005535 Bacteria 8827
58 Ga0070684_100037870 3300005535 Bacteria 4140
59 Ga0070684_100043486 3300005535 Bacteria 3879
60 Ga0070684_100044805 3300005535 Bacteria 3827
61 Ga0070684_100092697 3300005535 Bacteria 2688
62 Ga0070684_100154222 3300005535 Bacteria 2082
63 Ga0070684_100174691 3300005535 Bacteria 1952
64 Ga0070684_100965871 3300005535 Bacteria 799
65 Ga0068853_100061529 3300005539 Bacteria 3247
66 Ga0068853_100108151 3300005539 Bacteria 2466
67 Ga0068853_100956913 3300005539 Unclassified 823
68 Ga0068853_101220789 3300005539 Bacteria 726
69 Ga0070695_100019282 3300005545 Bacteria 4152
70 Ga0070695_100108421 3300005545 Bacteria 1880
71 Ga0070695_100223716 3300005545 Unclassified 1357
72 Ga0070695_100312512 3300005545 Bacteria 1165
73 Ga0070693_100166297 3300005547 Bacteria 1409
74 Ga0070665_100013667 3300005548 Bacteria 8167
75 Ga0070665_100395801 3300005548 Bacteria 1389
76 Ga0070665_100712685 3300005548 Bacteria 1016
77 Ga0070665_101001734 3300005548 Bacteria 848
78 Ga0070704_100792865 3300005549 Bacteria 846
79 Ga0068855_100002831 3300005563 Bacteria 21343
80 Ga0068855_100017703 3300005563 Bacteria 8569
81 Ga0068855_100041212 3300005563 Bacteria 5474
82 Ga0068855_100070680 3300005563 Bacteria 4060
83 Ga0068855_100344716 3300005563 Bacteria 1642
84 Ga0068855_100348570 3300005563 Bacteria 1631
85 Ga0068855_100349984 3300005563 Bacteria 1628
86 Ga0070664_100095957 3300005564 Bacteria 2572
87 Ga0070664_100323171 3300005564 Bacteria 1398
88 Ga0070664_100391417 3300005564 Bacteria 1270
89 Ga0070664_100571113 3300005564 Unclassified 1047
90 Ga0068857_100004524 3300005577 Bacteria 11761
91 Ga0068857_100012957 3300005577 Bacteria 7268
92 Ga0068857_100038590 3300005577 Bacteria 4230
93 Ga0068857_100310594 3300005577 Bacteria 1454
94 Ga0068854_100031037 3300005578 Bacteria 3711
95 Ga0068854_100476360 3300005578 Bacteria 1047
96 Ga0068856_100030889 3300005614 Bacteria 5239
97 Ga0068856_100044343 3300005614 Bacteria 4377
98 Ga0068856_100057924 3300005614 Bacteria 3826
99 Ga0068856_100073391 3300005614 Bacteria 3388
100 Ga0068856_100312180 3300005614 Bacteria 1590
101 Ga0068856_100384736 3300005614 Bacteria 1422
102 Ga0068856_100953620 3300005614 Bacteria 876
103 Ga0068852_100285621 3300005616 Bacteria 1592
104 Ga0068859_100018317 3300005617 Bacteria 7040
105 Ga0068859_100148927 3300005617 Unclassified 2416
106 Ga0068864_100232662 3300005618 Bacteria 1705
107 Ga0068864_100894075 3300005618 Bacteria 877
108 Ga0068866_10065991 3300005718 Bacteria 1895
109 Ga0068851_10116794 3300005834 Bacteria 1430
110 Ga0068851_10527057 3300005834 Unclassified 711
111 Ga0068863_100242026 3300005841 Bacteria 1741
112 Ga0068858_100008312 3300005842 Bacteria 9982
113 Ga0068858_100015487 3300005842 Bacteria 7171
114 Ga0068858_100127763 3300005842 Bacteria 2382
115 Ga0068858_100165225 3300005842 Bacteria 2086
116 Ga0068858_100321945 3300005842 Bacteria 1478
117 Ga0068858_100709657 3300005842 Bacteria 979
118 Ga0068860_100017905 3300005843 Bacteria 6899
119 Ga0068860_100041270 3300005843 Bacteria 4407
120 Ga0068860_100301192 3300005843 Bacteria 1570
121 Ga0068860_100508957 3300005843 Bacteria 1203
122 Ga0081539_10056209 3300005985 Bacteria 2185
123 Ga0070717_10197117 3300006028 Bacteria 1762
124 Ga0070717_10302964 3300006028 Bacteria 1421
125 Ga0097621_100007365 3300006237 Bacteria 7870
126 Ga0097621_100106620 3300006237 Bacteria 2364
127 Ga0097621_100135442 3300006237 Bacteria 2100
128 Ga0097621_100355051 3300006237 Bacteria 1304
129 Ga0097621_100505092 3300006237 Unclassified 1095
130 Ga0068871_100011638 3300006358 Bacteria 6459
131 Ga0068871_100027800 3300006358 Bacteria 4428
132 Ga0068871_100031825 3300006358 Unclassified 4162
133 Ga0068871_100111868 3300006358 Bacteria 2297
134 Ga0068871_100127795 3300006358 Bacteria 2153
135 Ga0068871_100159972 3300006358 Bacteria 1926
136 Ga0068871_100214934 3300006358 Bacteria 1664
137 Ga0068871_101098433 3300006358 Bacteria 743
138 Ga0068871_101558819 3300006358 Unclassified 625
139 Ga0075431_100017970 3300006847 Bacteria 7191
140 Ga0075429_101004572 3300006880 Bacteria 729
141 Ga0068865_100005242 3300006881 Bacteria 7837
142 Ga0068865_100015691 3300006881 Bacteria 4833
143 Ga0068865_100316009 3300006881 Bacteria 1255
144 Ga0075436_100002682 3300006914 Bacteria 12246
145 Ga0097620_100018317 3300006931 Bacteria 7040
146 Ga0097620_100148930 3300006931 Unclassified 2416
147 Ga0105240_10000394 3300009093 Bacteria 81599
148 Ga0105240_10001861 3300009093 Bacteria 35189
149 Ga0105240_10002259 3300009093 Bacteria 31243
150 Ga0105240_10030019 3300009093 Bacteria 7072
151 Ga0105240_10064499 3300009093 Bacteria 4551
152 Ga0105240_10130287 3300009093 Bacteria 3018
153 Ga0105240_10132369 3300009093 Bacteria 2990
154 Ga0105240_10177801 3300009093 Bacteria 2514
155 Ga0105240_10801057 3300009093 Unclassified 1020
156 Ga0105245_10000827 3300009098 Bacteria 28177
157 Ga0105245_10001486 3300009098 Bacteria 21200
158 Ga0105245_10015223 3300009098 Bacteria 6701
159 Ga0105245_10059060 3300009098 Bacteria 3453
160 Ga0105245_10089427 3300009098 Bacteria 2831
161 Ga0105245_10127618 3300009098 Bacteria 2383
162 Ga0105245_10269851 3300009098 Bacteria 1659
163 Ga0105245_10311079 3300009098 Bacteria 1549
164 Ga0105245_10575298 3300009098 Bacteria 1150
165 Ga0105245_10608722 3300009098 Bacteria 1120
166 Ga0105245_10839509 3300009098 Bacteria 958
167 Ga0105245_11338560 3300009098 Bacteria 765
168 Ga0105247_10169701 3300009101 Bacteria 1450
169 Ga0114129_10025980 3300009147 Bacteria 8293
170 Ga0114129_10222165 3300009147 Bacteria 2547
171 Ga0114129_10425975 3300009147 Bacteria 1745
172 Ga0114129_11837419 3300009147 Unclassified 736
173 Ga0105241_10000998 3300009174 Bacteria 21446
174 Ga0105241_10004783 3300009174 Bacteria 9972
175 Ga0105241_10019328 3300009174 Bacteria 5023
176 Ga0105241_10061455 3300009174 Bacteria 2893
177 Ga0105241_10156461 3300009174 Bacteria 1869
178 Ga0105241_10786750 3300009174 Bacteria 875
179 Ga0105241_11469361 3300009174 Bacteria 655
180 Ga0105242_10005892 3300009176 Bacteria 9449
181 Ga0105242_10012732 3300009176 Bacteria 6478
182 Ga0105242_10012939 3300009176 Bacteria 6434
183 Ga0105242_10026958 3300009176 Bacteria 4558
184 Ga0105242_10060698 3300009176 Bacteria 3108
185 Ga0105242_10329633 3300009176 Unclassified 1403
186 Ga0105242_10344061 3300009176 Bacteria 1375
187 Ga0105242_10370801 3300009176 Unclassified 1328
188 Ga0105242_10407953 3300009176 Bacteria 1270
189 Ga0105242_10688689 3300009176 Bacteria 998
190 Ga0105248_10007047 3300009177 Bacteria 12315
191 Ga0105248_10016678 3300009177 Bacteria 8085
192 Ga0105248_10037541 3300009177 Bacteria 5420
193 Ga0105248_10074785 3300009177 Bacteria 3807
194 Ga0105248_10136871 3300009177 Bacteria 2763
195 Ga0105248_10292927 3300009177 Bacteria 1833
196 Ga0105248_10315312 3300009177 Bacteria 1761
197 Ga0105248_10478793 3300009177 Bacteria 1403
198 Ga0105248_10553164 3300009177 Bacteria 1298
199 Ga0105248_11270690 3300009177 Bacteria 833
200 Ga0105248_11895543 3300009177 Bacteria 676
201 Ga0105237_10001090 3300009545 Bacteria 36343
202 Ga0105237_10004471 3300009545 Bacteria 16165
203 Ga0105237_10032759 3300009545 Bacteria 5262
204 Ga0105237_10034090 3300009545 Bacteria 5157
205 Ga0105237_10040832 3300009545 Bacteria 4679
206 Ga0105237_10300691 3300009545 Bacteria 1608
207 Ga0105237_10763167 3300009545 Bacteria 974
208 Ga0105238_10004740 3300009551 Bacteria 13454
209 Ga0105238_10013247 3300009551 Bacteria 8320
210 Ga0105238_10018287 3300009551 Bacteria 7132
211 Ga0105238_10019159 3300009551 Bacteria 6973
212 Ga0105238_10027937 3300009551 Bacteria 5749
213 Ga0105238_10029699 3300009551 Bacteria 5567
214 Ga0105238_10038819 3300009551 Bacteria 4835
215 Ga0105238_10206034 3300009551 Bacteria 1943
216 Ga0105238_10225174 3300009551 Bacteria 1852
217 Ga0105238_10262638 3300009551 Bacteria 1706
218 Ga0105249_10016720 3300009553 Bacteria 6510
219 Ga0105249_10027955 3300009553 Bacteria 5090
220 Ga0105249_10129097 3300009553 Bacteria 2411
221 Ga0105249_10415156 3300009553 Bacteria 1378
222 Ga0105249_10415963 3300009553 Bacteria 1377
223 Ga0105239_10004394 3300010375 Bacteria 16878
224 Ga0105239_10006490 3300010375 Bacteria 13565
225 Ga0105239_10016236 3300010375 Bacteria 8237
226 Ga0105239_10068655 3300010375 Bacteria 3895
227 Ga0105239_10657302 3300010375 Bacteria 1197
228 Ga0105246_10003465 3300011119 Bacteria 9563
229 Ga0105246_10050571 3300011119 Bacteria 2851
230 Ga0105246_10052177 3300011119 Bacteria 2810
231 Ga0105246_10500201 3300011119 Bacteria 1032
232 Ga0105246_10730467 3300011119 Unclassified 871
233 Ga0105246_10833750 3300011119 Bacteria 821
234 Ga0157373_10600097 3300013100 Bacteria 801
235 Ga0157371_10306114 3300013102 Bacteria 1151
236 Ga0157371_10640356 3300013102 Bacteria 793
237 Ga0157370_10002972 3300013104 Bacteria 20158
238 Ga0157370_10004359 3300013104 Bacteria 16244
239 Ga0157370_10006336 3300013104 Bacteria 13075
240 Ga0157370_10043236 3300013104 Bacteria 4336
241 Ga0157370_10176756 3300013104 Bacteria 1984
242 Ga0157370_10385951 3300013104 Bacteria 1290
243 Ga0157370_10483810 3300013104 Bacteria 1137
244 Ga0157370_10488043 3300013104 Unclassified 1132
245 Ga0157369_10001061 3300013105 Bacteria 34642
246 Ga0157369_10001514 3300013105 Bacteria 28521
247 Ga0157369_10017524 3300013105 Bacteria 8049
248 Ga0157369_10041321 3300013105 Bacteria 5034
249 Ga0157369_10071019 3300013105 Bacteria 3739
250 Ga0157369_10282205 3300013105 Bacteria 1729
251 Ga0157369_10717259 3300013105 Bacteria 1029
252 Ga0157374_10004840 3300013296 Bacteria 11304
253 Ga0157374_10034649 3300013296 Bacteria 4614
254 Ga0157374_10079400 3300013296 Bacteria 3110
255 Ga0157374_10203538 3300013296 Bacteria 1939
256 Ga0157374_10391634 3300013296 Unclassified 1385
257 Ga0157378_10003953 3300013297 Bacteria 13093
258 Ga0157378_10018534 3300013297 Bacteria 6118
259 Ga0157378_10054095 3300013297 Bacteria 3574
260 Ga0163162_10037727 3300013306 Bacteria 4823
261 Ga0163162_10043890 3300013306 Bacteria 4476
262 Ga0163162_10297298 3300013306 Bacteria 1746
263 Ga0163162_10438120 3300013306 Bacteria 1439
264 Ga0163162_11219881 3300013306 Unclassified 854
265 Ga0157372_10012797 3300013307 Bacteria 8942
266 Ga0157372_10024411 3300013307 Bacteria 6566
267 Ga0157372_10035656 3300013307 Bacteria 5477
268 Ga0157372_10050410 3300013307 Bacteria 4630
269 Ga0157372_10322522 3300013307 Bacteria 1798
270 Ga0157372_10357570 3300013307 Bacteria 1701
271 Ga0157375_10017435 3300013308 Bacteria 6480
272 Ga0157375_10086101 3300013308 Bacteria 3193
273 Ga0157375_10171946 3300013308 Bacteria 2314
274 Ga0157375_10245061 3300013308 Bacteria 1952
275 Ga0157375_10667162 3300013308 Bacteria 1195
276 Ga0157375_10757809 3300013308 Bacteria 1122
277 Ga0157375_10866129 3300013308 Bacteria 1049
278 Ga0163163_10004400 3300014325 Bacteria 12010
279 Ga0163163_10014721 3300014325 Bacteria 7196
280 Ga0163163_10041929 3300014325 Bacteria 4479
281 Ga0163163_10051117 3300014325 Bacteria 4074
282 Ga0163163_10571075 3300014325 Unclassified 1194
283 Ga0163163_11411633 3300014325 Bacteria 758
284 Ga0157379_10302415 3300014968 Bacteria 1458
285 Ga0157379_10960910 3300014968 Bacteria 813
286 Ga0157376_10027439 3300014969 Bacteria 4513
287 Ga0157376_10210798 3300014969 Bacteria 1793
288 Ga0157376_10345009 3300014969 Bacteria 1423
289 Ga0157376_10931431 3300014969 Bacteria 888
290 Ga0157376_11250551 3300014969 Unclassified 771
291 Ga0213873_10102351 3300021358 Bacteria 825
292 Ga0213874_10043439 3300021377 Bacteria 1354
293 Ga0213874_10054603 3300021377 Bacteria 1235
294 Ga0213876_10016166 3300021384 Bacteria 3944
295 Ga0213876_10247901 3300021384 Bacteria 946
296 Ga0213875_10035063 3300021388 Bacteria 2368
297 Ga0213875_10036778 3300021388 Bacteria 2308
298 Ga0213875_10086394 3300021388 Bacteria 1463
299 Ga0213875_10239142 3300021388 Bacteria 856
300 Ga0207656_10052348 3300025321 Bacteria 1768
301 Ga0207642_10376195 3300025899 Bacteria 844
302 Ga0207642_10536850 3300025899 Unclassified 720
303 Ga0207710_10029576 3300025900 Bacteria 2385
304 Ga0207680_10152578 3300025903 Bacteria 1541
305 Ga0207680_10494940 3300025903 Bacteria 870
306 Ga0207699_10074587 3300025906 Bacteria 2084
307 Ga0207645_10205206 3300025907 Bacteria 1297
308 Ga0207705_10005419 3300025909 Bacteria 9544
309 Ga0207705_10017258 3300025909 Bacteria 5168
310 Ga0207705_10148833 3300025909 Bacteria 1753
311 Ga0207684_10213049 3300025910 Bacteria 1666
312 Ga0207654_10010964 3300025911 Bacteria 4615
313 Ga0207654_10014726 3300025911 Bacteria 4045
314 Ga0207654_10036016 3300025911 Bacteria 2762
315 Ga0207707_10011044 3300025912 Bacteria 7857
316 Ga0207707_10062423 3300025912 Bacteria 3242
317 Ga0207707_10081791 3300025912 Bacteria 2819
318 Ga0207707_10087522 3300025912 Bacteria 2722
319 Ga0207707_10234244 3300025912 Bacteria 1597
320 Ga0207695_10002146 3300025913 Bacteria 29894
321 Ga0207695_10002938 3300025913 Bacteria 24585
322 Ga0207695_10003294 3300025913 Bacteria 22929
323 Ga0207695_10006140 3300025913 Bacteria 15663
324 Ga0207695_10082304 3300025913 Bacteria 3256
325 Ga0207695_10091974 3300025913 Bacteria 3046
326 Ga0207695_10208311 3300025913 Bacteria 1867
327 Ga0207695_10829961 3300025913 Unclassified 804
328 Ga0207671_10027690 3300025914 Unclassified 4237
329 Ga0207671_10042184 3300025914 Bacteria 3377
330 Ga0207671_10160005 3300025914 Unclassified 1743
331 Ga0207671_10308852 3300025914 Unclassified 1250
332 Ga0207671_10426637 3300025914 Bacteria 1055
333 Ga0207663_10055940 3300025916 Bacteria 2478
334 Ga0207663_10071388 3300025916 Bacteria 2241
335 Ga0207663_10092026 3300025916 Bacteria 2015
336 Ga0207663_10168836 3300025916 Bacteria 1552
337 Ga0207663_10235937 3300025916 Bacteria 1339
338 Ga0207660_10027354 3300025917 Bacteria 3890
339 Ga0207660_10263579 3300025917 Bacteria 1363
340 Ga0207657_10002168 3300025919 Bacteria 21257
341 Ga0207657_10021668 3300025919 Bacteria 6040
342 Ga0207657_10283105 3300025919 Unclassified 1316
343 Ga0207657_10659838 3300025919 Bacteria 814
344 Ga0207649_10175176 3300025920 Bacteria 1497
345 Ga0207649_10445550 3300025920 Bacteria 976
346 Ga0207652_10015619 3300025921 Bacteria 6180
347 Ga0207652_10035197 3300025921 Bacteria 4225
348 Ga0207652_10169287 3300025921 Unclassified 1960
349 Ga0207652_10179561 3300025921 Bacteria 1902
350 Ga0207652_10274441 3300025921 Bacteria 1521
351 Ga0207652_10598502 3300025921 Bacteria 989
352 Ga0207652_11052866 3300025921 Bacteria 713
353 Ga0207652_11164652 3300025921 Unclassified 672
354 Ga0207694_10020969 3300025924 Bacteria 4946
355 Ga0207694_10023690 3300025924 Bacteria 4661
356 Ga0207694_10028083 3300025924 Bacteria 4289
357 Ga0207694_10028119 3300025924 Bacteria 4286
358 Ga0207694_10042380 3300025924 Bacteria 3511
359 Ga0207694_10083036 3300025924 Bacteria 2519
360 Ga0207694_10144992 3300025924 Bacteria 1911
361 Ga0207694_10458654 3300025924 Bacteria 1064
362 Ga0207687_10001622 3300025927 Bacteria 15504
363 Ga0207687_10002789 3300025927 Bacteria 11849
364 Ga0207687_10010970 3300025927 Bacteria 5921
365 Ga0207687_10044259 3300025927 Bacteria 3071
366 Ga0207687_10091738 3300025927 Bacteria 2216
367 Ga0207687_10245778 3300025927 Bacteria 1420
368 Ga0207687_10279645 3300025927 Bacteria 1337
369 Ga0207687_10308132 3300025927 Bacteria 1277
370 Ga0207687_10413166 3300025927 Bacteria 1112
371 Ga0207687_10490755 3300025927 Bacteria 1024
372 Ga0207700_10000532 3300025928 Bacteria 22353
373 Ga0207700_10238734 3300025928 Bacteria 1548
374 Ga0207700_10755818 3300025928 Bacteria 869
375 Ga0207700_11116678 3300025928 Bacteria 705
376 Ga0207700_11364454 3300025928 Bacteria 631
377 Ga0207664_10026687 3300025929 Bacteria 4368
378 Ga0207664_10027394 3300025929 Bacteria 4320
379 Ga0207644_10062762 3300025931 Bacteria 2696
380 Ga0207644_10097262 3300025931 Bacteria 2205
381 Ga0207690_10589012 3300025932 Bacteria 907
382 Ga0207706_10028264 3300025933 Bacteria 5009
383 Ga0207686_10011817 3300025934 Bacteria 4789
384 Ga0207686_10101826 3300025934 Bacteria 1919
385 Ga0207686_10238994 3300025934 Unclassified 1321
386 Ga0207686_10325067 3300025934 Bacteria 1151
387 Ga0207686_10590476 3300025934 Bacteria 873
388 Ga0207670_10258184 3300025936 Bacteria 1349
389 Ga0207670_10311851 3300025936 Bacteria 1235
390 Ga0207704_10009986 3300025938 Bacteria 4607
391 Ga0207704_10014407 3300025938 Bacteria 3990
392 Ga0207704_10038120 3300025938 Bacteria 2784
393 Ga0207711_10007923 3300025941 Bacteria 8886
394 Ga0207711_10013954 3300025941 Bacteria 6672
395 Ga0207711_10191418 3300025941 Bacteria 1864
396 Ga0207711_10298740 3300025941 Bacteria 1485
397 Ga0207711_10655493 3300025941 Unclassified 979
398 Ga0207689_10044590 3300025942 Bacteria 3667
399 Ga0207689_10491134 3300025942 Bacteria 1028
400 Ga0207661_10010202 3300025944 Bacteria 6755
401 Ga0207661_10045366 3300025944 Bacteria 3479
402 Ga0207661_10062819 3300025944 Bacteria 3006
403 Ga0207661_10128891 3300025944 Bacteria 2164
404 Ga0207661_10169256 3300025944 Bacteria 1901
405 Ga0207661_10232079 3300025944 Bacteria 1634
406 Ga0207661_11096984 3300025944 Unclassified 733
407 Ga0207679_10015137 3300025945 Bacteria 5088
408 Ga0207679_10354945 3300025945 Bacteria 1279
409 Ga0207667_10000290 3300025949 Bacteria 69361
410 Ga0207667_10002700 3300025949 Bacteria 21961
411 Ga0207667_10038210 3300025949 Bacteria 5128
412 Ga0207667_10106827 3300025949 Bacteria 2887
413 Ga0207667_10131542 3300025949 Bacteria 2577
414 Ga0207667_10246315 3300025949 Bacteria 1829
415 Ga0207667_10321490 3300025949 Bacteria 1580
416 Ga0207667_10382029 3300025949 Bacteria 1435
417 Ga0207712_10012192 3300025961 Bacteria 5491
418 Ga0207712_10017576 3300025961 Bacteria 4647
419 Ga0207712_10061986 3300025961 Bacteria 2656
420 Ga0207677_10004490 3300026023 Bacteria 7501
421 Ga0207677_10031135 3300026023 Bacteria 3414
422 Ga0207677_10496314 3300026023 Bacteria 1054
423 Ga0207677_11124483 3300026023 Unclassified 717
424 Ga0207703_10012502 3300026035 Bacteria 6617
425 Ga0207703_10015872 3300026035 Bacteria 5875
426 Ga0207703_10019141 3300026035 Bacteria 5347
427 Ga0207703_10097468 3300026035 Bacteria 2484
428 Ga0207703_10100761 3300026035 Bacteria 2448
429 Ga0207703_10135058 3300026035 Bacteria 2135
430 Ga0207703_10656354 3300026035 Bacteria 995
431 Ga0207639_10025331 3300026041 Bacteria 4301
432 Ga0207639_10166248 3300026041 Bacteria 1864
433 Ga0207639_10673291 3300026041 Bacteria 958
434 Ga0207639_10855455 3300026041 Bacteria 849
435 Ga0207678_10013821 3300026067 Bacteria 7094
436 Ga0207708_10775035 3300026075 Unclassified 824
437 Ga0207702_10067179 3300026078 Bacteria 3076
438 Ga0207702_10074523 3300026078 Bacteria 2930
439 Ga0207702_10076405 3300026078 Bacteria 2895
440 Ga0207702_10132817 3300026078 Bacteria 2242
441 Ga0207702_10639285 3300026078 Unclassified 1046
442 Ga0207702_10744181 3300026078 Bacteria 967
443 Ga0207702_11679194 3300026078 Unclassified 628
444 Ga0207648_10016825 3300026089 Bacteria 6668
445 Ga0207648_10029836 3300026089 Bacteria 4836
446 Ga0207648_10056696 3300026089 Bacteria 3418
447 Ga0207648_10188428 3300026089 Bacteria 1827
448 Ga0207648_10224153 3300026089 Bacteria 1671
449 Ga0207676_10570841 3300026095 Unclassified 1083
450 Ga0207676_10619006 3300026095 Bacteria 1042
451 Ga0207676_11119538 3300026095 Bacteria 779
452 Ga0207674_10001670 3300026116 Bacteria 28551
453 Ga0207674_10011229 3300026116 Bacteria 10065
454 Ga0207674_10033329 3300026116 Bacteria 5393
455 Ga0207674_10270134 3300026116 Bacteria 1648
456 Ga0207674_10373972 3300026116 Bacteria 1377
457 Ga0207683_10278358 3300026121 Bacteria 1529
458 Ga0207683_10813212 3300026121 Bacteria 867
459 Ga0207698_10025632 3300026142 Bacteria 4157
460 Ga0207698_10038820 3300026142 Bacteria 3521
461 Ga0207698_11235699 3300026142 Bacteria 761
462 Ga0268266_10016891 3300028379 Bacteria 6236
463 Ga0268266_10455190 3300028379 Bacteria 1217
464 Ga0268264_10019195 3300028381 Bacteria 5587
465 Ga0268264_10079133 3300028381 Bacteria 2804
466 Ga0265338_10174441 3300028800 Bacteria 1645
467 Ga0265338_10245172 3300028800 Bacteria 1325
468 Ga0265338_10297893 3300028800 Bacteria 1173
469 Ga0265328_10222403 3300031239 Unclassified 719
470 Ga0265325_10224916 3300031241 Unclassified 857
471 Ga0265331_10118865 3300031250 Bacteria 1209
472 Ga0265313_10006759 3300031595 Bacteria 8023
473 Ga0265313_10114296 3300031595 Bacteria 1184
474 Ga0265314_10007594 3300031711 Bacteria 9387
475 Ga0265314_10025967 3300031711 Bacteria 4409
476 Ga0307406_10701150 3300031901 Bacteria 845
477 Ga0373934_0052952 3300035086 Bacteria 1610
478 Ga0373941_0031005 3300035115 Bacteria 1590
479 Ga0373953_0072749 3300035117 Bacteria 1420
480 Ga0373953_0327902 3300035117 Unclassified 669
481 Ga0373954_0287231 3300035118 Bacteria 811
482 Ga0373956_0257598 3300035119 Bacteria 829
483 Ga0373957_0196903 3300035120 Bacteria 839
484 Ga0373946_0021810 3300035171 Bacteria 2487
485 Ga0373955_0453696 3300035172 Bacteria 781
486 Ga0373955_0504079 3300035172 Bacteria 739
487 Ga0373955_0580896 3300035172 Bacteria 686
488 Ga0373935_0010626 3300035692 Bacteria 5526
489 Ga0373935_0176148 3300035692 Bacteria 1466
490 Ga0373927_0001164 3300035695 Bacteria 19889
491 Ga0373927_0002121 3300035695 Bacteria 14614
492 Ga0373927_0118427 3300035695 Bacteria 1728
493 Ga0373927_0676363 3300035695 Unclassified 682
494 Ga0373933_0068218 3300035724 Bacteria 2160
495 Ga0373947_0000671 3300035725 Bacteria 20338
496 Ga0373947_0203195 3300035725 Bacteria 1297
497 Ga0373937_0019689 3300036401 Bacteria 6044
498 Ga0373937_0134192 3300036401 Bacteria 2314
499 Ga0373937_0238321 3300036401 Bacteria 1714
500 Ga0373937_0247370 3300036401 Bacteria 1681
501 Ga0373937_0333172 3300036401 Bacteria 1437
502 Ga0373925_0000163 3300037068 Bacteria 71614
503 Ga0373925_0051106 3300037068 Bacteria 3085
504 Ga0373925_0567094 3300037068 Bacteria 934
505 Ga0373925_0995433 3300037068 Bacteria 690
506 Ga0436364_0025286 3300037853 Bacteria 1949
507 Ga0436364_0526588 3300037853 Bacteria 938
508 Ga0436364_0546176 3300037853 Bacteria 8833
509 Ga0436364_0587740 3300037853 Bacteria 3623
510 Ga0436364_0679437 3300037853 Bacteria 1035
511 Ga0436364_0741491 3300037853 Bacteria 3578
512 Ga0436364_0799077 3300037853 Bacteria 5024
513 Ga0436364_0971882 3300037853 Bacteria 865
514 Ga0436364_0985483 3300037853 Bacteria 19444
515 Ga0436364_1065030 3300037853 Bacteria 28547
516 Ga0436364_1407089 3300037853 Bacteria 910
517 Ga0436364_1477067 3300037853 Bacteria 1951
518 Ga0436364_1500419 3300037853 Unclassified 785
519 Ga0436365_0036425 3300039437 Bacteria 1235
520 Ga0436365_0501870 3300039437 Bacteria 7471
521 Ga0436365_0695711 3300039437 Bacteria 3282
522 Ga0436365_1147266 3300039437 Bacteria 1643
523 Ga0436365_1334419 3300039437 Unclassified 792
524 Ga0436365_1655364 3300039437 Bacteria 1307
525 Ga0436365_1663589 3300039437 Bacteria 1248
526 Ga0436365_1731472 3300039437 Bacteria 762
527 Ga0436365_1929563 3300039437 Bacteria 623
528 Ga0436360_0923887 3300039438 Bacteria 8201
529 Ga0436363_0002230 3300039450 Bacteria 1284
530 Ga0436362_0132137 3300039453 Bacteria 2158
531 Ga0436362_0231937 3300039453 Bacteria 2140
532 Ga0436362_0675257 3300039453 Bacteria 981
533 Ga0466970_0566366 3300044765 Unclassified 657
534 Ga0451576_0584388 3300045051 Bacteria 1174
535 Ga0451576_1127994 3300045051 Unclassified 820
536 Ga0495592_0151743 3300046454 Bacteria 1602
537 Ga0495580_0026829 3300046472 Bacteria 4196
538 Ga0495580_0081724 3300046472 Bacteria 2252
539 Ga0495580_0263298 3300046472 Bacteria 1179
540 Ga0495580_0394525 3300046472 Bacteria 934
541 Ga0495594_0300251 3300046499 Bacteria 915
542 Ga0495594_0462056 3300046499 Unclassified 721
543 Ga0495652_0017834 3300046529 Bacteria 6336
544 Ga0495640_0523910 3300046533 Bacteria 720
545 Ga0495586_0357661 3300046535 Bacteria 839
546 Ga0495587_0000640 3300046536 Bacteria 23483
547 Ga0495587_0123773 3300046536 Bacteria 1480
548 Ga0495599_0004509 3300046678 Bacteria 8258
549 Ga0495623_0337574 3300046679 Bacteria 824
550 Ga0495658_0335670 3300046683 Bacteria 959
551 Ga0495674_0025592 3300047319 Bacteria 5409
552 Ga0495674_0884648 3300047319 Bacteria 690
553 Ga0495674_1084254 3300047319 Bacteria 610
554 Ga0495675_0256288 3300047444 Bacteria 1049
555 Ga0495602_0517944 3300048088 Bacteria 831
556 Ga0496104_0402200 3300048907 Unclassified 1282
557 Ga0496112_0026466 3300048915 Bacteria 5582
558 Ga0496114_0411317 3300048917 Bacteria 1198
559 Ga0496114_0922893 3300048917 Bacteria 755
560 Ga0496115_0245562 3300048918 Bacteria 1475
561 Ga0496126_0047732 3300048929 Bacteria 3919
562 Ga0501034_0031346 3300049571 Bacteria 5401
563 Ga0501039_0593310 3300049575 Bacteria 868
564 Ga0501046_0147812 3300049580 Bacteria 1774
565 Ga0501047_0026093 3300049581 Bacteria 5619
566 Ga0501047_0405414 3300049581 Unclassified 1196
567 Ga0501073_0027097 3300049589 Bacteria 4102
568 Ga0501074_0241139 3300049590 Unclassified 1286
569 Ga0501270_006850 3300049767 Bacteria 1387
570 Ga0501044_0002405 3300049823 Bacteria 21347
571 nmdc:mga05p37_391203_c1 3300050507 Bacteria 1626
572 nmdc:mga05p37_563388_c1 3300050507 Bacteria 1294
573 nmdc:mga09592_68939_c1 3300050508 Bacteria 3000
574 nmdc:mga09592_881209_c1 3300050508 Bacteria 753
575 nmdc:mga06r32_184128_c1 3300050510 Bacteria 2075
576 nmdc:mga06r32_93604_c1 3300050510 Bacteria 2939
577 nmdc:mga08x19_7164_c1 3300050514 Bacteria 6625
578 Ga0495612_0042461 3300053078 Bacteria 1856
579 Ga0501082_0001662 3300060353 Bacteria 19587
580 Ga0070717_10006594
581 Ga0070658_10057173
582 Ga0070658_10874798
583 Ga0070676_10278097
584 Ga0070683_100005281
585 Ga0070683_100049278
586 Ga0070683_100526910
587 Ga0070677_10397773
588 Ga0068869_100270484
589 Ga0068869_100427228
590 Ga0070666_10028206
591 Ga0070666_10347579
592 Ga0070666_10586576
593 Ga0070680_100140939
594 Ga0070680_100716052
595 Ga0068868_100029326
596 Ga0068868_100279973
597 Ga0070660_100033705
598 Ga0070660_100034660
599 Ga0070660_100107772
600 Ga0070660_100314274
601 Ga0070689_100299141
602 Ga0070661_100040562
603 Ga0070671_100017534
604 Ga0070671_100026304
605 Ga0070673_100028501
606 Ga0070673_100819919
607 Ga0070659_100879778
608 Ga0070667_100177652
609 Ga0070667_100714548
610 Ga0070709_10059553
611 Ga0070714_100000715
612 Ga0070714_100056472
613 Ga0070714_100334766
614 Ga0070713_100000906
615 Ga0070713_100017013
616 Ga0070713_100626292
617 Ga0070713_100817682
618 Ga0070711_100007658
619 Ga0070711_100100018
620 Ga0070678_100319649
621 Ga0070662_100013546
622 Ga0070681_10048406
623 Ga0070681_10083737
624 Ga0070681_10149977
625 Ga0070681_10155838
626 Ga0070681_10308265
627 Ga0070681_10832181
628 Ga0068867_100031040
629 Ga0068867_100045080
630 Ga0068867_100457733
631 Ga0068867_100782407
632 Ga0070699_100199011
633 Ga0070679_100016018
634 Ga0070679_100019809
635 Ga0070679_100053121
636 Ga0070684_100006884
637 Ga0070684_100037870
638 Ga0070684_100043486
639 Ga0070684_100044805
640 Ga0070684_100092697
641 Ga0070684_100154222
642 Ga0070684_100174691
643 Ga0070684_100965871
644 Ga0068853_100061529
645 Ga0068853_100108151
646 Ga0068853_100956913
647 Ga0068853_101220789
648 Ga0070695_100019282
649 Ga0070695_100108421
650 Ga0070695_100223716
651 Ga0070695_100312512
652 Ga0070693_100166297
653 Ga0070665_100013667
654 Ga0070665_100395801
655 Ga0070665_100712685
656 Ga0070665_101001734
657 Ga0070704_100792865
658 Ga0068855_100002831
659 Ga0068855_100017703
660 Ga0068855_100041212
661 Ga0068855_100070680
662 Ga0068855_100344716
663 Ga0068855_100348570
664 Ga0068855_100349984
665 Ga0070664_100095957
666 Ga0070664_100323171
667 Ga0070664_100391417
668 Ga0070664_100571113
669 Ga0068857_100004524
670 Ga0068857_100012957
671 Ga0068857_100038590
672 Ga0068857_100310594
673 Ga0068854_100031037
674 Ga0068854_100476360
675 Ga0068856_100030889
676 Ga0068856_100044343
677 Ga0068856_100057924
678 Ga0068856_100073391
679 Ga0068856_100312180
680 Ga0068856_100384736
681 Ga0068856_100953620
682 Ga0068852_100285621
683 Ga0068859_100018317
684 Ga0068859_100148927
685 Ga0068864_100232662
686 Ga0068864_100894075
687 Ga0068866_10065991
688 Ga0068851_10116794
689 Ga0068851_10527057
690 Ga0068863_100242026
691 Ga0068858_100008312
692 Ga0068858_100015487
693 Ga0068858_100127763
694 Ga0068858_100165225
695 Ga0068858_100321945
696 Ga0068858_100709657
697 Ga0068860_100017905
698 Ga0068860_100041270
699 Ga0068860_100301192
700 Ga0068860_100508957
701 Ga0081539_10056209
702 Ga0070717_10197117
703 Ga0070717_10302964
704 Ga0097621_100007365
705 Ga0097621_100106620
706 Ga0097621_100135442
707 Ga0097621_100355051
708 Ga0097621_100505092
709 Ga0068871_100011638
710 Ga0068871_100027800
711 Ga0068871_100031825
712 Ga0068871_100111868
713 Ga0068871_100127795
714 Ga0068871_100159972
715 Ga0068871_100214934
716 Ga0068871_101098433
717 Ga0068871_101558819
718 Ga0075431_100017970
719 Ga0075429_101004572
720 Ga0068865_100005242
721 Ga0068865_100015691
722 Ga0068865_100316009
723 Ga0075436_100002682
724 Ga0097620_100018317
725 Ga0097620_100148930
726 Ga0105240_10000394
727 Ga0105240_10001861
728 Ga0105240_10002259
729 Ga0105240_10030019
730 Ga0105240_10064499
731 Ga0105240_10130287
732 Ga0105240_10132369
733 Ga0105240_10177801
734 Ga0105240_10801057
735 Ga0105245_10000827
736 Ga0105245_10001486
737 Ga0105245_10015223
738 Ga0105245_10059060
739 Ga0105245_10089427
740 Ga0105245_10127618
741 Ga0105245_10269851
742 Ga0105245_10311079
743 Ga0105245_10575298
744 Ga0105245_10608722
745 Ga0105245_10839509
746 Ga0105245_11338560
747 Ga0105247_10169701
748 Ga0114129_10025980
749 Ga0114129_10222165
750 Ga0114129_10425975
751 Ga0114129_11837419
752 Ga0105241_10000998
753 Ga0105241_10004783
754 Ga0105241_10019328
755 Ga0105241_10061455
756 Ga0105241_10156461
757 Ga0105241_10786750
758 Ga0105241_11469361
759 Ga0105242_10005892
760 Ga0105242_10012732
761 Ga0105242_10012939
762 Ga0105242_10026958
763 Ga0105242_10060698
764 Ga0105242_10329633
765 Ga0105242_10344061
766 Ga0105242_10370801
767 Ga0105242_10407953
768 Ga0105242_10688689
769 Ga0105248_10007047
770 Ga0105248_10016678
771 Ga0105248_10037541
772 Ga0105248_10074785
773 Ga0105248_10136871
774 Ga0105248_10292927
775 Ga0105248_10315312
776 Ga0105248_10478793
777 Ga0105248_10553164
778 Ga0105248_11270690
779 Ga0105248_11895543
780 Ga0105237_10001090
781 Ga0105237_10004471
782 Ga0105237_10032759
783 Ga0105237_10034090
784 Ga0105237_10040832
785 Ga0105237_10300691
786 Ga0105237_10763167
787 Ga0105238_10004740
788 Ga0105238_10013247
789 Ga0105238_10018287
790 Ga0105238_10019159
791 Ga0105238_10027937
792 Ga0105238_10029699
793 Ga0105238_10038819
794 Ga0105238_10206034
795 Ga0105238_10225174
796 Ga0105238_10262638
797 Ga0105249_10016720
798 Ga0105249_10027955
799 Ga0105249_10129097
800 Ga0105249_10415156
801 Ga0105249_10415963
802 Ga0105239_10004394
803 Ga0105239_10006490
804 Ga0105239_10016236
805 Ga0105239_10068655
806 Ga0105239_10657302
807 Ga0105246_10003465
808 Ga0105246_10050571
809 Ga0105246_10052177
810 Ga0105246_10500201
811 Ga0105246_10730467
812 Ga0105246_10833750
813 Ga0157373_10600097
814 Ga0157371_10306114
815 Ga0157371_10640356
816 Ga0157370_10002972
817 Ga0157370_10004359
818 Ga0157370_10006336
819 Ga0157370_10043236
820 Ga0157370_10176756
821 Ga0157370_10385951
822 Ga0157370_10483810
823 Ga0157370_10488043
824 Ga0157369_10001061
825 Ga0157369_10001514
826 Ga0157369_10017524
827 Ga0157369_10041321
828 Ga0157369_10071019
829 Ga0157369_10282205
830 Ga0157369_10717259
831 Ga0157374_10004840
832 Ga0157374_10034649
833 Ga0157374_10079400
834 Ga0157374_10203538
835 Ga0157374_10391634
836 Ga0157378_10003953
837 Ga0157378_10018534
838 Ga0157378_10054095
839 Ga0163162_10037727
840 Ga0163162_10043890
841 Ga0163162_10297298
842 Ga0163162_10438120
843 Ga0163162_11219881
844 Ga0157372_10012797
845 Ga0157372_10024411
846 Ga0157372_10035656
847 Ga0157372_10050410
848 Ga0157372_10322522
849 Ga0157372_10357570
850 Ga0157375_10017435
851 Ga0157375_10086101
852 Ga0157375_10171946
853 Ga0157375_10245061
854 Ga0157375_10667162
855 Ga0157375_10757809
856 Ga0157375_10866129
857 Ga0163163_10004400
858 Ga0163163_10014721
859 Ga0163163_10041929
860 Ga0163163_10051117
861 Ga0163163_10571075
862 Ga0163163_11411633
863 Ga0157379_10302415
864 Ga0157379_10960910
865 Ga0157376_10027439
866 Ga0157376_10210798
867 Ga0157376_10345009
868 Ga0157376_10931431
869 Ga0157376_11250551
870 Ga0213873_10102351
871 Ga0213874_10043439
872 Ga0213874_10054603
873 Ga0213876_10016166
874 Ga0213876_10247901
875 Ga0213875_10035063
876 Ga0213875_10036778
877 Ga0213875_10086394
878 Ga0213875_10239142
879 Ga0207656_10052348
880 Ga0207642_10376195
881 Ga0207642_10536850
882 Ga0207710_10029576
883 Ga0207680_10152578
884 Ga0207680_10494940
885 Ga0207699_10074587
886 Ga0207645_10205206
887 Ga0207705_10005419
888 Ga0207705_10017258
889 Ga0207705_10148833
890 Ga0207684_10213049
891 Ga0207654_10010964
892 Ga0207654_10014726
893 Ga0207654_10036016
894 Ga0207707_10011044
895 Ga0207707_10062423
896 Ga0207707_10081791
897 Ga0207707_10087522
898 Ga0207707_10234244
899 Ga0207695_10002146
900 Ga0207695_10002938
901 Ga0207695_10003294
902 Ga0207695_10006140
903 Ga0207695_10082304
904 Ga0207695_10091974
905 Ga0207695_10208311
906 Ga0207695_10829961
907 Ga0207671_10027690
908 Ga0207671_10042184
909 Ga0207671_10160005
910 Ga0207671_10308852
911 Ga0207671_10426637
912 Ga0207663_10055940
913 Ga0207663_10071388
914 Ga0207663_10092026
915 Ga0207663_10168836
916 Ga0207663_10235937
917 Ga0207660_10027354
918 Ga0207660_10263579
919 Ga0207657_10002168
920 Ga0207657_10021668
921 Ga0207657_10283105
922 Ga0207657_10659838
923 Ga0207649_10175176
924 Ga0207649_10445550
925 Ga0207652_10015619
926 Ga0207652_10035197
927 Ga0207652_10169287
928 Ga0207652_10179561
929 Ga0207652_10274441
930 Ga0207652_10598502
931 Ga0207652_11052866
932 Ga0207652_11164652
933 Ga0207694_10020969
934 Ga0207694_10023690
935 Ga0207694_10028083
936 Ga0207694_10028119
937 Ga0207694_10042380
938 Ga0207694_10083036
939 Ga0207694_10144992
940 Ga0207694_10458654
941 Ga0207687_10001622
942 Ga0207687_10002789
943 Ga0207687_10010970
944 Ga0207687_10044259
945 Ga0207687_10091738
946 Ga0207687_10245778
947 Ga0207687_10279645
948 Ga0207687_10308132
949 Ga0207687_10413166
950 Ga0207687_10490755
951 Ga0207700_10000532
952 Ga0207700_10238734
953 Ga0207700_10755818
954 Ga0207700_11116678
955 Ga0207700_11364454
956 Ga0207664_10026687
957 Ga0207664_10027394
958 Ga0207644_10062762
959 Ga0207644_10097262
960 Ga0207690_10589012
961 Ga0207706_10028264
962 Ga0207686_10011817
963 Ga0207686_10101826
964 Ga0207686_10238994
965 Ga0207686_10325067
966 Ga0207686_10590476
967 Ga0207670_10258184
968 Ga0207670_10311851
969 Ga0207704_10009986
970 Ga0207704_10014407
971 Ga0207704_10038120
972 Ga0207711_10007923
973 Ga0207711_10013954
974 Ga0207711_10191418
975 Ga0207711_10298740
976 Ga0207711_10655493
977 Ga0207689_10044590
978 Ga0207689_10491134
979 Ga0207661_10010202
980 Ga0207661_10045366
981 Ga0207661_10062819
982 Ga0207661_10128891
983 Ga0207661_10169256
984 Ga0207661_10232079
985 Ga0207661_11096984
986 Ga0207679_10015137
987 Ga0207679_10354945
988 Ga0207667_10000290
989 Ga0207667_10002700
990 Ga0207667_10038210
991 Ga0207667_10106827
992 Ga0207667_10131542
993 Ga0207667_10246315
994 Ga0207667_10321490
995 Ga0207667_10382029
996 Ga0207712_10012192
997 Ga0207712_10017576
998 Ga0207712_10061986
999 Ga0207677_10004490
1000 Ga0207677_10031135
1001 Ga0207677_10496314
1002 Ga0207677_11124483
1003 Ga0207703_10012502
1004 Ga0207703_10015872
1005 Ga0207703_10019141
1006 Ga0207703_10097468
1007 Ga0207703_10100761
1008 Ga0207703_10135058
1009 Ga0207703_10656354
1010 Ga0207639_10025331
1011 Ga0207639_10166248
1012 Ga0207639_10673291
1013 Ga0207639_10855455
1014 Ga0207678_10013821
1015 Ga0207708_10775035
1016 Ga0207702_10067179
1017 Ga0207702_10074523
1018 Ga0207702_10076405
1019 Ga0207702_10132817
1020 Ga0207702_10639285
1021 Ga0207702_10744181
1022 Ga0207702_11679194
1023 Ga0207648_10016825
1024 Ga0207648_10029836
1025 Ga0207648_10056696
1026 Ga0207648_10188428
1027 Ga0207648_10224153
1028 Ga0207676_10570841
1029 Ga0207676_10619006
1030 Ga0207676_11119538
1031 Ga0207674_10001670
1032 Ga0207674_10011229
1033 Ga0207674_10033329
1034 Ga0207674_10270134
1035 Ga0207674_10373972
1036 Ga0207683_10278358
1037 Ga0207683_10813212
1038 Ga0207698_10025632
1039 Ga0207698_10038820
1040 Ga0207698_11235699
1041 Ga0268266_10016891
1042 Ga0268266_10455190
1043 Ga0268264_10019195
1044 Ga0268264_10079133
1045 Ga0265338_10174441
1046 Ga0265338_10245172
1047 Ga0265338_10297893
1048 Ga0265328_10222403
1049 Ga0265325_10224916
1050 Ga0265331_10118865
1051 Ga0265313_10006759
1052 Ga0265313_10114296
1053 Ga0265314_10007594
1054 Ga0265314_10025967
1055 Ga0307406_10701150
1056 Ga0373934_0052952
1057 Ga0373941_0031005
1058 Ga0373953_0072749
1059 Ga0373953_0327902
1060 Ga0373954_0287231
1061 Ga0373956_0257598
1062 Ga0373957_0196903
1063 Ga0373946_0021810
1064 Ga0373955_0453696
1065 Ga0373955_0504079
1066 Ga0373955_0580896
1067 Ga0373935_0010626
1068 Ga0373935_0176148
1069 Ga0373927_0001164
1070 Ga0373927_0002121
1071 Ga0373927_0118427
1072 Ga0373927_0676363
1073 Ga0373933_0068218
1074 Ga0373947_0000671
1075 Ga0373947_0203195
1076 Ga0373937_0019689
1077 Ga0373937_0134192
1078 Ga0373937_0238321
1079 Ga0373937_0247370
1080 Ga0373937_0333172
1081 Ga0373925_0000163
1082 Ga0373925_0051106
1083 Ga0373925_0567094
1084 Ga0373925_0995433
1085 Ga0436364_0025286
1086 Ga0436364_0526588
1087 Ga0436364_0546176
1088 Ga0436364_0587740
1089 Ga0436364_0679437
1090 Ga0436364_0741491
1091 Ga0436364_0799077
1092 Ga0436364_0971882
1093 Ga0436364_0985483
1094 Ga0436364_1065030
1095 Ga0436364_1407089
1096 Ga0436364_1477067
1097 Ga0436364_1500419
1098 Ga0436365_0036425
1099 Ga0436365_0501870
1100 Ga0436365_0695711
1101 Ga0436365_1147266
1102 Ga0436365_1334419
1103 Ga0436365_1655364
1104 Ga0436365_1663589
1105 Ga0436365_1731472
1106 Ga0436365_1929563
1107 Ga0436360_0923887
1108 Ga0436363_0002230
1109 Ga0436362_0132137
1110 Ga0436362_0231937
1111 Ga0436362_0675257
1112 Ga0466970_0566366
1113 Ga0451576_0584388
1114 Ga0451576_1127994
1115 Ga0495592_0151743
1116 Ga0495580_0026829
1117 Ga0495580_0081724
1118 Ga0495580_0263298
1119 Ga0495580_0394525
1120 Ga0495594_0300251
1121 Ga0495594_0462056
1122 Ga0495652_0017834
1123 Ga0495640_0523910
1124 Ga0495586_0357661
1125 Ga0495587_0000640
1126 Ga0495587_0123773
1127 Ga0495599_0004509
1128 Ga0495623_0337574
1129 Ga0495658_0335670
1130 Ga0495674_0025592
1131 Ga0495674_0884648
1132 Ga0495674_1084254
1133 Ga0495675_0256288
1134 Ga0495602_0517944
1135 Ga0496104_0402200
1136 Ga0496112_0026466
1137 Ga0496114_0411317
1138 Ga0496114_0922893
1139 Ga0496115_0245562
1140 Ga0496126_0047732
1141 Ga0501034_0031346
1142 Ga0501039_0593310
1143 Ga0501046_0147812
1144 Ga0501047_0026093
1145 Ga0501047_0405414
1146 Ga0501073_0027097
1147 Ga0501074_0241139
1148 Ga0501270_006850
1149 Ga0501044_0002405
1150 nmdc:mga05p37_391203_c1
1151 nmdc:mga05p37_563388_c1
1152 nmdc:mga09592_68939_c1
1153 nmdc:mga09592_881209_c1
1154 nmdc:mga06r32_184128_c1
1155 nmdc:mga06r32_93604_c1
1156 nmdc:mga08x19_7164_c1
1157 Ga0495612_0042461
1158 Ga0501082_0001662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

41

201

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejk-assembly1.cif.gz_A-2 crystal structure of dtdp sugar isomerase (yp_390184.1) from desulfovibrio desulfuricans g20 at 1.95 a resolution 0.91 25 180
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9069 70 158
5fli-assembly1.cif.gz_K enzyme-substrate complex of ni-quercetinase 0.9056 70 157
4fbf-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant 0.8909 70 158
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.8821 70 158
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9059 68 159 2.60.120.10
3ejkA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9019 25 180 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8832 63 169 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8712 67 169 2.60.120.10
af_Q84TL6_200_363_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8658 68 161 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7C3E9M6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9717 78 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3S1SLE7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.9682 72 170 GO:0000271
GO:0005829
GO:0008830
AF-X0ZMI9-F1-model_v4 ATP-dependent DNA helicase RecG C-terminal domain-containing protein 0.9677 74 163 GO:0008830
AF-A0A1G0IZ64-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.9647 72 185 GO:0000271
GO:0005829
GO:0008830
AF-A0A382X6E8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9633 70 180 GO:0008830

Map